Protein Translation for a region of Chromosome IX



Send questions or suggestions to SGD

BLAST search


Protein translation of the coding sequence.

Other Formats Available: GCG | FASTA

HTHHTHTTPHHTHTHTHHTHTPHPHQLSLIYLYSRCHTLPGFLTEIKKNENEILFFSPTT
LLHSPK*P*IALIYVSSKPY*LLPGVSAKSYTYYLYFMFTFYRLSFHPTPSHLSLATAVQ
QTLNQNSKILHQNAYSLEKNFLTIYYTTQYIISDFRNNNFLHSPTSLLESLHNNISNLPS
GTSSLSSSL*TATISMYSGTLVSSAARTSTFAKSSQCGNNHTSEICSKRYSSFCRNVLL*
NSPISIERNAVQCGTLDGVTPSAI*SRKCIPRLNSYLLLNCR*CLLNCSLTYCGPCSPAL
VMERKR*KTPPFSSASTTTVSSFASHSSWHFFSSQFKKYCSTSVFDSRKLLHTLKYNSLI
CLPDMRKTWLPCLPLVESNTLIVSLLLVMARYQA*FLCI*E*ISLLFTLKYFKYPTGSP*
YGSMSSKYSLYSSSFRSILSTASASQAILRYDTFWPAQQTQSSNIF*QPLHNPYCVNTPS
GQKYMSIP*RKRCLISSDRNPRNCKTFIFSEVLGNCAFSFFLSSKTI*LPFRLYDSLLMS
VTGWNLLSSALPSLLASSLALALVLSVVVALVLELVLSVVAALVLELVLSVVVALVLELV
LSVVVALVLELVLSVVVALVLELVLSVVVALVLELILLVVVALVLTLMLAVVVALVLELV
LSVVVALVLTLMLAVVVALVLELVLSVVVALVLELVLSVVVALVLELVLSVVVALVLTLM
LAVVVALVLTLVLAVVVALVLELVVALVLALVVALVLALVLALVVALVLALVVALVLTLV
LAVVIALVLALVLALALP*MHVLLSSSLLQYFLYLSLLLLSWKLDGNATIDMEAVACFSA
NLSILSISSTVSADRSVLEPQHPTCWPFFPFFDSSP*NSRTCSVIQPSLIGGNSPLRFLA
AQLFFLDNR*QRPPSLSLPTP*MSSIILSLLSSMITIINCLMSIPSVTNFVPMRTCMLPS
VTNSFVRDTFSAAPSFPCIHTTLKYFLQEQANSSTSLVVLATTMAFDSGSLSKRAKRSFS
ASSGCDSTFFRIL*TCPKGTSDFSLIRLNIRVG*LDRPLLRSSDRLSSLMSIDFLASPVS
PIRCNAASATASGAVPLKKIAFSKASKSRLVMPPNCDCR*TSVSKL*NSSTMR*PNFTLL
VLKVHSTIFSHAAILSVKLVLARSS*IPTYKSVTPS*PSSIKFLTGATFKQPHRPNLIMQ
LASNTVYGTNRNDTYSTSPLDASAIKGR*NNSVLP*PGGACTATEGVSAMYIS*HKRN*C
KSLNSKELPKSFWPATRISFVLLGSRGLFRVTLEIF***FELAASPATTSSAFRVLENEQ
W*SLSRPNH*IQRSEARSCNKVAVVPLTLVNEKESTP*IFRPV*TE*LAMSSLVADSYKS
VSNLLPTQCRPRAINP*RISRKFSF*GAFFGSSLMYCRKVAYSTRQPFAVFRNM*EYKTI
LEMSRFVT*FGSSNPTTSIQGS*LKAS*LLPSAHICICLSTVTK*NT*SEVSPSSVFSRG
SDEPFLL*SVYSWMRLVVSSTYTLR*GPAKASS*SSG*R*GYPTAKWIIHISGTVSSSIA
TATLFLRAAVILLVSLLNLGSTISRYLTGII*RKESFSRYSSIPRFGSLNKTSRLRKMRL
AISTTVGI*KQLFNSPQRLSN*ALHAK*KPRTYSRLKKFSTY*YTIRRRYQSYSIRVLQR
GFLRYFVVQNFDPFPHCNAVVVIKYI*IPCGTSTRRHQ*SFHGI*CFSESSWSVRTAQLT
YFQAMLVHRGNNGFFIRNRSILFVTSATTGTRPEIECTCSQDNMQNITQSVLFVHHIVTY
L*KVLYLNGFTWA*ITLQPLCVDFLFAR*TCLVCRKNR*LIYV**QKHVGCQIVPIFPYG
AFLKTPYNRCAGNKVSESTHRRAVVRPSTRYFVTTFQDTETQLIIVSSVEVKKRKGIVIL
SIEFQSMHLKQRVDHQVDFLGNKIL*RDWSALEIWFVFNKRQELFYIFPDHDGNDNFFKR
PFPIHCTSSEFYHFD*ARLFVFVE*PHFRGDRFK*SY*GTMYQVVFVI*SRLKLVKVCFF
KLTPIGNFHFIFVSFEINNSMLIVMLFDKKSININKRLSSFRLIII*ECNN*AIEKMQNL
RYAGANL*QQQRKFS**EISLR*ATVCPLQAQHRKQKDVSFIA*FPACKNKVVGTYVRFQ
FPWCTVS*LSA*SRRTRILFVAQPLRGYSLGYFKHGPTLSLRLAYNFFRYRKDQYNKKL*
ITFPY*VYDLALRSKGALFGVPTYGASDRQPSLKMYYPAE*ENRPIHQRRIKLLP*FAMS
HYKKIP*R*IFGLKSASNRKYCLFSYKVTS*MLYVPLHNKLKNFFYKL**FLFISNSILG
LNKSLTIFILLYCFVQLNFNTKLFNCFVFKIF*IIK*YRVLL*IFH*YLINKDFQHTAHK
ILITYVINNKAIF*PCHYPTMPHLLLTILLFYPTY*NVNK*S*IIHTYLPYHSNPTTTCH
THPHLYTDMPYAHGCYSIYHLNLPYSHIPLHSTAHSH*ISINALTSLCTALASAVYTLCH
LPIKPTIIHILISISHSAAPNIV*LPLIHTLYHFFTIY*PLNLYTLMPILHKNHHQNHLN
IKIFYSSTIIHKHIGLKYEHYHGITNLKDP*YCNLLERMPFQNISYLHTPDITIICHLTV
VTLFIH*AIIR*WLALMRGL*YNCILFPFPYANRNILKA*LMHL*SCM*HYSYEETISEQ
DDTVIGTLFNRIYNEMSNNFTVI*LISGVYLNGRYDIVSLHLTTLYLIVDRTLTPQLYF*
LQLHKKLCQPKNFDILRVKK*GSLNESLIP*LVARTALICNHVLRSDAYSIRPDATRQKM
KKEAATHFYGRTKCCEVIRFQFHCCLLDIHC*LYYRPRFFYNNVKVSFYVYHIHKMLHEH
RH*SNRSIILIYIYIIYGIYIIKKK*FFIYFILFVNFQCLWKPVRKIGVCL*FAIV*IPS
LDRALEMAGFNLLEYHGTPVIILVTWSGEIPVNMVVKSP*LKTASATSTG*VSVGCAAWN
M*YWAK*ALISET*TPNSTKLTLSSD*ARVVVAEAVAAMAATPAAIEVNLTIVFVLFVSA
DISLTGKKRIKTYSQRHIVGAALFIPVPPSVIIT*TIR*QMLI*YLTYSPYLIFHTISLS
L*RCSCF*TNHTSLIDFVCGVLFYGTHVYSYAQNVRMPIIGVPRCLEKPFCAPAKFPFSV
KKNIRILDLDPRTEAYCLSLNSVCSKRLPCKKYFYLLNSYNIKRVLGVVYC*GLQICKLS
ANALVQLRNCSR*RRMVLREVDIQRILYDKNKIVTSS**QY*NFAQGEIFDSEMYSPFSS
QI*RKKV*GQ*MALICSILF*KRFLGKIY**LILLVISKSKEMSLSLS*RLIVRAQLCLL
DVFPKFHV**PSQHRFL*EQMATKVSFK*A*QSTPSKRSSLFFQTHEKKIQFLFHTKK*R
RNHVLRVACSRRSLRS*PIM*FVVSHPSMIMCPYYLLSNYYICFELICTKHLKLRTHFHW
QRLDEI*YTAIISSDTLQEFPPIMAARCPKDCAALDCFLHSFFPGDKQTKRKLRYNAVEV
PQELERKY*FDSQHYSIQWVLVPFSVVWL*FNCIRS*RDQPHMSIIIFRGTGKPYCLERI
SGKRVCRVFTSFIHILLSKLYLDPES*RWKRRQGWISYVGVFQ*DVYDLV*ETDVSSQHS
HYDDSLTSY*AASTEYNEKKKIIP*NSFFRKLLKVIAPQEQFFV*IYYQIHHRQSYKLHC
IPGDPSNPKYHFLILQSYLLALANI*SPYYLDG*PRSEHLRTKVTESQGMQNSWLSALKT
MLQPFASIIYIYIYIYISRPLSFFCQLGRNAGSRDLKKAS*RY*R*RYTHNGIVSCPVYY
LGIPTHSTVQCRRIHPQGYQNFVKICIRYSKL**FKHFDQSRRRLCRDKF*CWRKLENNR
