Alignment of GFA1/YKL104C and PDB 3TBF (chain E) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GFA1/YKL104C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GFA1/YKL104C and PDB protein 3TBF (chain E)Jump to
Structure
Alignment Details
GFA1 length = 718 aaAlignment Length = 369 aa (51.4%)P-value = 8.7e-57%Identity = 39%Similar = 19
Alignment Position

Sequence Alignment

GFA1

349

KGPYDHFMQKEIYEQPESTFNTMRGRIDYENNKVILGGL-KAWLPVVRRARRLIMIACGT

407






K Y H+ KEIYEQPE+ NT+ + + ++ L K + + + + ++ACGT


3TBF_(E)

7

KDGYKHYXLKEIYEQPEAVSNTILASL--ADGEISLDSFDKRAKELFEKTKHICIVACGT

64

GFA1

408

SYHSCLATRAIFEELSDIPVSVELASDFLDRKCPVFRDDVCVFVSQSGETADTMLALNYC

467






SY++ + E+ + +P SVE+AS+ R V + V +SQSGETADT+ +L


3TBF_(E)

65

SYNAGXTAKYWIEKYAKVPCSVEIASEIRYRDNVVVDGSLFVSISQSGETADTLESLRKS

124

GFA1

468

LERGAL-TVGIVNSVGSSISRVTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLSDD

526






++ + + I N SS+ R + AG EIGVASTKA+T+Q +AL +F L ++


3TBF_(E)

125

KKQNYVGSXCICNVPNSSLVRESDIAFXTKAGVEIGVASTKAFTTQLVALAIFTLVIAKL

184

GFA1

527

RVSKIDRRI-EIIQGLKLIPGQIKQVLKLEPRIKKLCATELKDQKSLLLLGRGYQFAAAL

585






+ S D++I + + LK I + LKL+ I ++ + D++ + LGRG + A+


3TBF_(E)

185

KNSLTDQQIAKYTEELKNIRALVXGALKLDTEIDQI-SEYFSDKEHTIFLGRGLYYPIAI

243

GFA1

586

EGALKIKEISYMHSEGVLAGELKHGVLALVDENLPIIAFGTRDSLFPKVVSSIEQVTARK

645






EGALK+KEISY+H+E +GELKHG LALVD+N PI+A D L K +S++++V AR


3TBF_(E)

244

EGALKLKEISYIHAEAYPSGELKHGPLALVDKNXPIVAVVPNDELLDKTLSNLQEVHARG

303

GFA1

646

GHPIIICNENDEVWAQKSKSIDLQTLEVPQTVDCLQGLINIIPLQLMSYWLAVNKGIDVD

705






G I+ ++ + SI LE+ D ++ IPLQL+SY +A+ KG DVD


3TBF_(E)

304

GKLILFVDKAVKERVNFDNSI---VLELDAGHDFSAPVVFTIPLQLLSYHVAIIKGTDVD

360

GFA1

706

FPRNLAKSVTVE

717






PRNLAKSVTVE


3TBF_(E)

361

QPRNLAKSVTVE

372

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3TBF (Chain E)
C-Terminal Domain Of Glucosamine-Fructose-6-Phosphate Aminotransferase From Francisella Tularensis.
  • PDB_Info
  • Homolog SourceFrancisella tularensis subsp. tularensis
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15