Alignment of GLK1/YCL040W and PDB 4DCH (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GLK1/YCL040W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GLK1/YCL040W and PDB protein 4DCH (chain A)Jump to
Structure
Alignment Details
GLK1 length = 501 aaAlignment Length = 490 aa (97.8%)P-value = 2.8e-51%Identity = 31%Similar = 22
Alignment Position

Sequence Alignment

GLK1

11

ERAVIQAVDQICDDFEVTPEKLDELTAYFIEQMEKGLAPPKEGHTLASDKGLPMIPAFVT

70






E A + V+QI +F++ E L ++ ++M++GL E H AS K M+P +V


4DCH_(A)

9

EAAKKEKVEQILAEFQLQEEDLKKVMRRMQKEMDRGLR--LETHEEASVK---MLPTYVR

63

GLK1

71

GSPNGTERGVLLAADLGGTNFRICSVNL-HGDH-TFSME---QMKSKIPDDLLDDENVTS

125






+P G+E G L+ DLGGTNFR+ V + G+ +S++ QM S IP+D + T+


4DCH_(A)

64

STPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYS-IPEDAMTG---TA

119

GLK1

126

DDLFGFLARRTLAFMKKYHPDELAKGKDAKPMKLGFTFSYPVDQTSLNSGTLIRWTKGFR

185






+ LF +++ F+ K+ K + LGFTFS+PV ++ G L+ WTKGF+


4DCH_(A)

120

EMLFDYISECISDFLDKHQMKH-------KKLPLGFTFSFPVRHEDIDKGILLNWTKGFK

172

GLK1

186

IADTVGKDVVQLYQEQLSAQGMPMIKVVALTNDTVGTYLSHCYTSDNTDSMTSGEISEPV

245






+ G +VV L ++ + +G + VVA+ NDTV T +S CY D+ +


4DCH_(A)

173

ASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMIS-CYYEDH----------QCE

221

GLK1

246

IGCIFGTGTNGCYMEEINKITKLPQELRDKLIKEGKTHMIINVEWGSFDN--ELKHLPTT

303






+G I GTG N CYMEE+ + +L++ + M +N EWG+F + EL


4DCH_(A)

222

VGMIVGTGCNACYMEEMQNV---------ELVEGDEGRMCVNTEWGAFGDSGELDEF-LL

271

GLK1

304

KYDVVIDQKLSTNPGFHLFEKRVSGMFLGEVLRNILVDLHSQGLLLQQYRSKEQLPRHLT

363






+YD ++D+ S NPG L+EK + G ++GE++R +L+ L + LL S++ L


4DCH_(A)

272

EYDRLVDES-SANPGQQLYEKLIGGKYMGELVRLVLLRLVDENLLFHGEASEQ-----LR

325

GLK1

364

TPFQLSSEVLSHIEIDDSTGLRETELSLLQSLRLPTTPTERVQIQKLVRAISRRSAYLAA

423






T + +S +E D TG R+ ++L +L L + T+ +++ ++S R+A++ +


4DCH_(A)

326

TRGAFETRFVSQVESD--TGDRKQIYNILSTLGLRPSTTDCDIVRRACESVSTRAAHMCS

383

GLK1

424

VPLAAILIKTNALNKRYHGEVEIGCDGSVVEYYPGFRSMLRHALALSPLGAEGERKVHLK

483






LA ++ + + +G DGSV + +P F+ HA ++ L E +


4DCH_(A)

384

AGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFKERF-HA-SVRRLTPSCE--ITFI

439

GLK1

484

IAKDGSGVGAALCALVA

500






+++GSG GAAL + VA


4DCH_(A)

440

ESEEGSGRGAALVSAVA

456

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein4DCH (Chain A)
Insights Into Glucokinase Activation Mechanism: Observation Of Multiple Distinct Protein Conformations
  • PDB_Info
  • Homolog SourceHomo sapiens
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15