*D*RAYRVICC*SLPWA**SFCFRENGTKILRHG*SR*IVEAFDYTHF*ESIELFLRRNY
SPYKKEASYYSL*FVDNKKLRLNVCWKRDLHN**WSILFPS*TFFWKN*WSY*HGTL*LY
*I**GF*SGR**CFDTLSFPKH*VH*KYRLNY*QV*IDFKCRWR*NIQRISPVQR*GC*S
IRDT*ASCDRFDTR*YV**NVINKHLDIQ*CIHFSSGSYTY*DTAR*YGTNS*RFHRKNR
FTCI*RKR**RQQPTGSC*SVNIRF*RTKIFAYKLDTKQSVWIYQCSLSRFLKRNIFWFV
SSLH*IF**KKEIQPTESKRGN*SIC**RSHMDKLESC*PGKCRFIWL*CH*TREMFASD
SFL*SKKFKSLCRNHDDIGYCWRRQCIQLERRKNFHLQG*WFNMEVSP*FHWFIYYW*SG
KYYHVYSISFE*KWRCAF*ILLFLGSR*DMG*I*SNHAYLSIQISQHNIRWIWFKIYSNR
NVHYRRSNIHYIFN*FFSGI*L*IM*RG*F*RLESSRWKMC*WRQIQVQKEETGRPVFGK
KSIQRFEFR*NAL*QLYWIRLRMFV*IR*RCEG*LYTRL*SDCPFRYM*QIEG*ICVSKA
TTINQR**M*NTYEN*IRRHSV*RNSKGGFE*QGNSDY*KQIRL*N*ILPILRYSCRRIF
GHAEFDRRRLYIPRWWTNDKKV*H*RRKNCRNRV*PILQFFSIFVWL*R*HILNTR*RIL
FHDS*IT*SQAIRHATRF*C*STGYFYLLWW*EL*INFKSRMSCSGIPHQRWG*NFYRNA
**CNSL*VCRNTIQISVK*RYGYVPSKGKVFANKKFSFFY*LFPR**KNCL*KHYRLLVY
WWLYHCCRTS*RQ*IEGVCN**WC*VYRGKIPI**RYW*ARRIHYFRI*GRINIFTFSNK
LGIRTRFRKPFEIQLEWYFFCHLRACR**KHIRLCGL*KSSRS*RYYYHQHRFE*RKGWR
EQGRRTIEDENHLQ*RFRLELFEASKEGFGREKVSL*FCVIR*MFSTFAWLH*T*GYQGY
IFLWLRVRNDVWCRKCWR*ASTI*GVFHFSNH*WRRDVD*G*KRPPSMGVR*SWWSLGFG
PRKRRN*FYFLLHRFW*NMERL*ILWRQSPRKGYNHRSQRFCFEVFAIWRSKKHG*WFIQ
NVYN*F*KHLREAM*V*YYR*KKGRF*VLSSGFQNWLFVWP*NRIFT*NR*KMFYWEYST
F*IFEERQKLSMYKTRFRM*L*FL*SQ*WYL*ISQRLKFGEWCRYLQKGTRLN*IL*FLR
LSENSLINL*RWAEIGCTFSTTSLSGKRKGIQGKILYKHRRLCAGFCYNSSRYFLCRMVC
IR*RYQEKWGIFKI*RNQIRRRWADRKQ*DR*SCQHHCKTRIMHFFNHQVCVSTREGRYS
ATFFKI*GKVWQQKRCHLLFAAS*SAFR*TRWLP*RFQRFIQFQRSR**F*N*ARRC*HI
STRAYVADRPTWC*QYSRRFASA*CFSRVRFSSCTQRRQVGRSF*TNEIVHALYVGFLTY
QSLRSPFSTSITVLIELFFFLDTIYCG*FNISCPLNIFHGVDRTTSIVRSMEVK*TIPQT
K**RPQEALQSAVIIFMVLIVTIRLHSSKSS*CKFFYFYV*ELPKKKVWILTLLNKIIQS
IQTFYCFFFQLTISYYCTQLLITTYINCYSLRFRISHTQYRITTCMSLLFKVRYVT*INI
SICICIKILSSQSLIIQICKFCPPMASMFWKTHQLHFLGSFRIPT*TMSYCLES*SRSNQ
S*SSKQQTMFCCRISL*S*TVSYCPNQ*TQNHIHTQ*YPCVPF*ISRPPSRSSKPSWGPW
IRLQR*FLP*KTRSSKTMV*H*DQKNQHLAPHETIA*VF*HGLWK*GQLLPKTSSSPSSF
LHALP*SHHSYF*LRHPRIFR*ASS*N*FHPVPVLGTHIEYRSVTPTTQTTTYQK*HGFW
ENRHQIW*LNEVGRDFPDKLLTNNQFR*RI*KVQQGQPSNPLVHMVSNFDGTWAKSRHQC
GKS*ITH*VRVLTHLYTTSWSHQ*HVAFHQLS*FLCHPSLCF**TCSFLDETHGYVVRSL
*KDH*VATLSFRQSQERLVDQQPWSTSFPHQF*SRLHHGLTSIQRHFRRLPFCSLRSPSL
DQVGWSKTNASKTLVSFHRTSMQNHRSKTSNCLEELACLRRHNP*EVSRRTSHVLDWFLR
ICSL*TIHVRWSNG**LSR**ISYQAYVSFRSRQSSPRSYRRLARPFRSWQYRNPYHLVA
SRKMARSKWHRYQAL*CTPTWRQYPSYHPNHRCWSL*NLRDKFDKLWPLSTTWVLFLDVQ
KK*SLYVAFLSL*KNFHFCLCVWIGEWNIYSSTANSSSEEVFLTYICLWTSYE*SKIRKE
QSKFRIWKECCM*TKLSVLGNVCTTYMI*DGMFCNSVPVTWPVIADYTHLQADPIIALPP
QPCVYIALRQNTERKQPSIPATIT*PFLRGIT*SFLRENYIIISPCEL*VLFSCISLTLH
KTFFFFFLYFRGNQCKTKKKEIL*NVNSRCQKINYIRGKSGVGNCR*IRLLHNKNADHTS
NAYTRTPSFKVSVAVRHTLYYLALKV*AHLSQFLFFAK*RYIMSQLCN*RTLLFLSFSSS
FFGMSWKK*SLHN*VLKAFVSYPISCPVLIIHPQMIYPLPSLTLTQQ*ALLLLRLSTVTP
KTPSTLMLLKHLLTYLKNPSLHIPPSQSYV**LHLAVSSLVGIPVPFLVLLTFLTLSEGL
VKKKRQGDLLLIESKNGFDCLNIQHWLRHRRNCLVKSR*YIWSSYWIDYSYCHLRCRHPN
PNNLHKQVVPILHWKNYFWHRSGRNCCPFPNVDI*SCSQTYQGNPGPIVPADGYDGYFSR
LLYQLRYQELSQRHSMESRPWSLLCLGYIHG*WDDVCTRITTLPDRSW*R*GSETFTIEI
QQSLS*RSSLVSRI*HYKGGN*N*KVGR*RIMV*TTLH*NKGLSACSYGSDNPIAAAINR
*QLLLLLRYHHLQICRSKGLLSNFDHHWCGQFFLFIHSGIHH*EVWTPYVSIVGCCFYAV
LLCCLCLRWCDKAVASRKQSPRHYFSGCR*LYDCVYYVLHLFVCHHLGGRLFRYCVRDVS
S*SQIKRNGNRNSCKLDVGFPD*FLYPIHYRGNQLLLRLCILRLSGFCILLCLFLCPRNK
RLDAGRGKYYVAGRCASMEIGLMGATGEKNRRLRC*CNRS*Q*TNLQEVLFQLIF*FSVN
W*KSKKKN*RN*FSIIHNVFTFVPFNF**MFYGSFNKCVTGYSCRMAIHYYVYRIIKSAT
RPDYKSNTQILVL*CIFIFSQVAC**YHDIFFEALKNSSSSYDIMNQYTHCSLCNIYRFR
VTTRF*YFRYGYTGFFMMEM*YYQFQYIYLPYLYDTLLF*FKSVSN*SECHVHSDGSRWM
C*MMFYCQ*LQIRSKSIKSKETN*VANPYCNYSMLHICTISITLRFRHSHVPILNRNITW
RSTECL*IFFFCLWPGRDINLSC*KIRKLKLNYAWDFSIRLPEFQSAEELCLKKKKSRLK
KAKKGVTVDCG*LAVK*HENLCLHDPCQNSKTRGHKIVPQKDIFSAGSLSK*G*VVSYSY
EISLVLAAHIIVGKIFRSGRSSSEEERSAVN**EPNRKVSYTQKRFENSPRILFETLINK
*SINIIKFIVRHVAISTPCLSWKGEICNIKPSAQNSIFF*PKSGSSTIKVGRYF*VLLSS
HLIMA*TILLWTISEISVLKMCTMCTHQPTLPFIGRRGNHFIQKK*KNKKNPNIKLKKYL
TVYTKRI*NAY*EPISFQRNKLLIPQLKKLVKESKNENTDQCIQSIGIQTCGNTLGLDND
TSRGLYWSCRFGVCGKLH*KPWKWQ*SMRLL*NPQK*Q*CMTLEKH*LRDG*SSFRYFRG
DYLDVTTIVITIE*PVAVVYVLRGSTGF*SF*SFFRSFRSDSLGATSIVIALSNSSGGVC
LWRNSSGCGFRGLRGDSLSVTAVVVTVSNGNSSV*FWRSSSC*SFFRTFRSDSLGATSIV
ITLSNSSGGVCLWRNSSGCGFRSFRSDSLGLTSIVITVGDGGSGVRLRRNSSCGGSFRSF
RGDSLGVTAIVVTVGYGDSGV*FWRSSCC*CFFGTFRSDSLGVTAIIVTVSYSGSCV*FG
