Alignment of GLK1/YCL040W and PDB 5HFU (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GLK1/YCL040W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GLK1/YCL040W and PDB protein 5HFU (chain A)Jump to
Structure
Alignment Details
GLK1 length = 501 aaAlignment Length = 486 aa (97%)P-value = 1.6e-57%Identity = 37%Similar = 15
Alignment Position

Sequence Alignment

GLK1

15

IQAVDQICDDFEVTPEKLDELTAYFIEQMEKGLAPPKEGHTLASDKGLPMIPAFVTGSPN

74






+Q VDQ ++ E L E++ F ++MEKGL H A+ K M+P FV +P+


5HFU_(A)

25

VQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATT--HPTAAVK---MLPTFVRSTPD

79

GLK1

75

GTERGVLLAADLGGTNFRICSVNL--HGDHTFSMEQMKSKIPDDLLDDENVTSDDLFGFL

132






GTE G LA DLGGTNFR+ V + +G ME IP+D++ LF +


5HFU_(A)

80

GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSGT---QLFDHI

136

GLK1

133

ARRTLAFMKKYHPDELAKGKDAKPMKLGFTFSYPVDQTSLNSGTLIRWTKGFRIADTVGK

192






A FM D+L + KD K + LGFTFS+P QT L+ L+ WTKGF+ + G+


5HFU_(A)

137

AECLANFM-----DKL-QIKDKK-LPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGR

189

GLK1

193

DVVQLYQEQLSAQGMPMIKVVALTNDTVGTYLSHCYTSDNTDSMTSGEISEPVIGCIFGT

252






DVV L ++ + +G I +VA+ NDTVGT ++ Y N + IG I GT


5HFU_(A)

190

DVVALIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDHNCE-----------IGLIVGT

238

GLK1

253

GTNGCYMEEINKITKLPQELRDKLIKEGKTHMIINVEWGSF--DNELKHLPTTKYDVVID

310






G+N CYMEE+ I + + EG+ M IN+EWG+F D L + T++D ID


5HFU_(A)

239

GSNACYMEEMRHIDMVEGD-------EGR--MCINMEWGAFGDDGSLNDI-RTEFDQEID

288

GLK1

311

QKLSTNPGFHLFEKRVSGMFLGEVLRNILVDLHSQGLLLQQYRSKEQLPRHLTTPFQLSS

370






S NPG LFEK +SGM++GE++R ILV + + LL S E L T F+


5HFU_(A)

289

MG-SLNPGKQLFEKMISGMYMGELVRLILVKMAKEELLFGGKLSPELLN---TGRFETKD

344

GLK1

371

EVLSHIEIDDSTGLRETELSLLQSLRLPTTPTERVQIQKLVRAISRRSAYLAAVPLAAIL

430






+S IE + G+R+ +L L L T + V ++ + +S RSA L A LAA+L


5HFU_(A)

345

--ISDIE-GEKDGIRKAR-EVLMRLGLDPTQEDCVATHRICQIVSTRSASLCAATLAAVL

400

GLK1

431

--IKTNALNKRYHGEVEIGCDGSVVEYYPGFRSMLRHALALSPLGAEGERKVHLKIAKDG

488






IK N +R IG DGSV + +P F L + G + V ++DG


5HFU_(A)

401

QRIKENKGEERLRST--IGVDGSVYKKHPHFAKRLHKTVRRLVPGCD----VRFLRSEDG

454

GLK1

489

SGVGAALCALVA

500






SG GAA+ VA


5HFU_(A)

455

SGKGAAMVTAVA

466

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein5HFU (Chain A)
Crystal Structure Of Human Hexokinase 2 With Cmpd 27, A 2-amido-6- Benzenesulfonamide Glucosamine
  • PDB_Info
  • Homolog SourceHomo sapiens
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15