Alignment of GFA1/YKL104C and PDB 2DF8 (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GFA1/YKL104C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GFA1/YKL104C and PDB protein 2DF8 (chain B)Jump to
Structure
Alignment Details
GFA1 length = 718 aaAlignment Length = 316 aa (44%)P-value = 4.4e-12%Identity = 26%Similar = 21
Alignment Position

Sequence Alignment

GFA1

399

RLIMIACGTSYHSCLATRAIFEELSDIPVSVELASDFLDRK--CPVFRDDVCVFVSQSGE

456






R++ + CG+S+ + + +++ S+FL K P+ ++ V +S+SGE


2DF8_(B)

33

RILYLGCGSSHFLSKLLAMVTNMHGGLGIALP-CSEFLYSKETYPIGEVELAVGISRSGE

91

GFA1

457

TADTMLALNYCLERGALTVGIVNSVGSSISRVTHCGVHINAGPEIGVASTKAYTSQYIA-

515






T + +LAL + +GI SS++R+ + + A E V T ++TS Y A


2DF8_(B)

92

TTEILLALE---KINVKKLGITTRE-SSLTRMCDYSLVVPAIEE-SVVMTHSFTSFYFAY

146

GFA1

516

--LVMFALSLSDDRVSKIDRRIEIIQGLKLIPGQIKQVLKLEPRIKKLCATELKDQKSLL

573






L+ ++ L +I + E + L+ E I+++ E D ++++


2DF8_(B)

147

LQLLRYSYGLPPLNAGEISKATE-------------KSLEYERYIREI--VESFDFQNII

191

GFA1

574

LLGRGYQFAAALEGALKIKEISYMHSEGVLAGELKHGVLALVDEN-LPIIAFGTRDSLFP

632






LG G + ALE +LK+KE+S SE E++HG A+ DE L ++


2DF8_(B)

192

FLGSGLLYPVALEASLKMKEMSIFWSEAYPTFEVRHGFKAIADEKTLVVLMVEEPFEWHE

251

GFA1

633

KVVSSIEQVTARKGHPIIICNENDEVWAQKSKSIDLQTLEVPQTVDCLQGLINIIPL-QL

691






K+V + A+ ++I N ++ + SI+L L + D I +P+ QL


2DF8_(B)

252

KLVKEFKNQGAKV---LVISNSPQDLG--QDYSIELPRL----SKDA--NPIPYLPIVQL

300

GFA1

692

MSYWLAVNKGIDVDFPRNLAKSV

714






+SY+ AV++G++ D PR L K V


2DF8_(B)

301

LSYYKAVSRGLNPDNPRFLDKVV

323

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2DF8 (Chain B)
Crystal Structure Of The Ph0510 Protein From Pyrococcus Horikoshii Ot3 In Complex With Beta-D-Fructopyranose-1-Phosphate
  • PDB_Info
  • Homolog SourcePyrococcus horikoshii OT3
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15