Alignment of GLK1/YCL040W and PDB 3HM8 (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GLK1/YCL040W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GLK1/YCL040W and PDB protein 3HM8 (chain B)Jump to
Structure
Alignment Details
GLK1 length = 501 aaAlignment Length = 468 aa (93.4%)P-value = 8.7e-57%Identity = 36%Similar = 17
Alignment Position

Sequence Alignment

GLK1

33

DELTAYFIEQMEKGLAPPKEGHTLASDKGLPMIPAFVTGSPNGTERGVLLAADLGGTNFR

92






D+L A QM K +A G AS L M+P FV +P+G+ERG LA DLGGTNFR


3HM8_(B)

18

DQLAAVQA-QMRKAMAKGLRGE--ASS--LRMLPTFVRATPDGSERGDFLALDLGGTNFR

72

GLK1

93

ICSVNLHGDHTFSMEQMKSKIPDDLLDDENVTSDDLFGFLARRTLAFMKKYHPDELAKGK

152






+ V + + E IP+ + + LF + + F +K +G


3HM8_(B)

73

VLLVRVTTGVQITSEIYS--IPETVAQG---SGQQLFDHIVDCIVDFQQK-------QGL

120

GLK1

153

DAKPMKLGFTFSYPVDQTSLNSGTLIRWTKGFRIADTVGKDVVQLYQEQLSAQGMPMIKV

212






+ + LGFTFS+P Q L+ G L+ WTKGF+ +D G+DVV L +E ++ + + V


3HM8_(B)

121

SGQSLPLGFTFSFPCRQLGLDQGILLNWTKGFKASDCEGQDVVSLLREAITRRQAVELNV

180

GLK1

213

VALTNDTVGTYLSHCYTSDNTDSMTSGEISEPVIGCIFGTGTNGCYMEEINKITKLPQEL

272






VA+ NDTVGT +S Y + IG I GTGTN CYMEE+ + +P +


3HM8_(B)

181

VAIVNDTVGTMMSCGYEDPRCE-----------IGLIVGTGTNACYMEELRNVAGVPGD-

228

GLK1

273

RDKLIKEGKTHMIINVEWGSF--DNELKHLPTTKYDVVIDQKLSTNPGFHLFEKRVSGMF

330






G+ M IN+EWG+F D L L +T++D +DQ S NPG FEK +SGM+


3HM8_(B)

229

------SGR--MCINMEWGAFGDDGSLAML-STRFDASVDQA-SINPGKQRFEKMISGMY

278

GLK1

331

LGEVLRNILVDLHSQGLLLQQYRSKEQLPRHLTTPFQLSSEVLSHIEIDDSTGLRETELS

390






LGE++R+IL+ L S G+L +R +Q+ R L T ++ LS IE DS LR+ +


3HM8_(B)

279

LGEIVRHILLHLTSLGVL---FRG-QQIQR-LQTRDIFKTKFLSEIE-SDSLALRQVR-A

331

GLK1

391

LLQSLRLPTTPTERVQIQKLVRAISRRSAYLAAVPLAAILIKTNALNKRYHGEVEIGCDG

450






+L+ L LP T + + + ++ +A+S+R+A L +AA++ K V +G DG


3HM8_(B)

332

ILEDLGLPLTSDDALMVLEVCQAVSQRAAQLCGAGVAAVVEKIRENRGLEELAVSVGVDG

391

GLK1

451

SVVEYYPGFRSMLRHALA-LSPLGAEGERKVHLKIAKDGSGVGAALCALVA

500






++ + +P F S++ + L+P V ++DGSG GAAL VA


3HM8_(B)

392

TLYKLHPRFSSLVAATVRELAPRCV-----VTFLQSEDGSGKGAALVTAVA

437

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3HM8 (Chain B)
Crystal Structure Of The C-Terminal Hexokinase Domain Of Human Hk3
  • PDB_Info
  • Homolog SourceHomo sapiens
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15