Alignment of GLK1/YCL040W and PDB 1QHA (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GLK1/YCL040W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GLK1/YCL040W and PDB protein 1QHA (chain B)Jump to
Structure
Alignment Details
GLK1 length = 501 aaAlignment Length = 482 aa (96.2%)P-value = 1.5e-54%Identity = 33%Similar = 19
Alignment Position

Sequence Alignment

GLK1

18

VDQICDDFEVTPEKLDELTAYFIEQMEKGLAPPKEGHTLASDKGLPMIPAFVTGSPNGTE

77






+++ F +T + L E+ +ME GL K+ H A K M+P+FV +P+GTE


1QHA_(B)

470

IEETLAHFHLTKDMLLEVKKRMRAEMELGLR--KQTHNNAVVK---MLPSFVRRTPDGTE

524

GLK1

78

RGVLLAADLGGTNFRICSVNLHGDHTFSMEQMKSKIPDDLLDDENVTSDDLFGFLARRTL

137






G LA DLGGTNFR+ V + ++E M +KI ++ T ++LF +


1QHA_(B)

525

NGDFLALDLGGTNFRVLLVKIRSGKKRTVE-MHNKIYAIPIEIMQGTGEELFDHIVSCIS

583

GLK1

138

AFMKKYHPDELAKGKDAKPMKLGFTFSYPVDQTSLNSGTLIRWTKGFRIADTVGKDVVQL

197






F+ D + G M LGFTFS+P QTSL++G LI WTKGF+ D VG DVV L


1QHA_(B)

584

DFL-----DYM--GIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTL

636

GLK1

198

YQEQLSAQGMPMIKVVALTNDTVGTYLSHCYTSDNTDSMTSGEISEPVIGCIFGTGTNGC

257






++ + + + VVA+ NDTVGT ++ Y + +G I GTG+N C


1QHA_(B)

637

LRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCE-----------VGLIVGTGSNAC

685

GLK1

258

YMEEINKITKLPQELRDKLIKEGKTHMIINVEWGSF-DNELKHLPTTKYDVVIDQKLSTN

316






YMEE+ + ++++ + M IN+EWG+F DN T YD ++++ S N


1QHA_(B)

686

YMEEMKNV---------EMVEGDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVNE-YSLN

735

GLK1

317

PGFHLFEKRVSGMFLGEVLRNILVDLHSQGLLLQQYRSKEQLPRHLTTPFQLSSEVLSHI

376






G +EK +SGM+LGE++RNIL+D +G L +R Q+ L T ++ LS I


1QHA_(B)

736

AGKQRYEKMISGMYLGEIVRNILIDFTKKGFL---FRG--QISETLKTRGIFETKFLSQI

790

GLK1

377

EIDDSTGLRETELSLLQSLRLPTTPTERVQIQKLVRAISRRSAYLAAVPLAAILIKTNAL

436






E D L + ++LQ L L +T + + ++ + +SRR+A L +AA++ K


1QHA_(B)

791

E-SDRLALLQVR-AILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIREN

848

GLK1

437

NKRYHGEVEIGCDGSVVEYYPGFRSMLRHALA-LSPLGAEGERKVHLKIAKDGSGVGAAL

495






V +G DG++ + +P F ++ + LSP + V +++DGSG GAAL


1QHA_(B)

849

RGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSP-----KCNVSFLLSEDGSGKGAAL

903

GLK1

496

CALV

499






V


1QHA_(B)

904

ITAV

907

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1QHA (Chain B)
Human Hexokinase Type I Complexed With Atp Analogue Amp-Pnp
  • PDB_Info
  • Homolog SourceHomo sapiens
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15