RNGFSYNSTG*CTNVTSSFITRSNSGGSG*AWNGCGNGIDVTIGVSCL*TRNYDCACGIY
IV*CCSVNRC*TGNGSTK*SGSS*TGNGSTE*SGSS*TGNGSTE*SRTGNGSGSTRCSG*
RSGTSSDNTIVV*VVSVSTCKDSFRDAEVRAGESGTNSKRELSVTLGCS*NTGSTVIRKS
SDVSGNGNLVLTSVANNRNRSGIGFGWVNSKDTFTLEYNSLASKCVRVV*V*VTGNDVDC
TFSRNWFDNNIGTSIV*VNFTVVY*TFSVVSTL*TGNRTTVENSVREREGTRIGVWRESD
FTLLGL**T*GNVTTVVKRTWSEGVDGCRGGSGFFSVEVTGHVKVFTGDVEFGTWIGFFG
LFHKQVTVDF*VS*ERIFVTVK*SQFGTSCDHNTFCCNYFTSKS*ITTDCSSW*IDSTIA
GRKGVGSSCACTRC*RSNGTQGIGSGRTGGSRSG*G*LRE*A*ATRSG*D*LAARA*DTR
SRGS*LTDRA*DIRSRGS*LTDRA*DIRS*GRRLTDRA*YIRS*RRRLTDRA*DIRSRGS
*LTDRA*DIRS*GS*LTDRA*DIRS*GRRLTDRA*YIRS*RRRLTDRA*DIRSRGS*LTD
RA*DIRS*RRRLTDRA*YIRNG*RGLADRA*DNRGRGWTDRARDTRSG*S*LCDRT*DIG
SGRGCLSNRTTDRNGSRGT*YHRGG*AVA*N*GAIAIVLTQCTLRVKGQS*SSLEFV*TI
EHLFQLGEILPNLQ**GLLFLNLLEIKTTHTVQNPP*Q*IKTKPFISL*ALLQLFVGFRY
VITERTVELDRFFVRQFHRTLQSLRGLCARVW*VGNWVVILCKRNGCRE*QHDPFNIIRK
RAERHKPIGYDQNGS*ERTRSIMSSNPIFF*DLRYFRSIQHEQLQ*SVLKMSRLDSLQDH
IRLKDRNRHLPPLEQKKMVVALGREVNLQHC*GDGCLTSL*RERDNFCVSEWLVSPFKSH
SL*NTAPSGLLS*SNKV*DSSQDSSLGKKN*APN*RNFCHFFPKII*NATQFANMIHGSW
NYHII*RYLHLSTRESKEHNSVRRYSKSFRKKFSSGFI*PAR*AIYY*LPFVSICLRILD
YRGYFLFF*G**G****SVSELHSMKNFWCNYGSKEFS*LFVMNF*WLVYKFKSRHSLRK
D*TLVFCDSNFFS*YLISCPVLNCSFKAGIILLKWNFDSGSSIIWQCSTICISRHMRVVS
THI*NMFSYSVDRVAYHKLF*QHLIVILRYTFSLDVVPGA*GDLIN*RSWSEEG*CTIKY
LL*SGMSSNVECSPSGYFLLENTFLWCLCSFRLGKRVLLLTSTEG*NNTQD*KVKWPVLC
SLHFIFY*QNILL**NFMVNFFYDDTLSCTSFRTLNWDATRTNLSSMCGN*KPSIYLM*Y
FIVCKNLFVVLS*QLKKFFLMQWKLLMTCGTLFKGLHEVYHASSFFLCLACNAVVITCCY
ISSFHLYCFQHKEPFDGLGLAPIFGPLPITEL*EKQYVLTLVHAVHPRL*LILHRPCHIK
LQISPFSWFTVGIPSKY*QSTIKRMMPYLIYILYIYIYIALVYKYRTCHSP*HTHNGNSN
QIVIVWAESYPQILDIA*RSIYGIKKARTA*DIRFFL*TLSNAVSLL*YFPIGLNGNVLI
VVRIWKNYIISKLEMMLDKSGRLLSVVY*PERIHI*S*RHFEKITFIEVYYNVTVNNKGS
*SEINIINYSRFKEEVTMEMTYYEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGI
GHLIRKSNEEALSEGSGKLAVFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKI
QSAGAKVIIHGDHWGEADEYLRHE*MAQESQHGSKTLYVHPFDNETIWEGHSTIVDEIIE
QLKENDISLPRVKALVCSVGGGGLFSGIIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKK
GSPVTLEKLTSVATSLASPYIASFAFESFNKYGCKSVVLSDQDVLATCLRYADDYNFIVE
PACGASLHLCYHPEILEDILEQKIYEDDIVIIIACGGSCMTYEDLVKASSTLNVS*FSNT
HAILEQ*KWIAIYLCTFGLIKMCFIFFRSSLFIGWWSGNSIY*YYSIKAIKHLG*SSCK*
LGR*EMLSG**R*SYAMP**FIKKSIKKSVY*YY*YVEERIN*YNSESSKENFIYI*M*K
LILRFTRNIVKS*DKKVARDHK*RLSANSINR*HLMNVR*HR*LSALTCELLHRIFVCLG
II*EALGWFRGIFTIGHCILISITEDFGVIMFKNFFLFP*THNCCHLLLWYSSAKLLKSN
NIP*PLP*KLEKKKFLH*PFVALV**FFLMYDFSLLRVALL*QQKF*YTKT*SSE*TYNQ
DASFPYL*LCPSN*SALLLS*SSICGPCIYSY*YSKT**QQPYKC*SK*ILEVFCYL*YS
KVYHHFYTC*KQ*LLQLGHSYCITLCPLYAILPNLKSRRPNQQEWNVYREDQVYRLVIYT
*SRGLCQSVKRPEKL*KGAPKRWQFPHKVIFLSIYAIIVPLMVNLLAAGLGLELLKCSKE
M*SNLNSLISKINRNQLFEEI*ML*YLG*TMAIDQILLECTKSP*R*LVVGYSCHPLMGH
PLKFC*P*FSPHTQ*ITIFLCEMQTHQFA*VLYALNKRMPRQQKGTETLQL*IGTASQLS
YEYPSSL*FRKLKESLKFGKEV*HTKRNLGGM*AQLQYNNMTSIEYCPG*TRPVPFLISI
**Q*IDLDFSDQLE*YKLHSTTQFEPE*PFLDQIFWTADCRVVHLLEI*LDKQFGQGCSR
SCSFSSQQ*SCLKLPLQYFSLLNPKRQT**KPTKKSSSPFFLPISFPHPLSM*TQDRI*T
SLHNHWIHRLFSNALLYENRQMGYVKYSPNLMLSFLRTQIIGPFLQYRILLFVRT*MKLC
LLIEFFINCLYNK*FQ*STIERCLFILNDSVEDEPSAGNTSCI***APNLLGNKV*QIGS
IDSYSQLTHRLLK*NHQYMLKPQVRRQPLSEASSFANYYICHMTAGSLF*GASCNDFVL*
RGAAANVAYLLEVFLSYENASNSR*YVVI*CISAQLSEKRTISGLYRSEILCVEPNAKEK
SSENDYKQPWRRQK*AW*EWLDPHGDSCIGSMHNFDCERRNY*GCIL*LVLTPTRHRTIS
TLKNITTFINLLHTGLNKKTVLIGSGRKC*YLLLVCEMMITGLLNENETSQIHLFINKC*
FIF*KKVKIK*SGLRS*FQNHGLDYILETYGFQTNAYLIEYYRSTLSLVHKTLYNRHIDI
NEYFRATIHESLVNGFMRYSFRKLDIV*PFIDSQLEDISPSIMSDRVKIKASFSNQVSVN
FGG*KALLP*QWPCNNLSIRINNNTTSINTVVVSRWPSR*FSLTCSLVNNLPKAHCCRIW
HELHCTNQE*TTFVCNIFHHSPLNRPSIHRWGTPDLNPFFIHGVSQ*RHHVLPADSTANL
PSSGIHDRQSRTIALTPYQSFASCRHQFSMLPNVAIFRIYINHGTI*CRPIALYTPHT*G
CVGGLR*CAQLTNFWIFLSVSDLNCFGKILSILLPSFLKTVA*INPKVRSLWITTKSGFW
DNDQLGTRFLDLLLI*QNFFQGILSRARTRADLKGSNNVFRHCG*LEVASKSDWLTLSHN
ITLSY*RAFIIYIHCPL*VTEAWAPFFLRSKKDSSYFVSIRPTLLITVFKSRWD*YNVAF
IVKCGSKV*A*MRLLIEPQVTCNFTSIISSGF*DTPCFK*PPFAFFLCYRTSICKKFACR
RKKALHGRGLIINENQAMIKQLLALIYGFGYII*LSYLLSRHSSLDKRVLHCC*VQWSAI
VIHTKFQFLTRIAVDTCKHLDYSGDSSTNNHQHKFCHLCFARVTSVLIRL*YFAAFIGIE
RKARALPTFI*YTEKCINIFSSLCVFLSPYLTKEKY*WLIIVGSIHCIS*MSTEHKSDSL
PFLKSCEGERDYGVRVFVLLM*HDSLSNVLLCSFKLF*ASLQFCLTTNMAACVVSRC*PG
CENVKLAYVQHSLLFNVTVHFVTMKVVRRNLYFSSKVFFCSR*SVF*EIDAFKWP*KIFV
