Alignment of GFA1/YKL104C and PDB 3HBA (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GFA1/YKL104C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GFA1/YKL104C and PDB protein 3HBA (chain B)Jump to
Structure
Alignment Details
GFA1 length = 718 aaAlignment Length = 243 aa (33.8%)P-value = 7.2e-18%Identity = 27%Similar = 21
Alignment Position

Sequence Alignment

GFA1

402

MIACGTSYHSCLATRAIFEELSDIPVSVELAS-DFLDRKCPVFRDDVCVFVSQSGETADT

460






++ G+S H+ + + +FE + IP S + K + + +SQSG + D


3HBA_(B)

47

IVGRGSSDHAGVFAKYLFEIEASIPTFAAAPSVASVYGKTLKLAGGLVIVISQSGRSPDI

106

GFA1

461

MLALNYCLERGALTVGIVNSVGSSISRVTHCGVHINAGPEIGVASTKAYTSQYIALVMFA

520






+ GA V +VN + I + + + AG E VA+TK+Y + AL+ A


3HBA_(B)

107

LAQARXAKNAGAFCVALVNDETAPIKDIVDVVIPLRAGEEKAVAATKSYLATLSALLQVA

166

GFA1

521

LSLSDDRVSKIDRRIEIIQGLKLIPGQIKQVLKLEPRIKKLCATELKDQKSLLLLGRGYQ

580






+K + +++ + +P ++ + EP+++ A L D K+L++LGRG+


3HBA_(B)

167

--------AKWTQNESLVEAVNSLPQALQAAVDAEPQLR---AGSLTDVKNLVVLGRGFG

215

GFA1

581

FAAALEGALKIKEISYMHSEGVLAGELKHGVLALVDENLPIIAFGTRDSLFPKVVSSIEQ

640






+A + E ALK+KE+ +H+E + E HG + LV++ L I+ RD + V I


3HBA_(B)

216

YAVSKEIALKLKEVCAIHAEAFSSAEFLHGPVTLVEKKLSILDVCIRDESYGSHVEQIAN

275

GFA1

641

VTAR

644






V R


3HBA_(B)

276

VKQR

279

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3HBA (Chain B)
Crystal Structure Of A Putative Phosphosugar Isomerase (Sden_2705) From Shewanella Denitrificans Os217 At 2.00 A Resolution
  • PDB_Info
  • Homolog SourceShewanella denitrificans OS217
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15