Alignment of GFA1/YKL104C and PDB 3EUA (chain E) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GFA1/YKL104C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GFA1/YKL104C and PDB protein 3EUA (chain E)Jump to
Structure
Alignment Details
GFA1 length = 718 aaAlignment Length = 223 aa (31.1%)P-value = 2.6e-07%Identity = 24%Similar = 20
Alignment Position

Sequence Alignment

GFA1

400

LIMIACGTSYHSCLATRAIFE-ELSDIPVSVELASDFLDRKCPVFRDD--VCVFVSQSGE

456






+ +ACG S ++ +F+ E I + A++F+ R PV + + + S SG


3EUA_(E)

28

VFFVACGGSSAIXYPSKYVFDRESKSINSDLYSANEFIQRN-PVQLGEKSLVILCSHSGN

86

GFA1

457

TADTMLALNYCLERGALTVGIVNSVGSSISRVTHCGVHINAGPEIGVASTKAYTSQYIAL

516






T +T+ A + +GALT+ S +++ + G E +T Y Y +


3EUA_(E)

87

TPETVKAAAFARGKGALTIAXTFKPESPLAQEAQYVAQYDWGDEALAINTN-YGVLY-QI

144

GFA1

517

VMFALSLSDDRVSKIDRRIEIIQGLKLIPGQIKQVLKLEPRIKKLCATELKDQKSLLLLG

576






V L + ++ +K ++ IE GL + ++ LK E K A + + +


3EUA_(E)

145

VFGTLQVLENN-TKFEQAIE---GLDQLQAVYEKALKQEADNAKQFAKAHEKESIIYTXA

200

GFA1

577

RGYQFAAALEGALKI-KEISYMHSEGVLAGELKHGVLALVDENLPII

622






G + A ++ I E ++HS + AGE HG ++DE++P I


3EUA_(E)

201

SGANYGVAYSYSICILXEXQWIHSHAIHAGEYFHGPFEIIDESVPFI

247

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3EUA (Chain E)
Crystal Structure Of A Putative Phosphosugar Isomerase (Bsu32610) From Bacillus Subtilis At 1.90 A Resolution
  • PDB_Info
  • Homolog SourceBacillus subtilis
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15