S*LTTYCCARGSEIMVVYYNSIMCIYQVWKSGKCERSL*KKRKIKKKSLFSCDFWEAVRP
PSLYS*VLYLISTMVIDDQSINALKNVEKLLTEEALLMPSHIKRLDIALNRKPNNLRNIM
ELQGLAYTIVKKKLSFPL**TGRYRTEV*IPYRSSCKNSEFATTYN*VKCLSKLKSLRL*
GLSIHTSQSRVSSIVCRITAGGFPMNKGQGHGELSKVSILSCFVCTSTTY*DIYRMGVVV
LA*FSLPQQSSKKYVI*NSL*ANYQSVCYVRKAHSILLPKACLC*TRSIMRASIIPRIFI
TLNRNKKKKPSLGNYPGAKKYA*R*STPRPGFFHGGFWKN*RGM*L*IPLCDV*DF*GTP
DVCLLPS*RRFFSRNA*TTLFDKNVA*GLYSKPFGRKI*RLFFFGFRSYNPSS*KETYK*
ICIILQNILLFLCFFFTIYLTFFFLSEKQAKQKAFLFTNVYDAFASFPFPFGWFCSQNIC
INDKRN*R*TFGPLHTQQGLDE*PKWVVVR*KRCQMASVLSIQPK*HRMGYAIVLGPCYF
R*FD*LGRSTHCYRSQA*RFRCFLWLHGG*LQQHEWVFQ*YY*SKTKMRCDLDL*HS*K*
RAIH*LFS*WWLHFY*IPKEPCFSCQLHSIQRSKGVLV*TFSKMDYDGCQITRLQN*NLL
L**LEVLEARICICQ*RFLRLPIRMSRFD*SPN*ARSFQILLGHVYFYQPRCTCWRFLQP
IFCWILQWYSF*SV*QSI*SGRFW*GLLCLANFLQH*PNLRFSIRYCLGFKLGVQCLCPN
*PMEIIHVFGPQVFFEH*ISS*SRD*IDQFESRTNIEH**CWSLVSFCY*HNSN*GQFLQ
CRFEQLDWYPRV*VGLRC*HHTNHIQIRLCRLITLVQGFRRS*RIFENGF*SQCFFLLFG
PW*L*GQVCQGEPIFHKQNVCQQPTIQV*ERPKLL*SVRPTGSKHLGIVLQRWRCGFYKY
LLHDHR*RSRICEHDHWCR*FVLH*QVPSKGSKIEVIKLIVFFIFFKSHSKGL*LTSDEC
KTL*FQRIPPNH*KCIFIFIFSRPQLPGICSLCTLYKYNSLKNFYYFAIDIIFSRNKPTI
VM*LPYTTRMDLFAFICFVTDTMKPGKVLVM*KFKSIK*KYTIL*KKKALSST*KCSQKE
VVREMDTKLSVTGAKKSQGKASGLGNEGTPIGNEESTNKAKNGNKKRNKNRNRNKKTETK
EQNEPKPVTGGEEVRVEKSQAKNRRRKNNNGANKKNTLHYSKEINVEERKQIAKRQEEIE
QCIHTLSDFKLFKKGKHVTSYGYRISPMTDSGKISLKILFNIPLDYPKAPIKLTMKSNEE
VSSYMDTVIANFNWKARQLVKEDWRILSQINYLVSELEILKMENYKQIDKLRNSFYKTI*
I*A**KGRILTIIKY*NYSLIKMAAAPIPVPIHILTTPI*SFFSSLSMVATCLAPVQPKG
WPNAIAPPLGFTLFKSMPSLWMQYNAWAANASFISKISISWTCKPVASRTFGMAYAGPTP
MISGGTPTV*KSM*RPSTGRFNWLATDLRANKTPATPSETWDALPAVVVPLSLIKAGLML
ESDSAVTLGRGPSSDWQIEPSGNFIGKISSSKSPSFFAL*AF*YEFAANSS*SFLLILKL
AATFSLVMPIGIRHFFASRFFCSSSEEIMPKGLTFL*LLVIDSTPSAKPISICPTLILLA
ISFTAVKPEEHCLFKATNGVE*GIPLAKHAALCSVAPAPTLRTFPQATSSIKFKSALKGS
GNLPMNSLRKLYNK*SVFTSLKAPLKPLPMADLLAATITTSSGLFSSNEFFLFDSPLPMA
LSTK*SLILCSL*DIAFM*CYIHSVLRATRNNHSISIELRCKSIPYLYLFFLVKLQ*I*N
Q*REKGKKSCGVNTIIPVSL**RLTRRYHIITLLMLTRQVFFLFSLFVA*VQN*QILDLL
KIT****S*HKSR*KNSTIISDGLFPEQEDVPLPSQIAVTSRA**GQRSP*IGRIEFERW
AGCRWLAVGRCSVRETRYRITYIHETEEFLS**RFFVTNGFRRSERIGNGF*SEVHASGR
ITRRKNV**AFKRWNFFLGGCL*EFTKHLSTKEMVIDM*NP*FQSLGEKESDFEHDILYT
FGH**TS*KRTLFGWPS*KPFNRWHEVIEGSI*TRKIPAKAKLFATFSQG*NLLDDIDRK
DFATHIQGITICLSSVL*NTDEQPTGENKSTTF*AFNSLVHRASDGSKF*FEMSVTFYGV
TFIINVC*GFHGL*VDMGPAFHIIHRLARMV*QNPCG*YCNSFIPLFELEPIKNRLFDNF
PTANKLHTARFQQQDCTRNFEFFEKE*YT*HYHIFRTGL*R*S**CRDHGTNKTIQIQRI
CDI*LDDKNYQRYEFASPNKRYRKNRKRASMS*KLPVIEGKR*SRRGTNKRDYSIAVENL
RLSKTILRIY*TIKIDKFFAVLSHRFLSSVNESFF**NLGVRRKCGLCFSRFC**IVGFS
TI**NC*KSGHRN**S*C*DFSFE*KIKFSRKS**RSFNSKTR*K*IFDISENQGN*KSE
TAVEGNQEKTRPNYHASKVI*PATFIGK*QLEYCRLDNKK**SWKYHFPKFSKKATAAAK
NFSAQAFN*STKK*KSYVPFIIFN*CK*RK*VPK*IRR*IKRLIISKIYVNH*F*YPFYE
KYY*YAKCLSKFDTFRVGIFK*PRNTT*LPIVSRVVFGFFFTKTFPSTFLR*S**WNPTS
T*SC*TTSTSTAPSSTSPSSTSTVSFD*SRS*TGWCFLYCSTCTATPSRSI*N*NLWRRS
TTTTATAFTRVLVDEQRPLQSRFSYSSSSTFTKWSSFFLLSVYQSNDNRFKTTSN*KAIE
ANPLG*GGGYQRHTLGRHVSTPRNNQRITN*WYILSD*RYF*DEKSD*DCK*KERRILNC
LVFKQWQVFQ*AEENFILIKRFGSAIWY*FTHVFPII*YGICYESIEL**RHCPKC*HTE
IFL*RRVSKYTKKYA**VRAIFTG*GW*SSK*LTKS*QNIFGVVYQFKILLECKIKESAD
IVNIRERLLRFDFQVTKN**CNFTLKSFT*I*KFDVYYHGNRQSYE*KNC*GYQIEVID*
TCLCQIQY*SKCIIFAFY*KSHKNKIS*YIRFCG*FEEH*RFR*NLTRTR*IRVS*IS*K
N*GFSYSVSSRKAIQRGELRPQRSNY*KGQV*D*SGQNKK*IIDWSM*INFNRFE*TDEI
LR*RSQR*RE*KRIFPTLY*IFSHV*EMCQGKH*KGGNGKSVRTKEELVRYEDKQ**EKQ
WK**KRW*KSKQGCC*STHI*ITRSKEGSRTSKKKKEYKTQ*NSH*RT*RRCKNEKG*RS
RFTRENACYAERYSKYIVKT*YFM*LWSLYKEMDNIRNRFSKGKYFPFSGGGRVDKFPS*
ELRFGDGQIH**ISK*AQKASNF*LKTIYFSIIKTDY*IKMGNVSVAVGTAVGIPIAVGV
IIALIFWCKLQRRYKKEEIRDADLEKMVMEEVAVSVYDGFKAEINSSSEASTINEKEANQ
DLKPCQEKTAKAGYTPAYRRQLNASMGTLRPKKQSTAYTNVPVIFSGEKVNYGMVRDPSY
SFMYPLTLSRKETSSLRSASTSNLSSSTENTALHEEIKLDDPYENDFTNYTVNKREFIDS
LRPH*YICI*IYKRTYIVLHLYRYPDHL**R*K*NNNKGYLQTNSTILAIKLVSWYFQLA
NRSFGQRQ*RSIHESKTLRRECSYRQPV*RFQ*RFCPP*YKT*C*SYPSQSSVHRRPKG*
YHQILCSHPVCF*LLETVLYNTACWR*WGTPSFHS*RSKIVRTQWPQKTTKIQLFAFSSP
WLGQAILCQFSMACSCLSKRSWPHLQRHYY*I*RW*RMSAARNHALAQP*LQKVSLSATL
*LLVLTSCIVCFIFYFYVVDWYGEKDRTVLKLGLK*QEGAFFLSTMIKTRTSKTQRDDIS
KYPNELLTTHPVILTREIG*VGKLVHISIDLVLVSTCLAGIKRNTGLTPKLETLDNQTMR
NYMKRYLNLGESVYDYSVATCGSSTYFARK*VRLYSIYVDNILYNGTQPGAKINNRNLKS
YRYRLRIEL*MLDDDKGTAMHPHITPFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLL
