Alignment of GFA1/YKL104C and PDB 1AO0 (chain C) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GFA1/YKL104C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GFA1/YKL104C and PDB protein 1AO0 (chain C)Jump to
Structure
Alignment Details
GFA1 length = 718 aaAlignment Length = 181 aa (25.2%)P-value = 1.0e-05%Identity = 30%Similar = 16
Alignment Position

Sequence Alignment

GFA1

2

CGIFGYCNYLVERSRGEIIDTLVDGLQRLEYRGYDSTGI-AIDGDEADSTFIYKQIGKVS

60






CG+FG + E GL L++RG + GI A DG++ + +K G ++


1AO0_(C)

1

CGVFGIWGH------EEAPQITYYGLHSLQHRGQEGAGIVATDGEKLTA---HKGQGLIT

51

GFA1

61

ALKEEITKQNPNRDVTFVSHCG-IAHTRWATHGRPEQVNCHPQ--RSDPEDQFVVVHNGI

117






E+ + N +++ V G I H R+AT G N P RS + HNG


1AO0_(C)

52

----EVFQ---NGELSKVKGKGAIGHVRYATAGGGGYENVQPLLFRSQNNGSLALAHNGN

104

GFA1

118

ITNFRELKTLLINKGYKFESDTDTECIAKLYLHLYNTNLQNGHDLDFHELTKLVLLELEG

177






+ N +LK L N+G F++ +DTE +A HL ++GH + K L L+G


1AO0_(C)

105

LVNATQLKQQLENQGSIFQTSSDTEVLA----HLIK---RSGH-FTLKDQIKNSLSMLKG

156

GFA1

178

SYGLL

182






+Y L


1AO0_(C)

157

AYAFL

161

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1AO0 (Chain C)
Glutamine Phosphoribosylpyrophosphate (Prpp) Amidotransferase From B. Subtilis Complexed With Adp And Gmp
  • PDB_Info
  • Homolog SourceBacillus subtilis
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15