Alignment of GFA1/YKL104C and PDB 2ZJ3 (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GFA1/YKL104C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GFA1/YKL104C and PDB protein 2ZJ3 (chain A)Jump to
Structure
Alignment Details
GFA1 length = 718 aaAlignment Length = 372 aa (51.8%)P-value = 1.1e-123%Identity = 63%Similar = 18
Alignment Position

Sequence Alignment

GFA1

346

QIMKGPYDHFMQKEIYEQPESTFNTMRGRIDYENNKVILGGLKAWLPVVRRARRLIMIAC

405






QIMKG + FMQKEI+EQPES NTMRGR+++++ V LGGLK + ++R RRLI+IAC


2ZJ3_(A)

9

QIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIAC

68

GFA1

406

GTSYHSCLATRAIFEELSDIPVSVELASDFLDRKCPVFRDDVCVFVSQSGETADTMLALN

465






GTSYH+ +ATR + EEL+++PV VELASDFLDR PVFRDDVC F+SQSGETADT++ L


2ZJ3_(A)

69

GTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLR

128

GFA1

466

YCLERGALTVGIVNSVGSSISRVTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLSD

525






YC ERGALTVGI N+VGSSISR T CGVHINAGPEIGVASTKAYTSQ+++LVMFAL + D


2ZJ3_(A)

129

YCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCD

188

GFA1

526

DRVSKIDRRIEIIQGLKLIPGQIKQVLKLEPRIKKLCATELKDQKSLLLLGRGYQFAAAL

585






DR+S +RR EI+ GLK +P IK+VL ++ I+KL ATEL QKS+L++GRGY +A L


2ZJ3_(A)

189

DRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKL-ATELYHQKSVLIMGRGYHYATCL

247

GFA1

586

EGALKIKEISYMHSEGVLAGELKHGVLALVDENLPIIAFGTRDSLFPKVVSSIEQVTARK

645






EGALKIKEI+YMHSEG+LAGELKHG LALVD+ +P+I RD + K ++++QV AR+


2ZJ3_(A)

248

EGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQ

307

GFA1

646

GHPIIICNENDEVWAQKSKSIDLQTLEVPQTVDCLQGLINIIPLQLMSYWLAVNKGIDVD

705






G P++IC++ D + +K +T++VP +VDCLQG++++IPLQL+++ LAV +G DVD


2ZJ3_(A)

308

GRPVVICDKEDTETIKNTK----RTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVD

363

GFA1

706

FPRNLAKSVTVE

717






FPRNLAKSVTVE


2ZJ3_(A)

364

FPRNLAKSVTVE

375

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2ZJ3 (Chain A)
Isomerase Domain Of Human Glucose:fructose-6-Phosphate Amidotransferase
  • PDB_Info
  • Homolog SourceHomo sapiens
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15