Alignment of GLK1/YCL040W and PDB 3QIC (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GLK1/YCL040W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GLK1/YCL040W and PDB protein 3QIC (chain A)Jump to
Structure
Alignment Details
GLK1 length = 501 aaAlignment Length = 485 aa (96.8%)P-value = 4.1e-50%Identity = 31%Similar = 21
Alignment Position

Sequence Alignment

GLK1

16

QAVDQICDDFEVTPEKLDELTAYFIEQMEKGLAPPKEGHTLASDKGLPMIPAFVTGSPNG

75






+ V+QI +F++ E L ++ ++M++GL E H AS K M+P +V +P G


3QIC_(A)

19

EKVEQILAEFQLQEEDLKKVMRRMQKEMDRGLR--LETHEEASVK---MLPTYVRSTPEG

73

GLK1

76

TERGVLLAADLGGTNFRICSVNL-HGDH-TFSME---QMKSKIPDDLLDDENVTSDDLFG

130






+E G L+ DLGGTNFR+ V + G+ +S++ QM S IP+D + T++ LF


3QIC_(A)

74

SEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYS-IPEDAMTG---TAEMLFD

129

GLK1

131

FLARRTLAFMKKYHPDELAKGKDAKPMKLGFTFSYPVDQTSLNSGTLIRWTKGFRIADTV

190






+++ F+ K+ K + LGFTFS+PV ++ G L+ WTKGF+ +


3QIC_(A)

130

YISECISDFLDKHQMKH-------KKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAE

182

GLK1

191

GKDVVQLYQEQLSAQGMPMIKVVALTNDTVGTYLSHCYTSDNTDSMTSGEISEPVIGCIF

250






G +VV L ++ + +G + VVA+ NDTV T +S CY D+ + +G I


3QIC_(A)

183

GNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMIS-CYYEDH----------QCEVGMIV

231

GLK1

251

GTGTNGCYMEEINKITKLPQELRDKLIKEGKTHMIINVEWGSFDN--ELKHLPTTKYDVV

308






GTG N CYMEE+ + +L++ + M +N EWG+F + EL +YD +


3QIC_(A)

232

GTGCNACYMEEMQNV---------ELVEGDEGRMCVNTEWGAFGDSGELDEF-LLEYDRL

281

GLK1

309

IDQKLSTNPGFHLFEKRVSGMFLGEVLRNILVDLHSQGLLLQQYRSKEQLPRHLTTPFQL

368






+D+ S NPG L+EK + G ++GE++R +L+ L + LL S++ L T


3QIC_(A)

282

VDES-SANPGQQLYEKLIGGKYMGELVRLVLLRLVDENLLFHGEASEQ-----LRTRGAF

335

GLK1

369

SSEVLSHIEIDDSTGLRETELSLLQSLRLPTTPTERVQIQKLVRAISRRSAYLAAVPLAA

428






+ +S ++ D TG R+ ++L +L L + T+ +++ ++S R+A++ + LA


3QIC_(A)

336

ETRFVSQVKSD--TGDRKQIYNILSTLGLRPSTTDCDIVRRACESVSTRAAHMCSAGLAG

393

GLK1

429

ILIKTNALNKRYHGEVEIGCDGSVVEYYPGFRSMLRHALALSPLGAEGERKVHLKIAKDG

488






++ + + +G DG V + +P F+ HA ++ L E + +++G


3QIC_(A)

394

VINRMRESRSEDVMRITVGVDGXVYKLHPSFKERF-HA-SVRRLTPSCE--ITFIESEEG

449

GLK1

489

SGVGAALCALVA

500






SG GAAL + VA


3QIC_(A)

450

SGRGAALVSAVA

461

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3QIC (Chain A)
The Structure Of Human Glucokinase E339k Mutation
  • PDB_Info
  • Homolog SourceHomo sapiens
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15