Alignment of GFA1/YKL104C and PDB 1MOR (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GFA1/YKL104C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GFA1/YKL104C and PDB protein 1MOR (chain A)Jump to
Structure
Alignment Details
GFA1 length = 718 aaAlignment Length = 369 aa (51.4%)P-value = 3.0e-70%Identity = 44%Similar = 19
Alignment Position

Sequence Alignment

GFA1

349

KGPYDHFMQKEIYEQPESTFNTMRGRIDYENNKVILGGLKAWLPVVRRARRLIMIACGTS

408






KG Y H+MQKEIYEQP + NT+ GRI + + G A ++ + + ++ACGTS


1MOR_(A)

5

KGIYRHYMQKEIYEQPNAIKNTLTGRISHGQVDLSELGPNAD-ELLSKVEHIQILACGTS

63

GFA1

409

YHSCLATRAIFEELSDIPVSVELASDFLDRKCPVFRDDVCVFVSQSGETADTMLALNYCL

468






Y+S + +R FE L+ IP VE+AS+F RK V R+ + + +SQSGETADT+ L


1MOR_(A)

64

YNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGLRLSK

123

GFA1

469

ERGAL-TVGIVNSVGSSISRVTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLSDDR

527






E G L ++ I N GSS+ R + + NAG EIGVASTKA+T+Q L+M LS R


1MOR_(A)

124

ELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKLS--R

181

GFA1

528

VSKIDRRIE--IIQGLKLIPGQIKQVLKLEPRIKKLCATELKDQKSLLLLGRGYQFAAAL

585






+ +D IE I+ GL+ +P +I+Q+L + RI+ L A + D+ L LGRG Q+ AL


1MOR_(A)

182

LKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEAL-AEDFSDKHHALFLGRGDQYPIAL

240

GFA1

586

EGALKIKEISYMHSEGVLAGELKHGVLALVDENLPIIAFGTRDSLFPKVVSSIEQVTARK

645






EGALK+KEISY+H+E AGELKHG LAL+D ++P+I + L K+ S+IE+V AR


1MOR_(A)

241

EGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRARG

300

GFA1

646

GHPIIICNENDEVWAQKSKSIDLQTLEVPQTVDCLQGLINIIPLQLMSYWLAVNKGIDVD

705






G + +++ A S ++ +E+P + + + +PLQL++Y +A+ KG DVD


1MOR_(A)

301

GQLYVFADQD----AGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVD

356

GFA1

706

FPRNLAKSVTVE

717






PRNLAKSVTVE


1MOR_(A)

357

QPRNLAKSVTVE

368

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1MOR (Chain A)
Isomerase Domain Of Glucosamine 6-Phosphate Synthase Complexed With Glucose 6-Phosphate
  • PDB_Info
  • Homolog SourceEscherichia coli
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15