Alignment of GLK1/YCL040W and PDB 1BG3 (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein GLK1/YCL040W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene GLK1/YCL040W and PDB protein 1BG3 (chain B)Jump to
Structure
Alignment Details
GLK1 length = 501 aaAlignment Length = 482 aa (96.2%)P-value = 1.9e-55%Identity = 34%Similar = 18
Alignment Position

Sequence Alignment

GLK1

18

VDQICDDFEVTPEKLDELTAYFIEQMEKGLAPPKEGHTLASDKGLPMIPAFVTGSPNGTE

77






+++ F ++ + L E+ +ME GL KE ++ A+ K M+P+FV P+GTE


1BG3_(B)

470

IEETLAHFRLSKQTLMEVKKRLRTEMEMGLR--KETNSKATVK---MLPSFVRSIPDGTE

524

GLK1

78

RGVLLAADLGGTNFRICSVNLHGDHTFSMEQMKSKIPDDLLDDENVTSDDLFGFLARRTL

137






G LA DLGGTNFR+ V + ++E M +KI L+ T D+LF +


1BG3_(B)

525

HGDFLALDLGGTNFRVLLVKIRSGKKRTVE-MHNKIYSIPLEIMQGTGDELFDHIVSCIS

583

GLK1

138

AFMKKYHPDELAKGKDAKPMKLGFTFSYPVDQTSLNSGTLIRWTKGFRIADTVGKDVVQL

197






F+ D + G M LGFTFS+P QT+L+ G LI WTKGF+ D G DV L


1BG3_(B)

584

DFL-----DYM--GIKGPRMPLGFTFSFPCHQTNLDCGILISWTKGFKATDCEGHDVASL

636

GLK1

198

YQEQLSAQGMPMIKVVALTNDTVGTYLSHCYTSDNTDSMTSGEISEPVIGCIFGTGTNGC

257






++ + + + VVA+ NDTVGT ++ Y + IG I GTGTN C


1BG3_(B)

637

LRDAVKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCE-----------IGLIVGTGTNAC

685

GLK1

258

YMEEINKITKLPQELRDKLIKEGKTHMIINVEWGSF-DNELKHLPTTKYDVVIDQKLSTN

316






YMEE+ + ++++ + M IN+EWG+F DN T +D V+D+ S N


1BG3_(B)

686

YMEEMKNV---------EMVEGNQGQMCINMEWGAFGDNGCLDDIRTDFDKVVDE-YSLN

735

GLK1

317

PGFHLFEKRVSGMFLGEVLRNILVDLHSQGLLLQQYRSKEQLPRHLTTPFQLSSEVLSHI

376






G FEK +SGM+LGE++RNIL+D +G L +R Q+ L T ++ LS I


1BG3_(B)

736

SGKQRFEKMISGMYLGEIVRNILIDFTKKGFL---FRG--QISEPLKTRGIFETKFLSQI

790

GLK1

377

EIDDSTGLRETELSLLQSLRLPTTPTERVQIQKLVRAISRRSAYLAAVPLAAILIKTNAL

436






E D L + ++LQ L L +T + + ++ + +S+R+A L +AA++ K


1BG3_(B)

791

E-SDRLALLQVR-AILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAAVVEKIREN

848

GLK1

437

NKRYHGEVEIGCDGSVVEYYPGFRSMLRHALA-LSPLGAEGERKVHLKIAKDGSGVGAAL

495






H V +G DG++ + +P F ++ + LSP + V +++DGSG GAAL


1BG3_(B)

849

RGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSP-----KCTVSFLLSEDGSGKGAAL

903

GLK1

496

CALV

499






V


1BG3_(B)

904

ITAV

907

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1BG3 (Chain B)
Rat Brain Hexokinase Type I Complex With Glucose And Inhibitor Glucose-6-Phosphate
  • PDB_Info
  • Homolog SourceRattus norvegicus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2016-09-15