DLLEHTEYLFELYLDSIHHDRPNDALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLK
KMYENEMNMTNVVLMVKKEIGVVLDESVKHGAGIEHRITKKRAFSVPADDLSGQVASLSL
DTAAPQDHGLKGTFTEDDAEQSSPVWTAPNLEPNDQLKLALLPEVIPTPAFREPERKTSV
PVRPSVLLEDVPSIYHEDDTSFASLNPPFREITADRSVTHRKDSYHSVYMVDSGNLKEDN
DDLFNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAINHIVA
PNLVNVDPNLLWDKQTNTPIYKDDILEHLLKENENFINRNKFDYIVYYTDVKTFMTINFD
YAFIFFYLMLTSQKTPLTTVPTTLLGGYEKWKKTLHSYAQEYHISIEDYLYRPYSQKARL
QQEQQQQQQQPDSQDSFSAKESSTKVPEPPSWKPPDLPIRLRKRPPPPPPVSMPTTPEIP
PPLPPKIMVHSQVSSISRKPPIPAKQHVKKEQLNSNEIIQRKRQHQHQHYDQQILQPQRA
YNIPTIERSPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSKYKSYLQPIR
SNGSHYSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMI
LLDRLHDELSDQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQ
MENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTSDEVL
SGENAWDCPRCGPTASVSTSVSALENEPSIVKSKKKKSRFFTLHTGTKRRHLDFFGDGIT
EGHNSNNNNTTIFERERSRSPFRMLGGSGKRSSSSTPFSTGGNDSNNSSDYKNKKLTTVK
TINFVTLPKILVIHLSRFYYDLTKKNNTVVTYPLILNIILKNNDTMKYKLFGVVNHTGTL
ISGHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRKHGSDKNLKISSSDVYVLFYERVY
D*QNFAFFFLHHKYVLRMHQDVEEYYLVFLYFMIKLEIKGIIKTILKRKSTQ*LYRLYYV
LEIEYKH*EGHNLKINCSSRVYYLFFFFSSYIFVVFLVYFNSSIKENR***RFHCHYHHY
YYCYYYHYYYYHHYHYYYSCECYLCHP*LS*SI*TPNVLMKFTVFSSSHCLFFSDQLNSS
PITLTVACTAFKASLASKKANLVLLKRKSKGVLQYSYCMEYFNSPIVNGYLKVSKLTKLF
SSLE*ITLFSLSAKDKGSLFSMDSLKNSQMIEERVP*F*TK*LDIFDDKW*F*ANKAT*F
CVHSSAPASLISLV*QGFRLWNPPTSTTLSTVSSAICL*VVHLPPAIVIRPLSEVNKKWD
LTTP*VAEPFFPSAGIVRGSLTKGLTPAHALSTSSLFTGNSI*CCSSFKIS*ISASVGIG
FSGTCFSGMSVVPARTLPCQGKKNITLPSEVLTSNKPISFGQ*KEGNTM*TPIDGMTIFG
SMTAI*LKVDLILELSFSGESGRPDGLRSICKMASLYGPVALTTHLALILTSSLVSTSRA
SAPITLPEVGSLINFCTST*FKTVAPFSTAVMAKVAFKRESLKDPSWYTSEAFKLSVVSM
GAFSTVADLDSRYDFFKFWEPAKKS*NLQPI*MYGTCQVL*MGIRIGSTVHR*GAVLIRC
LRSLSASMTRSSCALENSQKAFSKYRTPP*IILVDLDDVPEAKSPFSTRATLSPLVAASR
AHPVPVAPPPMINTSN*CVLARRSSRSRLETCGGAAVGNCTM*LGSLCTNGLSPWLVIQY
SVPVAVAMAAAAPAALLLVTENIY*YVFSLVAVMAIARSR*GRESPCFRPKFPICGCSLL
SLNTIFSVRGCEISPAKTEIKLGG*RIGAEKRHKVCCCI*VCVAKKELVQ*LLVTR*CPC
AWHVSASF*PRGWAQSRRSSAEWTG*PRGSSTGRLA*GRGSSR*GGVLGTDGSRRGRRRR
GRRARPRRSQTGA*RAF*FWQRWRTSGSRPWASRAPSGQCRRCLPG*QLRP*DRSGRRWT
RCSGPCRG*RTFGSRPLRRHPW*VVAWL*RSLRRVAPETRLRFRGHGC*SRTWLSRACWS
LALRLCWYKSWVTLSCPDRSGTPRQSLNRSLYRSLALHRTLPRPYRRRRRRRHLRRCPHL
PLQNPHPRPSTASRGPASTRST*GTLPPLLCCGYWPCFSTATDCSRLSLVRLFSSCYDLF
PCGPFPSAPSRTPPWWAFPF*CCVDSIVFRQV*SAICSSALRTWLFLLLVLLVLTLSIVS
CV*SSLFSGPLKLS*KDKIGRKCKVQKNAHMNKH*TSKEMSLDRVDWPHATFSTPVKRIF
DTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIAMVNGLMGVLDKLAHLI
DETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSEYHEVVPELQYYLGNSFGSSTR
LDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKYYTIMRRLILTYTLEPAGSHGV
WGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKDTNFYCQGINFINEVKMG
PFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFWFGTGFFPWVNIQNGT
DLPVFEEKEEESIEQANAGSPGREQTSTRFPTSTSMPPPGVPPSGNNINYLLSHQNQSHR
NQTSFSRDRLRR*Y*LNI*MCMTSIMTSIFVLFYLRLQYISI*SDEKRKRKR*YK*TKKW
KKSPQCKQMSHKRRGLVIYQDQKQQQQHPPGQSLSSISWSPTRRPHHPLKQQSTNSFSEI
LSKSSVQPNVQHDGNHMPISLLVLKQEHHKQQQQQQQRQNIRSQNSTPPLRQLVQESQWT
SSASNSSLKKQEKQPQTFYNTDSKLVSQLHSSVKDLDAIIQTHKPKFDTIIRDFSQATIL
SSNELLIKLPKDQTIILHSRAPKINAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHW
KFI*KVIVEWSVQKKKKNAQKYICDHIYVYIHISWYIIHY*YQACYLTKINTLYCTFLSF
CPSLFGSYYHHPLPALQTPCLCSCFHQSIFQLETFGSVWR*HQ*QIHRRASSK*FALRTP
DFLQHVLQYSP*IS*E*FSFHRTTGE**LPTLLLLRRQYRLSILLDNVVLEMWSDKSQI*
EYCFWLV*KYVQSVLTMR*HR*QNKAYNCSFRHCL*MRRQFYRRIFSPNAGSSCCWQHRI
*IRRLHPVLHHYQHWTIGCR*MHC*TRRFYQNNDNLVPISYNQYIRKYFHQKRRSNSVWL
VGPC*QPRFLHLFQLCHIDHLIRCCRYNYLRHMHLA*RSNSLGNNLEVCHFDDKTQKLES
LLSTPNREISWQYLSKVKLLSHCASRIFHQLHLFHQRLYHQGENRKKDGLERQEFPLHRT
S**RQTTMFPNISKSPEDFHFRYNIRSNHPVPMNKTFPILFSKKGVNYPACNKLIHYLRS
LLNSKALSFLKNVSRMLLLALNLPFLIFSK*QL*NVTTSKSAVRQPLMVHEEILLIHVYC
IVLTSC*YDSKNPAKY*DWLGYH*NLNLKHRYSGSSFLNLFEHRMDLYRKMFLLLRISFF
LFYPSLISNT*ATETIMQMGF*DCQIRLAVKAEIQQMQGHA*NNNAMILDFGKTCLLYRK
RHFR*NLYQTCL*ST*AQHAVNPYSPGN*VIALLQYALNNQLIENFYGQFHYCSHYQNFY
L*MQIDRYFQSITVTFAETE*RDPDKKHFFPSLRTLLNCSVELWQYDNIVFRTHICISLI
RYTNIRRLASNL*ILMGTAILPF*TNHPIFVSTK*NISTVYPQAYLRQR*KRI**TDNIP
LGP*SSKSSLVHPRRLLYHKPTIFFLFCKYPKFLGP*SSRL*VV*LIMQ***N*CNF*SV
