Alignment of GLK1/YCL040W and PDB 4JAX (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GLK1/YCL040W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GLK1/YCL040W and PDB protein 4JAX (chain A)Jump to
Structure
Alignment Details
GLK1 length = 501 aaAlignment Length = 473 aa (94.4%)P-value = 2.4e-70%Identity = 38%Similar = 16
Alignment Position

Sequence Alignment

GLK1

25

FEVTPEKLDELTAYFIEQMEKGLAPPKEGHTLASDKGLPMIPAFVTGSPNGTERGVLLAA

84






F V+ EK+ + +FI +++KGL+ K+G + PMIP +V P G E G LA


4JAX_(A)

34

FTVSSEKMRSIVKHFISELDKGLS--KKGGNI------PMIPGWVVEYPTGKETGDFLAL

85

GLK1

85

DLGGTNFRICSVNLHGDHTFSMEQMKSKIPDDLLDDENVTSDDLFGFLARRTLAFMKKYH

144






DLGGTN R+ V L G+H F Q K ++PD L TS+ L+ F+A+ F+ +++


4JAX_(A)

86

DLGGTNLRVVLVKLGGNHDFDTTQNKYRLPDHL---RTGTSEQLWSFIAKCLKEFVDEWY

142

GLK1

145

PDELAKGKDAKPMKLGFTFSYPVDQTSLNSGTLIRWTKGFRIADTVGKDVVQLYQEQLSA

204






PD +++ P+ LGFTFSYP Q +NSG L RWTKGF I G DVV + QEQ+


4JAX_(A)

143

PDGVSE-----PLPLGFTFSYPASQKKINSGVLQRWTKGFDIEGVEGHDVVPMLQEQIEK

197

GLK1

205

QGMPMIKVVALTNDTVGTYLSHCYTSDNTDSMTSGEISEPVIGCIFGTGTNGCYMEEINK

264






+P I VVAL NDT GT ++ YT T +G I GTG NG Y + ++


4JAX_(A)

198

LNIP-INVVALINDTTGTLVASLYTDPQTK-----------MGIIIGTGVNGAYYDVVSG

245

GLK1

265

ITKLPQELRDKLIKEGKTHMIINVEWGSFDNELKHLPTTKYDVVIDQKLSTNPGFHLFEK

324






I KL L + + + M IN E+GSFDNE LP TKYDV+ID++ S PG FEK


4JAX_(A)

246

IEKLEGLLPEDIGPDSP--MAINCEYGSFDNEHLVLPRTKYDVIIDEE-SPRPGQQAFEK

302

GLK1

325

RVSGMFLGEVLRNILVDLHSQGLLLQQYRSKEQLPRHLTTPFQLSSEVLSHIEIDDSTGL

384






SG +LGE++R +L+DL+ G + K+Q L + + + S IE D L


4JAX_(A)

303

MTSGYYLGEIMRLVLLDLYDSGFIF-----KDQDISKLKEAYVMDTSYPSKIEDDPFENL

357

GLK1

385

RETELSLLQSLRLPTTPTERVQIQKLVRAISRRSAYLAAVPLAAILIKTNALNKRYHGEV

444






+T+ +L + TT ER I+KL + R+A L ++AI +KR +


4JAX_(A)

358

EDTDDLFKTNLNIETTVVERKLIRKLAELVGTRAARLTVCGVSAIC------DKRGYKTA

411

GLK1

445

EIGCDGSVVEYYPGFRSMLRHALA-LSPLGAEG--ERKVHLKIAKDGSGVGAALCA

497






I DGSV YPG++ AL + E + + L A+DGSGVGAA+ A


4JAX_(A)

412

HIAADGSVFNRYPGYKEKAAQALKDIYNWDVEKMEDHPIQLVAAEDGSGVGAAIIA

467

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein4JAX (Chain A)
Crystal Structure Of Dimeric Klhxk1 In Crystal Form X
  • PDB_Info
  • Homolog SourceKluyveromyces lactis NRRL Y-1140
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15