Alignment of GFA1/YKL104C and PDB 2POC (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GFA1/YKL104C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GFA1/YKL104C and PDB protein 2POC (chain B)Jump to
Structure
Alignment Details
GFA1 length = 718 aaAlignment Length = 370 aa (51.5%)P-value = 1.6e-156%Identity = 81%Similar = 8
Alignment Position

Sequence Alignment

GFA1

348

MKGPYDHFMQKEIYEQPESTFNTMRGRIDYENNKVILGGLKAWLPVVRRARRLIMIACGT

407






MKGPY HFMQKEI+EQP+S FNTMRGRID+EN V LGGLK+WL +RR RR+IMIACGT


2POC_(B)

1

MKGPYKHFMQKEIFEQPDSAFNTMRGRIDFENCVVTLGGLKSWLSTIRRCRRIIMIACGT

60

GFA1

408

SYHSCLATRAIFEELSDIPVSVELASDFLDRKCPVFRDDVCVFVSQSGETADTMLALNYC

467






SYHSCLATR+IFEEL++IPVSVELASDFLDR+ PVFRDD CVFVSQSGETAD++LAL YC


2POC_(B)

61

SYHSCLATRSIFEELTEIPVSVELASDFLDRRSPVFRDDTCVFVSQSGETADSILALQYC

120

GFA1

468

LERGALTVGIVNSVGSSISRVTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLSDDR

527






LERGALTVGIVNSVGSS+SR THCGVHINAGPEIGVASTKAYTSQYIALVMFALSLS+D


2POC_(B)

121

LERGALTVGIVNSVGSSMSRQTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLSNDS

180

GFA1

528

VSKIDRRIEIIQGLKLIPGQIKQVLKLEPRIKKLCATELKDQKSLLLLGRGYQFAAALEG

587






+S+ R EII+GL+ IP QIKQVLKLE +IK LC + L DQKSLLLLGRGYQFA ALEG


2POC_(B)

181

ISRKGRHEEIIKGLQKIPEQIKQVLKLENKIKDLCNSSLNDQKSLLLLGRGYQFATALEG

240

GFA1

588

ALKIKEISYMHSEGVLAGELKHGVLALVDENLPIIAFGTRDSLFPKVVSSIEQVTARKGH

647






ALKIKEISYMHSEGVLAGELKHG+LALVDE+LPIIAF TRDSLFPKV+S+IEQVTAR G


2POC_(B)

241

ALKIKEISYMHSEGVLAGELKHGILALVDEDLPIIAFATRDSLFPKVMSAIEQVTARDGR

300

GFA1

648

PIIICNENDEVWAQKSKSIDLQTLEVPQTVDCLQGLINIIPLQLMSYWLAVNKGIDVDFP

707






PI+ICNE D + + TLEVP+TVDCLQGL+N+IPLQL+SYWLAVN+GIDVDFP


2POC_(B)

301

PIVICNEGDAIISNDKVHT---TLEVPETVDCLQGLLNVIPLQLISYWLAVNRGIDVDFP

357

GFA1

708

RNLAKSVTVE

717






RNLAKSVTVE


2POC_(B)

358

RNLAKSVTVE

367

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2POC (Chain B)
The Crystal Structure Of Isomerase Domain Of Glucosamine-6-Phosphate Synthase From Candida Albicans
  • PDB_Info
  • Homolog SourceCandida albicans SC5314
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15