LCSVCILPTNFLVLWFERWLNKGIFVVTRFPAPL*FYKFPAVF**TSDLAAPKEVALSSA
GVKQQLQELF*YRIKLLGFGVANCYKYHLKRLMARQLSFVDLRYLHKCL*KQPSYFEQA*
FYSHNMEI*EHPLLE*NWS*LVVSIP*LCERCSVF*MHHQFWRVCFVQRSGY*LFHL*IL
SLRDLQFQAPFF*RTTTLVYHCATKNYVAFDEEMRRRSGAYRSQYECGCCWI*NNQFHY*
GHHSPAPLGQPYYAISVVLLLCIEPKNNVRCCQRSAKNDCKVK*RVQNEGCAQEGDVFGA
FCVSQDVLFCSFSL*GLIPYIATKITQFFIIIFQSLPAPLSIKSNTILGP*KAHQYLFIL
SQDRWHYRQKFL*FPWIRNVFAKLLRDGFFS*TIRSLKVRE*LFPSCNARDRL*QFFFYR
VSCS*VRSLIQKT*VLGKFFHEWDRILGVG*ALSGGHFLWFVSFSVALRRSYLLIRWIPS
FS*FCLVRGSVLSIS*FLLFSFFYCLSLPAYLDSEISRRKMLWQNYYS*NCESSF*VFPP
LLTGAYEYL*LY*TRFPLWPYIGLVESPLS*ARPRRTHHLIQFF*HLFHEIALLYGNRNT
YEEIC*WESHIFCESFYSLWDTNLNLYLNLSPGYI*SHD*FEG*RI**NFLALRVSMVVL
LGLILLSHHPGEDYNIFLHPFSRRYKHLVYAESPLW*T*RI*LAFQMM*I*CPICG**GL
RWPSWRIQALEI*VGEF*QKVCPTEGF*SHAKPVLSHLQVCTSF*PKDLKSFLIRL*LSA
HISSHRY*TYVLLHSSCFQTWQFVYLRSSLRFEISP*SMWLY*LVVLVAAVIEITLLH*Y
SNLRILCLVV*HYETPLSHGFW*EIEVPRWLQN*DPGVS*ILAFFLIVPLRPASFVP*IQ
VLSRWLAHPLHQK*YYCTDQPLKFHEDHSFLHEPSA*CALKM*G*IDKLTFLYLRWPIKL
IFLSGVRKGGFAHPRNPREKKWQINPKFVHT*LLVRMCHKSLYVLCNDISDI*NM*MFHI
YIITLFNITSLVGSLIICWTLFNLFGVWIRRCTALNWPFRCTSNFCYFCSIGAIVS*IGY
VGKVNRRFDCNFRLNIECT*GGIRIDIRLGCCEWVLKTLKR*CIRGEEWLTKTKGWNGLV
TSSATIHDIIFFICNH*LAVIEGNVILHILQLFLRFKVFLIYKASDSRRPLRIPLRWTVP
*FFFGIFPATFVIKKR*ASRVFFQFLSKFFF*FFFTLTNDLLYPFLAW*PYSFL*ILFCF
LNSP*RFIFIFL*PFLFQCFDIFTVFCF*ACTLI*GLL*FFFKFLRSFVNNSVLFFLHVN
FQFLKCIR*AIRSFENL*LLFE*FNFLH*CPISVLFVISRDVF*LEFMCFELRI*INNFS
VFKV*ILF*FVFNCF*FVEFVS*SSLLFLRCVQFFMSLLL*PIEFIFQVSVCVLSA*KFS
LQITNLIS*LFNVFFLGIFLLLR*VLVPLFTLLHFTFIY*NFVRIYRNLFFCLYEITL*S
RNFFLPII*LFINFPVFFGYVFETLL*DGIILF*NVNLSNFFRDILEFVNNNCRALVFLL
R*SLGSLQVIYRFF*TIVLLFNECQFSLTGG*LRL*RISFMT*V*KQRN*LQMIFIAIIC
CCVINLFNQYRIFNTQGFRLFNIRYQFSFIISLFLHPFPFMFIE*ILSAIQ*GFGFC*FC
LAISRILFKADNQFR*IFIFLHCGLILGHFFFFAQLDNRTHFFNFFYHFLDPFYLIPQLF
*LLNEMQCTFF*FRLQSSYFTELSA*TR*IFFPRPFFLLL*FNLSIVIFFGFC*FIFQFY
*RIFIR*YNFFISLYL*VCILQLNLDLL*FFSQSRF*RACITILIQEFILEFGFS*FLIQ
VLYF**KFFNRCFLI**FS**GLHFHFCIIDGILSPFELRILA*AYRFYFLYL*L*VGT*
SFQIVFQFFDFGFVLALFRAKIHFIFIMTDFRLL*SHLQFFFFFAALFEISS*RFFRGYK
AGSFLFQFGNLVLQRFDFDPRL*QFS*GSFFLNMYV*WNP*FLFLEFSF*VVYCFL*HTF
FFLCQTLEIFKIL*SCFFFAL*FLIN*QLFS*ILNNSRVFDFCR*KFCLKFSNLLFTGCF
HRSDRICVGLVFFS*CQQFVRIPLS**DIYPGFHLRIDVLQFNYCIFCFFNGLVFYLL*G
LVLFSFIIF*FISQNPNAIQEFNIFFL*LIHITEFNQSFRNDGLGIIFIYDIARLQYFS*
*YQFILR*RRCRFLYRRCI*KK*FNLTGQIQTLFHQRMNICFTAIYLLSQ*SYFSFLLTL
SQRNSF**FCGTF*FMFQ*FCSFLKRDQFRGFML*F*YKILQLIL*LKFLIPFLYQLSFQ
HFDIRK*FTYCGRNCTRSHCSFFFLGTIHNYIL*PLTLIF*FFES*FCVYKFVYHISMFR
VPAGIIIIFLYCSQGTIFFQ*C*L*A*QIVHIFL*SHFFGEFCFFHTCGIFQIFHFQYFL
FHRLG*LFILI**KLIVRKDRFIVGLHLV*FFFEVLYVR*FCDFFC*RFFAKR**FFFN*
FFTL*H*FFFLY*GIVL*L**YSIGLAPL*YIFHFHQLSSKKLIFFVQIII*RIIPLIST
LPNVIFFFNSFFVIYFSHSFMAHMQLFF*CIYFPPISGTFFIQLIFQAIQFFFSCVLLLR
RFI**LLKF*NP*IVLRFDLIDQNIEFCHFLFRTFKLGYFLV*LS*DRIGNTLK*FEWNI
*KLRYFVLHCRFASAQCSFALNFFW*TSTRKRKATREISACNLTPILFSSSIIFNYRSTL
SNNSIISTVH*RILVFFPYGEVNFPCNIRVSYRQVY*LQFEFITSVHY*DVWFFYFCAPC
RYFVEQTRKDAEPLSTPPGHRRSIFLLWDGFCCTLFSLDRTSDCLPEGEMVSGLRTAFSS
F*RGIHSNQRCIKNI*N*R*LNLYLLLLLPLIIP*LRRPRFKHANVCTISILNIVFRTFR
A*RDNYFRN*IFTQWNNIVSVKSTKFFIHQKLKQRKLPN*I*GTFLSRNDLVNVQ*LVEN
MIRF*AGDAT*QSHCLRNIQICGSCSPPRYDDESSFKILSSSEQL*KNYYVFL*YPY*LV
IFL*NYFFNSFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG
RTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKR
KCGHTNQLRPKKKLK*SVSPNQSIHLFTVYFNVHLLLSYLLLKS*Y*FIQYT*ENNILFL
VS*LWNL*CCFFFFKYICILCI*VNA*RWYYAQAFDFSYYSWLFICYFSFPDMLHKTQ*E
*FSILVF*LVSIKIRSFLIPNIL*CCYRQQKRLERQ*VRYNLNRALSSW*KVNHPL*ASG
HP*KSYYNFRP*MSIL*LCRMLLGHRKPVQYFQCPPSSTFF**LPDLHDYLLQPKF*HLF
HFYRRL*LWGCFYLMWLYQYFAKMVYQD*QNLDLHVENDA*KTRNFVR*LQHL*DI*KV*
YFFPAVVQALHCRFFLLFPC*DFQHLSSHAYLYFLPPVARRWLGYFYL*LVLQQMMWIVG
S*CF*QH*T*LFCSFYSQD*IRPQKETPYLQN*SL*FDLMAR*K*IYYQHLLSTLISSFH
ASYLLTVYRLIDLSQYHHIAWTMFDHLEQMDEIQILVRKGQYQAQCLPLQ*K*PTFWGFR
*VFLGYHLLHHLSQVLY*TDY*R*RYHTSW*LLIL*KIHHHSKLFPCHSLSYRYFHSQQY
FFLLSLPELSKCLYYFLGK*RWILNRHFSYGSIKLEDRIYL*FLNFRLLLSLF*YTLLCI
ASSRLILCRIHPTVSFLHQRYHLQG*TLVHWTLDSSQFE*FCWNHPKEPLSLSN*ETMIL
KDEHADPLQLYQISILFVRQHR*CKNLFSPVSFFEERFWKKLTIPLEYEAKAHLI*K*VL
NYFLFC*HRFLPLK*PSYPEYHLKAFSIRAKYWQ*RRFLLHLRPLPQSWQLRVVLSSP*L
FLLEEHNVGLMRLS*Y*RFLLNRKVHQKIVFYNLVA*LQLNLQKL*ECEIYWNFCQCHYV
SRNVVQANRDLASHPLIF*HRCGYSVFCSPPLEVTFSHFQGL*RFSCYYLLKKLHHCHGH
