Alignment of GFA1/YKL104C and PDB 2AML (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GFA1/YKL104C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GFA1/YKL104C and PDB protein 2AML (chain B)Jump to
Structure
Alignment Details
GFA1 length = 718 aaAlignment Length = 305 aa (42.5%)P-value = 7.7e-06%Identity = 22%Similar = 20
Alignment Position

Sequence Alignment

GFA1

397

ARRLIMIACGTSYHSCLATRAIFEELSDIPVSVELASDFLDRKCPVFRDDVCVFVSQSGE

456






A+ +++A G+S ++ + + E L+D+ +++E + L + D+ + +SQSG+


2AML_(B)

50

AKEWLILATGSSLNAAQSAKYYIENLADVRITIEEPFNHLYYEKLSSHLDLVIGISQSGQ

109

GFA1

457

TADTMLALNYCLERGAL-TVGIVNSVGSSISRVTHCGVHINAGPE-IGVASTKAYTSQYI

514






+ T+ AL + ++ V + + V S I+ + I +G E +G TK +T+ +


2AML_(B)

110

STSTISALERVKKEASVPVVALTSDVTSEIAEFADITLDIGSGKERVGYV-TKGFTATVL

168

GFA1

515

ALVMFALSLSDDRVSKIDRRI--EII---QGLKLIPGQIKQVLKLEPRIKKLCATELKDQ

569






L + L + V + R EI + + IP I + R ++ AT K


2AML_(B)

169

TLXLTGLHFAYKTVQIDETRFNNEISAFSRAIDAIPATIAETEAFYERWQEEFATAPK--

226

GFA1

570

KSLLLLGRGYQFAAALEGALKIKEISYMHSEGVLAGELKHGVLALVDENLPIIAFGTRDS

629






+G G E K E + S+G+ HG V+ I T +


2AML_(B)

227

--FTAIGYGPTVGTCKEFETKFSETVRVPSQGLDLEAFXHGPYLEVNPQHRIFFLETASA

284

GFA1

630

LFPKVVSSIEQVTARKGHPIIICNENDEVWAQKSKSIDLQTLEVPQTVDCLQG-LINIIP

688






+ ++V + + K P + K D +TL +P +D Q + I+P


2AML_(B)

285

VTERLVLLRDYES--KYTPFTYT-------VKFGKGEDDRTLVIPTDLDEYQAPFLXILP

335

GFA1

689

LQLMSYWLAVNKG

701






Q++++ +A KG


2AML_(B)

336

FQILAHHIAELKG

348

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2AML (Chain B)
Crystal Structure Of Lmo0035 Protein (46906266) From Listeria Monocytogenes 4b F2365 At 1.50 A Resolution
  • PDB_Info
  • Homolog SourceListeria monocytogenes serotype 4b str. F2365
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15