Alignment of GFA1/YKL104C and PDB 3KNZ (chain C) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GFA1/YKL104C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GFA1/YKL104C and PDB protein 3KNZ (chain C)Jump to
Structure
Alignment Details
GFA1 length = 718 aaAlignment Length = 217 aa (30.2%)P-value = 5.9e-07%Identity = 24%Similar = 13
Alignment Position

Sequence Alignment

GFA1

395

RRARRLIMIACGTSYHSCLATRAIFEELSDIPVSVELASDFLDRKCPVFRDDVCVFVSQS

454






R R+I+ GTSYH L R + +PV V D + V +SQ


3KNZ_(C)

48

RGVTRIILTGSGTSYHGALTARTFXQRWCALPVDVCWPFXLDDETLARSGKALVVGISQG

107

GFA1

455

GETADTMLALNYCLERGALTVGIVNSVGSSISRVTHCGVHINAGPEIGVASTKAYTSQYI

514






G + T+ A G +T ++I R + + G E A TK Y +


3KNZ_(C)

108

GGSLSTLAAXERARNVGHITASXAGVAPATIDRAADYILTVPCGEETAGAKTKGYHCTVL

167

GFA1

515

ALVMFALSLS--DDRVSKIDRRIEIIQGLKLIPGQIKQVLKLEPRIKKLCATELKDQKSL

572






L + AL+++ R+ RR +++ K + ++ + A L+D +


3KNZ_(C)

168

NLXLLALAVAGQQQRLDGEQRRSLLLRXEKTF-NHLPALVTASQAWAQTNALALRDSADI

226

GFA1

573

LLLGRGYQFAAALEGALKIKEISYMHSEGVLAGELKHGV

611






L G F EGALK E G E HG+


3KNZ_(C)

227

RLTGPATLFGTVQEGALKXLETLRCPVSGYEFEEFIHGI

265

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3KNZ (Chain C)
Crystal Structure Of Putative Sugar Binding Protein (Np_459565.1) From Salmonella Typhimurium Lt2 At 2.50 A Resolution
  • PDB_Info
  • Homolog SourceSalmonella enterica subsp. enterica serovar Typhimurium
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15