Alignment of GFA1/YKL104C and PDB 3OOJ (chain C) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GFA1/YKL104C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GFA1/YKL104C and PDB protein 3OOJ (chain C)Jump to
Structure
Alignment Details
GFA1 length = 718 aaAlignment Length = 700 aa (97.5%)P-value = 1.4e-95%Identity = 37%Similar = 17
Alignment Position

Sequence Alignment

GFA1

18

EIIDTLVDGLQRLEYRGYDSTGIAIDGDEADSTFIYKQIGKVSALKEEITKQNPNRDVTF

77






++ + L++GL+RLEYRGYDS G+A+ E T + +++GKV L + +++P T


3OOJ_(C)

11

DVAEILLEGLRRLEYRGYDSAGLAVVDAEGHMTRL-RRLGKVQMLAQA-AEEHPLHGGT-

67

GFA1

78

VSHCGIAHTRWATHGRPEQVNCHPQRSDPEDQFVVVHNGIITNFRELKTLLINKGYKFES

137






GIAHTRWATHG P +VN HP S+ VVVHNGII N L+ L +GY F S


3OOJ_(C)

68

----GIAHTRWATHGEPSEVNAHPHVSE---HIVVVHNGIIENHEPLREELKARGYTFVS

120

GFA1

138

DTDTECIAKLYLHLYNTNLQNGHDLDFHELTKLVLLELEGSYGLLCKSCHYPNEVIATRK

197






+TDTE IA HL N L+ G L E + +L G+YG + +P+ ++A R


3OOJ_(C)

121

ETDTEVIA----HLVNWELKQGGTL--REAVLRAIPQLRGAYGTVIMDSRHPDTLLAARS

174

GFA1

198

GSPLLIGVKSEKKLKVDFVDVEFPEENAGQPEIPLKSNNKSFGLGPKKAREFEAGSQNAN

257






GSPL+IG+ G+G


3OOJ_(C)

175

GSPLVIGL----------------------------------GMG---------------

185

GFA1

258

LLPIAANEFNLRHSQSRAFLSEDGSPTPVEFFVSSDAASVVKHTKKVLFLEDDDLAHIYD

317






E F++SD +++ T++ +FLE+ D+A I


3OOJ_(C)

186

-----------------------------ENFIASDQLALLPVTRRFIFLEEGDIAEITR

216

GFA1

318

GELHIHRSRREVGASMTRSIQTLEMELAQIM--KGPYDHFMQKEIYEQPESTFNTMRGRI

375






++I + GA + R Q +E L KG Y H+MQKEIYEQP + NT+ GRI


3OOJ_(C)

217

RSVNIFD---KTGAEVKR--QDIESNLQYDAGDKGIYRHYMQKEIYEQPNAIKNTLTGRI

271

GFA1

376

DYENNKVILGGLKAWLPVVRRARRLIMIACGTSYHSCLATRAIFEELSDIPVSVELASDF

435






+ + G A ++ + + ++ACGTSY+S + +R FE L+ IP VE+AS+F


3OOJ_(C)

272

SHGQVDLSELGPNAD-ELLSKVEHIQILACGTSYNSGMVSRYWFESLAGIPCDVEIASEF

330

GFA1

436

LDRKCPVFRDDVCVFVSQSGETADTMLALNYCLERGAL-TVGIVNSVGSSISRVTHCGVH

494






RK V R+ + + +SQSGETADT+ L E G L ++ I N GSS+ R + +


3OOJ_(C)

331

RYRKSAVRRNSLMITLSQSGETADTLAGLRLSKELGYLGSLAICNVPGSSLVRESDLALM

390

GFA1

495

INAGPEIGVASTKAYTSQYIALVMFALSLSDDRVSKIDRRIE--IIQGLKLIPGQIKQVL

552






NAG EIGVASTKA+T+Q L+M LS R+ +D IE I+ GL+ +P +I+Q+L


3OOJ_(C)

391

TNAGTEIGVASTKAFTTQLTVLLMLVAKLS--RLKGLDASIEHDIVHGLQALPSRIEQML

448

GFA1

553

KLEPRIKKLCATELKDQKSLLLLGRGYQFAAALEGALKIKEISYMHSEGVLAGELKHGVL

612






+ RI+ L A + D+ L LGRG Q+ ALEGALK+KEISY+H+E AGELKHG L


3OOJ_(C)

449

SQDKRIEAL-AEDFSDKHHALFLGRGDQYPIALEGALKLKEISYIHAEAYAAGELKHGPL

507

GFA1

613

ALVDENLPIIAFGTRDSLFPKVVSSIEQVTARKGHPIIICNENDEVWAQKSKSIDLQTLE

672






AL+D ++P+I + L K+ S+IE+V AR G + +++ A S ++ +E


3OOJ_(C)

508

ALIDADMPVIVVAPNNELLEKLKSNIEEVRARGGQLYVFADQD----AGFVSSDNMHIIE

563

GFA1

673

VPQTVDCLQGLINIIPLQLMSYWLAVNKGIDVDFPRNLAKSVTVE

717






+P + + + +PLQL++Y +A+ KG DVD PRNLAKSVTVE


3OOJ_(C)

564

MPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPRNLAKSVTVE

608

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3OOJ (Chain C)
C1a Mutant Of E. Coli Glms In Complex With Glucose-6p And Glutamate
  • PDB_Info
  • Homolog SourceEscherichia coli
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15