Alignment of GLK1/YCL040W and PDB 3IMX (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GLK1/YCL040W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GLK1/YCL040W and PDB protein 3IMX (chain A)Jump to
Structure
Alignment Details
GLK1 length = 501 aaAlignment Length = 483 aa (96.4%)P-value = 7.4e-51%Identity = 31%Similar = 22
Alignment Position

Sequence Alignment

GLK1

18

VDQICDDFEVTPEKLDELTAYFIEQMEKGLAPPKEGHTLASDKGLPMIPAFVTGSPNGTE

77






V+QI +F++ E L ++ ++M++GL E H AS K M+P +V +P G+E


3IMX_(A)

6

VEQILAEFQLQEEDLKKVMRRMQKEMDRGLR--LETHEEASVK---MLPTYVRSTPEGSE

60

GLK1

78

RGVLLAADLGGTNFRICSVNL-HGDH-TFSME---QMKSKIPDDLLDDENVTSDDLFGFL

132






G L+ DLGGTNFR+ V + G+ +S++ QM S IP+D + T++ LF ++


3IMX_(A)

61

VGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYS-IPEDAMTG---TAEMLFDYI

116

GLK1

133

ARRTLAFMKKYHPDELAKGKDAKPMKLGFTFSYPVDQTSLNSGTLIRWTKGFRIADTVGK

192






+ F+ K+ K + LGFTFS+PV ++ G L+ WTKGF+ + G


3IMX_(A)

117

SECISDFLDKHQMKH-------KKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGN

169

GLK1

193

DVVQLYQEQLSAQGMPMIKVVALTNDTVGTYLSHCYTSDNTDSMTSGEISEPVIGCIFGT

252






+VV L ++ + +G + VVA+ NDTV T +S CY D+ + +G I GT


3IMX_(A)

170

NVVGLLRDAIKRRGDFEMDVVAMVNDTVATMIS-CYYEDH----------QCEVGMIVGT

218

GLK1

253

GTNGCYMEEINKITKLPQELRDKLIKEGKTHMIINVEWGSFDN--ELKHLPTTKYDVVID

310






G N CYMEE+ + +L++ + M +N EWG+F + EL +YD ++D


3IMX_(A)

219

GCNACYMEEMQNV---------ELVEGDEGRMCVNTEWGAFGDSGELDEF-LLEYDRLVD

268

GLK1

311

QKLSTNPGFHLFEKRVSGMFLGEVLRNILVDLHSQGLLLQQYRSKEQLPRHLTTPFQLSS

370






+ S NPG L+EK + G ++GE++R +L+ L + LL S++ L T +


3IMX_(A)

269

ES-SANPGQQLYEKLIGGKYMGELVRLVLLRLVDENLLFHGEASEQ-----LRTRGAFET

322

GLK1

371

EVLSHIEIDDSTGLRETELSLLQSLRLPTTPTERVQIQKLVRAISRRSAYLAAVPLAAIL

430






+S +E D TG R+ ++L +L L + T+ +++ ++S R+A++ + LA ++


3IMX_(A)

323

RFVSQVESD--TGDRKQIYNILSTLGLRPSTTDCDIVRRACESVSTRAAHMCSAGLAGVI

380

GLK1

431

IKTNALNKRYHGEVEIGCDGSVVEYYPGFRSMLRHALALSPLGAEGERKVHLKIAKDGSG

490






+ + +G DGSV + +P F+ HA ++ L E + +++GSG


3IMX_(A)

381

NRMRESRSEDVMRITVGVDGSVYKLHPSFKERF-HA-SVRRLTPSCE--ITFIESEEGSG

436

GLK1

491

VGAALCALVA

500






GAAL + VA


3IMX_(A)

437

RGAALVSAVA

446

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3IMX (Chain A)
Crystal Structure Of Human Glucokinase In Complex With A Synthetic Activator
  • PDB_Info
  • Homolog SourceHomo sapiens
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15