CLHGHLRLWCCQLQQY*IVITKKEQQIQN*ILF*MNWLCLSFLGCSVEGLSPL*LIQLPF
VDVQLVALPSVLEEGLTK*QRHQ*R*QCR**FLLVSLLEKGKPTQAVKLSRPN*LG*TNM
VNSLKQYSV*KGYWFVSKTLPSRF*MRY**MYHFL*KKLFAGGLIVIHTVERQNDTLKLC
LDYYILQK*WQLWNVLKQLYR*THFSDPLPTLL**CIRKPLNQSR**KDWQK*VKT*TSN
SRCYLVLDPSIYL*FPVKKVAVYRWIMGTNCLKHLLELDHQFHYS*RSKQH*MKNRKL*Q
HKTSLKSSKIFESHSRNLPNYLHSCYLQRNLLVSFAGRLLMPNSTPGNISSLEFGQSVMT
LTERQCTVYRTLNFYSSR*NRPLSLQPE*SVSPKPLY*LVPLVEFGCLS*TEE*VPILMA
GQIAFVLLNQNKVDYTQRVLISILCLL*LDDRSIRSSPLLLPVFIEFVVGNGKQQTRTES
KLRTESAKM**VGFCSCCFR*TINPKFM***SLKNAKRKY*RAAQKDRVIWAFKYMKVEY
FKYDVKGDNSNF*MHSHLQR*FP*SRRNTLYALWLIFNCFFVLRRESKEYIKKLKFANRR
NIL*AVCLCIYETKQKIACIMKEFSYLISFYVIKERNQTGNIDTQ*EKQK***KSE*ERV
CLCILEKGYNRI*PSAKIRLDSSMENSELLLRFSKNFKGLERACKTKVFILPQVSLIMVR
LFIMNPSEWKFI*SVPLSNHKNCSVEEGDAVAGVLIVSLEESKESKEANMEGRKLKDLTV
WCSYAAVTKYVTQHPKLIPIVIEMPQVNQLVKNFCFFLLGFLFDLGDFFFEFSAFLLRQ*
DRDFVCIASSSLSSSFTSSPYSKDKSCNL*NIFFKSLLLVTTTGGNNNLTSLFLKNDFRT
FFTWMTCPGWQIGITGLP*EY*TILFSRDTISLSS*KIMTIPVYCGNVAES*YLGNSKRD
WYSFGID**KLEPVLPSIRRRKTGFFCVSDSLGITKEFVEEVKLFVIVTLSSSKASSSSP
SSSCSLKGVFSLPGKGSDIIFCNCLKG*DGETTFAPSCPCLIIFIISAAGA*SSSCSSSE
VSLDDRILPLVV*EEHLSGMKEAPKSKG*MACHDPDILSFTLWLPDMSMDVTKFCPIGEG
ECPVLLNNSNTDR*GSSKPLSSPVCASEHV*IVVDEESGGMLLDEDPLPSLCWYSKTICL
LFLADFFCFCD*DFNIAYR*EKSQLIRKIVKNEKWAL*ENISTITQKYRF*KYNDYASGS
LLHLIS*ITFLLLNRSVSFFFFCKRGASNNRYML*TDGDLRYLRKHETSAKQLQLC*SSI
NFAFTMQTVKDDLSFPYLCFERWGCRPFSRLKKKSSSVKSIIPLLV*KNIVHTV*EWYIL
QHRHGKAQSPSLNNDVIY*SDDRIGFFAVSHVYSTTNDYWLLFAGVFNIGEFIKSLKIC*
GNIVDFEIVGINVGCPYLSHSIDDF*SGETSPWC*SPNSIFRSFQPAVKVFRDL*RLWTK
IFVSTTQSQSIIVSYNRHHL*PCINKQFVHHTL*NNELLNVLLPKISHIRHNDIE*FSHD
SCHAPKEVRSRLPL*FFTQSKNTNKRAFLLFYVERNSLWIHHVCIRSK*NIHLQRLKQFD
VVWQSSRIVI*IFRWRKLGGIYKYTDHSIGVFLHRLRDQTSVTRMQATHCGNEPNSFSKS
SFPQLLCSPLNNFFDSMEDFHQFYMDMQYKNLYKTVQYQHTPLLVHINMYATSRNVH*SL
VGKYDKRKKLVKVTFTRISVQPTL*KRWALNFHSYRYHSF*LTYISKKVKRATIRHKKVS
VGSIVAGLLSGKDCECKGKTVGGPKSITDVRIEEKFTVLCARWL*LNIEIIS*LWAG*EP
R*VLLKM*AVYCD*RLKYHFKGYPY*KCQKKKR*RME*YSHKTNIS*NKQTTPKMVEIIG
IHSQER*NRPCKKN*NGTRKITDVPFFKR*GVL*YIP*EIPVSINAKLNKY*STCATSHG
PSSVYVPNTNCNIVTIEEKKQHESRSNRHDQ*EYCQEYNKRDWHSHRRHK*K*EDKKHGC
RRYKWYSIGSK*QIQQ*KQRQQIINKSTWQPAATSEQ*RSKATKRQKLPKRYSRGDL*LF
EKE*I*Y*NKSSHFNKISKTTHSKGVYYHFQVVIFKTRSRLRLY*VYRE*DLSNFKKSAL
SVFRVNK*ITNFGCRWL*LAQISWHVALDGTNKY*TGYVLE*SRSFIN*SKYTRNNNSEP
AFKDFGRTGPKTRKI*ANGGETVN*LFYRVLQKLFET*G*L*AFDARTKVRF*KIRSHN*
Y*YS*STNPK*QSL*EISRSNENKPKDQNHQGKMEGFEKRF**V*KLCQRDEAKESRMAR
*TGKDEIRV*TERRRN*SLTK*YFRIAQNFKKKGNFN*AVRITKPRKRKAD*GT**NKYP
V**IDKLN*IQKAGSRGNIQKLTGYVEAIRFVDTKFNQIA*SIGS*C**FISKN*HFREL
IRQRFS*RYLLRAIVSKGIWN*RVY*KIYLKIKR*NSRKNKNH*ERQHNIRKRYQKLKA*
HK*ENSN**KT*IGIVRSEFQI*AL*AGERTIISSAKN*D*KNGKKN**FKSLDEN*NFR
C*GIGNFNGTKIGRIES*LKQETIQTTPTSDTCY*YNK*I*N*YSIVIGKL*KRIRKRH*
RVTKFGV*N*T*RNKLIK*MIYNTRAIYSKAQPHLSAF**PAFCSIPPSLPFSSIPNQFK
*VLICSYF*NKYM*VYLDALIRNVLFFFYFLYYGRKWT*RINKRKNSDERIRRRWEQKGI
MTE*IQNRKVTMKPSLFTSSNSYNTSF*LMDDVPSVLCFYWYCIPYMPYLHRQQDQTMNL
HL*RPLI*IFCGHLNLSQQNCQRHHRPRYQQLLRSSIILLAIALYVLWVKHMPNLECSPF
RVNV**L*MRNLDLPKTLVSLLSSTFLAYP*KPENKRTH*NLRHYVF*LLKFFLIFGLLD
DETHSAKIFELNR*LLVNRWKYHQLLIEIWY*FGHCTGNFAECSYALVVVWNHK*MVFPF
SKHILVRRKHYLKKR*SYHPSFRDIELRIGMPETLLDS*YTVAFFSLQFLLNTLGKILLS
WDTKPLHIGHLQYVLFGIIPSNLLHKVLDQLKNSDHQFYHLL*PALRSVPIWRVLRWWRP
PYGTLRRAPHELRQE**TPIPYRSRNP*LFVNHETCFLCLPPLNKWKQPNRILSGTFPYY
QR*KQHNFQVVRYTIVKIAASIA*RRLMKYIKQLRIFL*YMLR*YRPKFYLRHMAKQ*SL
NEHAHYQTFYSAIFLDRV*FEWKVSNQYLNPGFYGRF*SRILPTRDNRFLDIFSLRLQQT
HWQFQRSERHQYHHLLLPAHYHHL*LH*TRLPHRSD*H**RVFQRFAEVVAVVHPLVAVL
DDRYLFLGAR*RNHSATFAEYLLV*SPRNIYYA**LVSLYRMKW*PL**S*LSIQQRVLW
IIYPELK*YHPSPTLQKQLHTKSML*SCIHEYGRVYL*ALQW*PESPEPVLLMERNSPE*
SYRHLARSKGAWKHGLVLTANN*SHGF*TFQRRNLERNLLVYRY*CPAKALYP*RPFDS*
RNPPLYACYSWSFSEASSTLLPWRRYPFLHVLLTFPCYHHSSHRSLHQ*LVNPHLMRKRT
HPYLERFSPCS*VGSLQRPS*FIFH*FQRQ*MLLLLNNVDIITIIYPY*GPFSLYFLEEK
PRF*RSEIFFSSRWRV*KTRAEQ*KRG*KVAIK*ARRVSRTKLKRFRMSVQIFGDQVTEE
RAENARLSAFVGAIAVGDLVKSTLGPKGMDKLLQSASSNTCMVTNDGATILKSIPLDNPA
AKVLVNISKVQDDEVGDGTTSVTVLSAELLREAEKLIDQSKIHPQTIIEGYRLASAAALD
ALTKAAVDNSHDKTMFREDLIHIAKTTLSSKILSQDKDHFAELATNAILRLKGSTNLEHI
QIIKILGGKLSDSFLDEGFILAKKFGNNQPKRIENAKILIANTTLDTDKVKIFGTKFKVD
STAKLAQLEKAEREKMKNKIAKISKFGINTFINRQLIYDYPEQLFTDLGINSIEHADFEG
VERLALVTGGEVVSTFDEPSKCKLGECDVIEEIMLGEQPFLKFSGCKAGEACTIVLRGAT
