Alignment of GLK1/YCL040W and PDB 3O8M (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GLK1/YCL040W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GLK1/YCL040W and PDB protein 3O8M (chain A)Jump to
Structure
Alignment Details
GLK1 length = 501 aaAlignment Length = 473 aa (94.4%)P-value = 2.4e-70%Identity = 38%Similar = 16
Alignment Position

Sequence Alignment

GLK1

25

FEVTPEKLDELTAYFIEQMEKGLAPPKEGHTLASDKGLPMIPAFVTGSPNGTERGVLLAA

84






F V+ EK+ + +FI +++KGL+ K+G + PMIP +V P G E G LA


3O8M_(A)

34

FTVSSEKMRSIVKHFISELDKGLS--KKGGNI------PMIPGWVVEYPTGKETGDFLAL

85

GLK1

85

DLGGTNFRICSVNLHGDHTFSMEQMKSKIPDDLLDDENVTSDDLFGFLARRTLAFMKKYH

144






DLGGTN R+ V L G+H F Q K ++PD L TS+ L+ F+A+ F+ +++


3O8M_(A)

86

DLGGTNLRVVLVKLGGNHDFDTTQNKYRLPDHL---RTGTSEQLWSFIAKCLKEFVDEWY

142

GLK1

145

PDELAKGKDAKPMKLGFTFSYPVDQTSLNSGTLIRWTKGFRIADTVGKDVVQLYQEQLSA

204






PD +++ P+ LGFTFSYP Q +NSG L RWTKGF I G DVV + QEQ+


3O8M_(A)

143

PDGVSE-----PLPLGFTFSYPASQKKINSGVLQRWTKGFDIEGVEGHDVVPMLQEQIEK

197

GLK1

205

QGMPMIKVVALTNDTVGTYLSHCYTSDNTDSMTSGEISEPVIGCIFGTGTNGCYMEEINK

264






+P I VVAL NDT GT ++ YT T +G I GTG NG Y + ++


3O8M_(A)

198

LNIP-INVVALINDTTGTLVASLYTDPQTK-----------MGIIIGTGVNGAYYDVVSG

245

GLK1

265

ITKLPQELRDKLIKEGKTHMIINVEWGSFDNELKHLPTTKYDVVIDQKLSTNPGFHLFEK

324






I KL L + + + M IN E+GSFDNE LP TKYDV+ID++ S PG FEK


3O8M_(A)

246

IEKLEGLLPEDIGPDSP--MAINCEYGSFDNEHLVLPRTKYDVIIDEE-SPRPGQQAFEK

302

GLK1

325

RVSGMFLGEVLRNILVDLHSQGLLLQQYRSKEQLPRHLTTPFQLSSEVLSHIEIDDSTGL

384






SG +LGE++R +L+DL+ G + K+Q L + + + S IE D L


3O8M_(A)

303

MTSGYYLGEIMRLVLLDLYDSGFIF-----KDQDISKLKEAYVMDTSYPSKIEDDPFENL

357

GLK1

385

RETELSLLQSLRLPTTPTERVQIQKLVRAISRRSAYLAAVPLAAILIKTNALNKRYHGEV

444






+T+ +L + TT ER I+KL + R+A L ++AI +KR +


3O8M_(A)

358

EDTDDLFKTNLNIETTVVERKLIRKLAELVGTRAARLTVCGVSAIC------DKRGYKTA

411

GLK1

445

EIGCDGSVVEYYPGFRSMLRHALA-LSPLGAEG--ERKVHLKIAKDGSGVGAALCA

497






I DGSV YPG++ AL + E + + L A+DGSGVGAA+ A


3O8M_(A)

412

HIAADGSVFNRYPGYKEKAAQALKDIYNWDVEKMEDHPIQLVAAEDGSGVGAAIIA

467

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3O8M (Chain A)
Crystal Structure Of Monomeric Klhxk1 In Crystal Form Xi With Glucose Bound (Closed State)
  • PDB_Info
  • Homolog SourceKluyveromyces lactis
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15