Alignment of GFA1/YKL104C and PDB 3FJ1 (chain D) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GFA1/YKL104C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GFA1/YKL104C and PDB protein 3FJ1 (chain D)Jump to
Structure
Alignment Details
GFA1 length = 718 aaAlignment Length = 310 aa (43.2%)P-value = 1.8e-18%Identity = 28%Similar = 18
Alignment Position

Sequence Alignment

GFA1

403

IACGTSYHSCLATRAIFEELSDIPVSV---ELASDFLDRKCPVFRDDVCVFVSQSGETAD

459






+A G+S H C E L +PV+ +AS + D + + R +C+ VSQSG++ D


3FJ1_(D)

49

VARGSSDHVCTYLSYAAELLLGLPVASLGPSVASVY-DARLRLDRA-LCLAVSQSGKSPD

106

GFA1

460

TMLALNYCLERGALTVGIVNSVGSSISRVTHCGVHINAGPEIGVASTKAYTSQYIA-LVM

518






+ GAL V + N S ++ V+ + I+AGPE+ VA+TK + + +A L +


3FJ1_(D)

107

IVAXTRNAGRDGALCVALTNDAASPLAGVSAHTIDIHAGPELSVAATKTFVTSAVAGLXL

166

GFA1

519

FALSLSDDRVSKIDRRIEIIQGLKLIPGQIKQVLKLEPRIK-KLCATELKDQKSLLLLGR

577






A DD GL+ G + + L RI + + SL LGR


3FJ1_(D)

167

LADWAEDD-------------GLRAALGNLPETLAAASRIDWPEXRVAIGARPSLFTLGR

213

GFA1

578

GYQFAAALEGALKIKEISYMHSEGVLAGELKHGVLALVDENLPIIAFGTRDSLFPKVVSS

637






G A + E ALK KE +H+E + E+ HG +++V+E P++ F D+ +


3FJ1_(D)

214

GTSLAVSNEAALKFKETCQLHAESYSSAEVLHGPVSIVEEGFPVLGFAAGDAAEAPLAEI

273

GFA1

638

IEQVTARKGHPIIICNENDEVWAQKSKSIDLQTLEVPQTVDCLQGLINIIPLQLMSYW--

695






+Q+ A KG V+A + + LE ++ L +++I + S


3FJ1_(D)

274

ADQIAA-KGAT---------VFATTGRVTRARVLEHVRSGHALTDPLSLI-VSFYSXVEA

322

GFA1

696

LAVNKGIDVDFPRNLAK

712






A +GID D PR+L K


3FJ1_(D)

323

FASERGIDPDAPRHLNK

339

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3FJ1 (Chain D)
Crystal Structure Of Putative Phosphosugar Isomerase (Yp_167080.1) From Silicibacter Pomeroyi Dss-3 At 1.75 A Resolution
  • PDB_Info
  • Homolog SourceRuegeria pomeroyi DSS-3
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15