Alignment of GFA1/YKL104C and PDB 4AMV (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GFA1/YKL104C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GFA1/YKL104C and PDB protein 4AMV (chain B)Jump to
Structure
Alignment Details
GFA1 length = 718 aaAlignment Length = 717 aa (99.9%)P-value = 2.0e-96%Identity = 37%Similar = 17
Alignment Position

Sequence Alignment

GFA1

1

MCGIFGYCNYLVERSRGEIIDTLVDGLQRLEYRGYDSTGIAIDGDEADSTFIYKQIGKVS

60






MCGI G + +R EI L++GL+RLEYRGYDS G+A+ E T + +++GKV


4AMV_(B)

1

MCGIVGA---IAQRDVAEI---LLEGLRRLEYRGYDSAGLAVVDAEGHMTRL-RRLGKVQ

53

GFA1

61

ALKEEITKQNPNRDVTFVSHCGIAHTRWATHGRPEQVNCHPQRSDPEDQFVVVHNGIITN

120






L + +++P T GIAHTRWATHG P +VN HP S+ VVVHNGII N


4AMV_(B)

54

MLAQA-AEEHPLHGGT-----GIAHTRWATHGEPSEVNAHPHVSE---HIVVVHNGIIEN

104

GFA1

121

FRELKTLLINKGYKFESDTDTECIAKLYLHLYNTNLQNGHDLDFHELTKLVLLELEGSYG

180






L+ L +GY F S+TDTE IA HL N L+ G L E + +L G+YG


4AMV_(B)

105

HEPLREELKARGYTFVSETDTEVIA----HLVNWELKQGGTL--REAVLRAIPQLRGAYG

158

GFA1

181

LLCKSCHYPNEVIATRKGSPLLIGVKSEKKLKVDFVDVEFPEENAGQPEIPLKSNNKSFG

240






+ +P+ ++A R GSPL+IG+ G


4AMV_(B)

159

TVIMDSRHPDTLLAARSGSPLVIGL----------------------------------G

184

GFA1

241

LGPKKAREFEAGSQNANLLPIAANEFNLRHSQSRAFLSEDGSPTPVEFFVSSDAASVVKH

300






+G E F++SD +++


4AMV_(B)

185

MG--------------------------------------------ENFIASDQLALLPV

200

GFA1

301

TKKVLFLEDDDLAHIYDGELHIHRSRREVGASMTRSIQTLEMELAQIM--KGPYDHFMQK

358






T++ +FLE+ D+A I ++I + GA + R Q +E L KG Y H+MQK


4AMV_(B)

201

TRRFIFLEEGDIAEITRRSVNIFD---KTGAEVKR--QDIESNLQYDAGDKGIYRHYMQK

255

GFA1

359

EIYEQPESTFNTMRGRIDYENNKVILGGLKAWLPVVRRARRLIMIACGTSYHSCLATRAI

418






EIYEQP + NT+ GRI + + G A ++ + + ++ACGTSY+S + +R


4AMV_(B)

256

EIYEQPNAIKNTLTGRISHGQVDLSELGPNAD-ELLSKVEHIQILACGTSYNSGMVSRYW

314

GFA1

419

FEELSDIPVSVELASDFLDRKCPVFRDDVCVFVSQSGETADTMLALNYCLERGAL-TVGI

477






FE L+ IP VE+AS+F RK V R+ + + +SQSGETADT+ L E G L ++ I


4AMV_(B)

315

FESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGLRLSKELGYLGSLAI

374

GFA1

478

VNSVGSSISRVTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLSDDRVSKIDRRIE-

536






N GSS+ R + + NAG EIGVASTKA+T+Q L+M LS ++ +D IE


4AMV_(B)

375

CNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKLS--KLKGLDASIEH

432

GFA1

537

-IIQGLKLIPGQIKQVLKLEPRIKKLCATELKDQKSLLLLGRGYQFAAALEGALKIKEIS

595






I+ GL+ +P +I+Q+L + RI+ L A + D+ L LGRG Q+ ALEGALK+KEIS


4AMV_(B)

433

DIVHGLQALPSRIEQMLSQDKRIEAL-AEDFSDKHHALFLGRGDQYPIALEGALKLKEIS

491

GFA1

596

YMHSEGVLAGELKHGVLALVDENLPIIAFGTRDSLFPKVVSSIEQVTARKGHPIIICNEN

655






Y+H+E AGELKHG LAL+D ++P+I + L K+ S+IE+V AR G + +++


4AMV_(B)

492

YIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRARGGQLYVFADQD

551

GFA1

656

DEVWAQKSKSIDLQTLEVPQTVDCLQGLINIIPLQLMSYWLAVNKGIDVDFPRNLAKSVT

715






A S ++ +E+P + + + +PLQL++Y +A+ KG DVD PRNLAKSVT


4AMV_(B)

552

----AGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPRNLAKSVT

607

GFA1

716

VE

717






VE


4AMV_(B)

608

VE

609

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein4AMV (Chain B)
E.coli Glucosamine-6p Synthase In Complex With Fructose-6p
  • PDB_Info
  • Homolog SourceEscherichia coli
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15