Alignment of GFA1/YKL104C and PDB 2CB0 (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GFA1/YKL104C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GFA1/YKL104C and PDB protein 2CB0 (chain B)Jump to
Structure
Alignment Details
GFA1 length = 718 aaAlignment Length = 321 aa (44.7%)P-value = 3.9e-14%Identity = 26%Similar = 21
Alignment Position

Sequence Alignment

GFA1

394

VRRARRLIMIACGTSYHSCLATRAIFEELSDIPVSVELASDFLDRK--CPVFRDDVCVFV

451






+R RR++ + CG+S+ + V++ S+FL K P+ + ++ V +


2CB0_(B)

28

IRLPRRILYLGCGSSHFLAKLLAXVTNXHGGTGVALP-CSEFLYSKEAYPIGKPELVVGI

86

GFA1

452

SQSGETADTMLALNYCLERGALTVGIVNSVGSSISRVTHCGVHINAGPEIGVASTKAYTS

511






S+SGET + +LAL + +GI ++ SS++R + + E V T ++T+


2CB0_(B)

87

SRSGETTEVLLALE---KINTPKLGI-SAYESSLTRACDYSLVVPTIEE-SVVXTHSFTA

141

GFA1

512

QYIALVMFALSLSDDRVSKIDRRIEIIQGLKLIPGQIKQVLKLEPRIKKLCATELKDQKS

571






Y A + ++ + + +++ ++ K L+ E IK++ E D ++


2CB0_(B)

142

FYFAYL---------QLLRHSYGLPLLEATEVAKATEK-ALEYENYIKEI--VEDFDFQN

189

GFA1

572

LLLLGRGYQFAAALEGALKIKEISYMHSEGVLAGELKHGVLALVDENLPIIAFGTRDSLF

631






++ LG G + ALE +LK KE + SE E++HG A+ DEN ++ LF


2CB0_(B)

190

VIFLGSGLLYPVALEASLKXKEXAIFWSEAYPTFEVRHGFKAIADENTLVVLXA--QELF

247

GFA1

632

PKVVSSIEQVTARKGHPIIICNENDEVWAQKSKSIDLQTLEVPQ-TVDCLQGLINIIPL-

689






+ + ++ ++I N E S +EVP+ + D I +P+


2CB0_(B)

248

EWHKKLVNEFKGQRARVLLISNSQQEFGQDYS-------IEVPRLSKDATP--IPYLPVV

298

GFA1

690

QLMSYWLAVNKGIDVDFPRNLAKSV

714






QL+SY+ AV +G++ D PR L K V


2CB0_(B)

299

QLLSYYKAVARGLNPDNPRFLDKVV

323

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2CB0 (Chain B)
Crystal Structure Of Glucosamine 6-Phosphate Deaminase From Pyrococcus Furiosus
  • PDB_Info
  • Homolog SourcePyrococcus furiosus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15