Alignment of GFA1/YKL104C and PDB 1JXA (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GFA1/YKL104C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GFA1/YKL104C and PDB protein 1JXA (chain B)Jump to
Structure
Alignment Details
GFA1 length = 718 aaAlignment Length = 716 aa (99.7%)P-value = 6.8e-96%Identity = 37%Similar = 17
Alignment Position

Sequence Alignment

GFA1

2

CGIFGYCNYLVERSRGEIIDTLVDGLQRLEYRGYDSTGIAIDGDEADSTFIYKQIGKVSA

61






CGI G + +R EI L++GL+RLEYRGYDS G+A+ E T + +++GKV


1JXA_(B)

1

CGIVGA---IAQRDVAEI---LLEGLRRLEYRGYDSAGLAVVDAEGHMTRL-RRLGKVQM

53

GFA1

62

LKEEITKQNPNRDVTFVSHCGIAHTRWATHGRPEQVNCHPQRSDPEDQFVVVHNGIITNF

121






L + +++P T GIAHTRWATHG P +VN HP S+ VVVHNGII N


1JXA_(B)

54

LAQA-AEEHPLHGGT-----GIAHTRWATHGEPSEVNAHPHVSE---HIVVVHNGIIENH

104

GFA1

122

RELKTLLINKGYKFESDTDTECIAKLYLHLYNTNLQNGHDLDFHELTKLVLLELEGSYGL

181






L+ L +GY F S+TDTE IA HL N L+ G L E + +L G+YG


1JXA_(B)

105

EPLREELKARGYTFVSETDTEVIA----HLVNWELKQGGTL--REAVLRAIPQLRGAYGT

158

GFA1

182

LCKSCHYPNEVIATRKGSPLLIGVKSEKKLKVDFVDVEFPEENAGQPEIPLKSNNKSFGL

241






+ +P+ ++A R GSPL+IG+ G+


1JXA_(B)

159

VIMDSRHPDTLLAARSGSPLVIGL----------------------------------GM

184

GFA1

242

GPKKAREFEAGSQNANLLPIAANEFNLRHSQSRAFLSEDGSPTPVEFFVSSDAASVVKHT

301






G E F++SD +++ T


1JXA_(B)

185

G--------------------------------------------ENFIASDQLALLPVT

200

GFA1

302

KKVLFLEDDDLAHIYDGELHIHRSRREVGASMTRSIQTLEMELAQIM--KGPYDHFMQKE

359






++ +FLE+ D+A I ++I + GA + R Q +E L KG Y H+MQKE


1JXA_(B)

201

RRFIFLEEGDIAEITRRSVNIFD---KTGAEVKR--QDIESNLQYDAGDKGIYRHYMQKE

255

GFA1

360

IYEQPESTFNTMRGRIDYENNKVILGGLKAWLPVVRRARRLIMIACGTSYHSCLATRAIF

419






IYEQP + NT+ GRI + + G A ++ + + ++ACGTSY+S + +R F


1JXA_(B)

256

IYEQPNAIKNTLTGRISHGQVDLSELGPNAD-ELLSKVEHIQILACGTSYNSGMVSRYWF

314

GFA1

420

EELSDIPVSVELASDFLDRKCPVFRDDVCVFVSQSGETADTMLALNYCLERGAL-TVGIV

478






E L+ IP VE+AS+F RK V R+ + + +SQSGETADT+ L E G L ++ I


1JXA_(B)

315

ESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGLRLSKELGYLGSLAIC

374

GFA1

479

NSVGSSISRVTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLSDDRVSKIDRRIE--

536






N GSS+ R + + NAG EIGVASTKA+T+Q L+M LS ++ +D IE


1JXA_(B)

375

NVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKLS--KLKGLDASIEHD

432

GFA1

537

IIQGLKLIPGQIKQVLKLEPRIKKLCATELKDQKSLLLLGRGYQFAAALEGALKIKEISY

596






I+ GL+ +P +I+Q+L + RI+ L A + D+ L LGRG Q+ ALEGALK+KEISY


1JXA_(B)

433

IVHGLQALPSRIEQMLSQDKRIEAL-AEDFSDKHHALFLGRGDQYPIALEGALKLKEISY

491

GFA1

597

MHSEGVLAGELKHGVLALVDENLPIIAFGTRDSLFPKVVSSIEQVTARKGHPIIICNEND

656






+H+E AGELKHG LAL+D ++P+I + L K+ S+IE+V AR G + +++


1JXA_(B)

492

IHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRARGGQLYVFADQD-

550

GFA1

657

EVWAQKSKSIDLQTLEVPQTVDCLQGLINIIPLQLMSYWLAVNKGIDVDFPRNLAKSVTV

716






A S ++ +E+P + + + +PLQL++Y +A+ KG DVD PRNLAKSVTV


1JXA_(B)

551

---AGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPRNLAKSVTV

607

GFA1

717

E

717






E


1JXA_(B)

608

E

608

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1JXA (Chain B)
Glucosamine 6-Phosphate Synthase With Glucose 6-Phosphate
  • PDB_Info
  • Homolog SourceEscherichia coli
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15