Alignment of GFA1/YKL104C and PDB 3G68 (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GFA1/YKL104C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GFA1/YKL104C and PDB protein 3G68 (chain B)Jump to
Structure
Alignment Details
GFA1 length = 718 aaAlignment Length = 312 aa (43.5%)P-value = 5.2e-09%Identity = 22%Similar = 20
Alignment Position

Sequence Alignment

GFA1

398

RRLIMIACGTSYHSCLATRAIFEELSDIPVSVELASDFLDRKCPVFRDD--VCVFVSQSG

455






+++I+ GTSYHS + + + L DI V V+ + F ++ + V VSQ G


3G68_(B)

35

KKIIITGSGTSYHSGVQVQPYLQNLLDIDV-VKXYPFXITEDTFKFDNENTLVVGVSQGG

93

GFA1

456

ETADTMLALNYCLERGALTVGIVNSVGSSISRVTHCGVHINAGPEIGVASTKAYTSQYIA

515






+ T A ++G + I ++ + +N G E A TK Y +


3G68_(B)

94

SSYSTYNAXKLAEDKGCKIASXAGCKNALIDEISDYILTVNCGEEKSGAKTKGYYCTKLN

153

GFA1

516

LVMFALSLSDDR--VSKIDRRIEIIQGLKLIPGQIKQVLKLEPRIKKLCATELKDQKSLL

573






L + L ++ ++ +S EI + L I + + V KL + + +L + K +


3G68_(B)

154

LXLLGLQIAREKGIISSEKYNEEINKILDAI-NRFEAVYKLSKQWIERNKEKLVNSKEIR

212

GFA1

574

LLGRGYQFAAALEGALKIKEISYMHSEGVLAGELKHGVLALVDENLPIIAFGTRDSLFPK

633






++G + LE ALK+ E + G E HG+ ++ + I T P+


3G68_(B)

213

IIGHSDIYGDTLEAALKLLETXRIPVTGYEFEEFIHGIYNAINSDSTIFILDTGKE--PR

270

GFA1

634

VVSSIEQVTARKGHPIIICNENDEVWAQKSKSIDLQTLEVPQTVDCLQGLINIIPLQLMS

693






V I+ ++ + I + E K+ ID+ QT + I+P+QL+


3G68_(B)

271

VTKXIDVLSGWTENVFAIGRDVTE--NDKNLKIDITDNPYYQTFNF------IVPIQLIC

322

GFA1

694

YWLAVNKGIDVDFPRN

709






+ +G+D P++


3G68_(B)

323

GEIPTLRGVDPSVPKD

338

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3G68 (Chain B)
Crystal Structure Of A Putative Phosphosugar Isomerase (cd3275) From Clostridium Difficile 630 At 1.80 A Resolution
  • PDB_Info
  • Homolog SourcePeptoclostridium difficile 630
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15