DQTLDEAERSLHDALSVLSQTTKETRTVLGGGCAEMVMSKAVDTEAQNIDGKKSLAVEAF
ARALRQLPTILADNAGFDSSELVSKLRSSIYNGISTSGLDLNNGTIADMRQLGIVESYKL
KRAVVSSASEAAEVLLRVDNIIRARPRTANRQHM*HI*DIPRK**TATLSLL*LETERKN
YPLYNSKTRKKKNNAS*NFWQFASQINFGNLCFLFEQYSSPVSRM**YPS*VWLKIASPQ
PQSSLPRVALLCRVIFTFHMRTYFLILYSHIL**LTLQQPPSLEEQNNYLIEKLYLPRND
FLLPTSTYIKKHSLTMTQLQISLLLTATISLLHLVVATPYEAYPIGKQYPPVARVNESFT
FQISNDTYKSSVDKTAQITYNCFDLPSWLSFDSSSRTFSGEPSSDLLSDANTTLYFNVIL
EGTDSADSTSLNNTYQFVVTNRPSISLSSDFNLLALLKNYGYTNGKNALKLDPNEVFNVT
FDRSMFTNEESIVSYYGRSQLYNAPLPNWLFFDSGELKFTGTAPVINSAIAPETSYSFVI
IATDIEGFSAVEVEFELVIGAHQLTTSIQNSLIINVTDTGNVSYDLPLNYVYLDDDPISS
DKLGSINLLDAPDWVALDNATISGSVPDELLGKNSNPANFSVSIYDTYGDVIYFNFEVVS
TTDLFAISSLPNINATRGEWFSYYFLPSQFTDYVNTNVSLEFTNSSQDHDWVKFQSSNLT
LAGEVPKNFDKLSLGLKANQGSQSQELYFNIIGMDSKITHSNHSANATSTRSSHHSTSTS
SYTSSTYTAKISSTSAAATSSAPAALPAANKTSSHNKKAVAIACGVAIPLGVILVALICF
LIFWRRRRENPDDENLPHAISGPDLNNPANKPNQENATPLNNPFDDDASSYDDTSIARRL
AALNTLKLDNHSATESDISSVDEKRDSLSGMNTYNDQFQSQSKEELLAKPPVQPPESPFF
DPQNRSSSVYMDSEPAVNKSWRYTGNLSPVSDIVRDSYGSQKTVDTEKLFDLEAPEKEKR
TSRDVTMSSLDPWNSNISPSPVRKSVTPSPYNVTKHRNRHLQNIQDSQSGKNGITPTTMS
TSSSDDFVPVKDGENFCWVHSMEPDRRPSKKRLVDFSNKSNVNVGQVKDIHGRIPEML*L
YATIFCLILFSCFIFY*WFTDTLYFI*FLYLETFNFNSILQISFLHLKQRSKNALALFIL
RIHSIQNFVVTAD*FFTKLMNNQRPHVRTD*RSEFYFRRLKTIIVW*IFIFLTFNPV*IP
FNFCFFLQTIDPPVSVQLMS*FQFDRINNCFKCYCVIVDFR*FLQMHNQTI*GRSEFVEH
FSFRNDLIVFIHML*FTKI*NVFFNA*IVLFINNADGKSVNVR*FRKNIQYKFFYIVN*S
RMPINGNELRQVE*LVSSVVE*LRWVYISIK*NQINVAF*VYPQPLLYPSIHKADATITI
FFFFLDLSRRKNVYLLFPTFFLAFWKSLY*LNRV*S*CES*WFRLTDIKKVEIKLVV*TY
MHMYFSPVYVSTYF*FIARGKEIHTIFW*R*KHNVKARIKWTK*REA*FIFFPKSTQ***
LK*KGFAICQQHQLCEQ**NHHLRCL*RVCRLYLP*F*SYQWES*IFQ*ISNFVQFFLSF
FIFALEFFALLFPFISFFFQSNDPSTHLLRVQIGLFQFIHCFLQFGFTVF*LLF*ILVFL
GVVLIIRSQVIGVFSQLLCIRQLTL*LLHFTVELLVFSGQRFNLVFFFSVRLL*FFELFS
QLLIFFLP*LRF*F*AIQFLFDLLHFANCYFRCFLNLMRKKLLD*YSLCLHSFIPTYYC*
IYRFFVVYDNNNSNSAKRTSFIVLF*KTTKSTYDSVLKYL*KIRPRRPSLFL*SFWTLHL
AGQRPRCRPKITSFDPTSLSPN**TFLSSVARLLQTFERLSGKYSLTPCVDDPPWWYLSL
*PSVPIGQNCPYTTPRSFHERLGLEVSRFCSASS*SCN*IRIMPVPSPLTQYWK**NSKF
FSRYQNLNRIQEILLHRFESTWRFRYCFGHTY**HGL*YQYRNCVSPNRIFSSTA*CLHN
VAIRRQGLSSLILTVRSNVGPVIDV*NKFDTIQHILRSFYLKTRLET*LSTREGLCFYQI
HRGANQSY*KGE*QFFSLRKIVI*SSLNWHDRSFAELPTPWKEDPNILMQSLWKEKRYGL
VS*RDRANE*NSGNPHLQ*TATSLRKSSEGQSRITSPQLFYH*SMHSTLRTHMKRGNNLG
LNG*LLR*DNRTLRSYPSIVHF*YPFYHLAEPRIRVPDMGHLLTDPFLQ*IID**ICVES
ILFAFSRLSLLLRP*RQVSLAFLSKMKQSL*YFETSKIFRYDSIYPLV*RFSHEMF*YLQ
IHFPGPFVDEIRL*PIAGTSA**YPLCMPQDQKYRRFENLCQCSVAQSEICFFH*RQLHL
CTWSAPLAVVNKVPRSNNGIGHHSVLVCGKLTK*RKTH*TKEIPTSQKICSCPSIDERVR
GQ*VAVLAL*RFHWPRHLVV*AGGLVGW*SYQSSPLPCHLNMVVGRNLTLAEGMDI*NRI
PTKVDISGLYLK*KLH*QYPKVHKLKRE*SYHLPT*FPFSKILNHQ*KNQIRK*SSKVSW
QISPNVFENYPKLRPSLQEYWKRLYIVHPLQCSIEKWTCLKARQYMGKYC*RKTVGSE*Q
RRDYWQYRFYDP*NWF*KYQKSYHDVFLCHEFYPRIARTKSEGNRWTIE*EIQS*KSTNA
FQCPEKFLDQT**TLWWHVQTTQSNPWNVT*TG*NCLR*KLRWWSSD*ISNGLWRIL*NW
ATTA*GQFLDATHSD*APPDSLKITNYQT*WLVMINLALYILYTSSDLFFV*HIQEWFDC
KTRFSLKNYRRIV**KGSIYTKEKKD*YTRLQPRVVPHLKGVLKVLENFDILSCVC*AVP
ASLVPEIC*QN*SS*IYIHFI**LTS*YIRCADGYINAGIYKCYGQLASFCYADFLK*LA
YWW*T*NVKTLPLVIGKRWSSQPSAVTITQQTVLFDSPACMVFESESSGFATTNSVLLFA
GAQARRWPVWVKGGVC*PLFCRVP*RGVYIRGNGSC*SPASLPFLEIKGIFDWPVTLII*
*NKQIRMSSRIIVGSAALAAAITASIMVREQKAKGQRREGNVSAYYNGQEYGSSAPPQLG
KLHNIKQGIKEDALSLKDALLGVSQKAREEAPKVTKRVISPEEDAQTRKQLGQKAKDSSS
QSIFNWGFSEAERRKAIAIGEFDTAKKRFEEAVDRNEKELLSTVMREKKAALDRASIEYE
RYGRARDFNELSDKLDQQERNSNPLKRLLKNNTGDANTEEAAARSVQGWGDTAQEFGREE
LEEAKRNASSEPSEAQKRLDELKKIKEKGWFGYNKGEQSEQQIAERVARGLEGWGETAAQ
LSKDEMDDLRWNYENSKKQLDKNVSDAMDSLSKAKEDLKQYGSHWWSGWTSKVDNDKQAL
KDEAQKKYDEALKKYDEAKNKFKEWNDKGDGKFWSSKKD*LDS*L*RVGSRITYIHIHMF
LIFYI*NHIWSLLIMDWKTE*ISGIIGVYVHT*NTVIYLYIWKKET*MNF*SRRRRLKK*
TIAALQFSLFGCVWIHRGYCRV*I*F*TWIRVCERRAIFDVIINSILVFISIIVIIVNHV
GN*WWLCQL*LQFLL*IEFISFNHSVVLLFGRKPFTATGFHMEFGFRFPDHNVGSTAGPI
AVSS*TGAP*R*PLLFK*VLLVRWRS**CGPRSASSAGSPIGIVDRCVRVTSRYDERVGE
VHMLRW*CRS*WGGRQMRRRIQKGRRERVVTLHWGSSQGVRS**C*CRITNVVIVVIGQH
VSVGIKP**S*TMVVGRSWMRRRRFVIKRL*RKTSCPT*GSIQADGRWPSRINHINVIKA
SRVVSYNRTASV*CRRDEIL*GTTVIQWSLHNKIRIVCLVRCY*LISPRRLQM*IHSRRS
LA*VMEVPITRIIMIEQTGPAALPRERVCSVV*HRFIKV*WVLYISFKNHRTLAHGGGRW
HIIIVVLPLCRHVGVVVLVVVAGIHLCRLRSLCLKVVYHKSFQDQPFAPQEIAYHQRVSL
V*YCLLITSRLLQH*YGAHTVLRDENKDNKAIA*IKYHLIRFVKQALTRRCLITK*SAFN
NVRRIATTSTSAVLLNSLPTTIYMSPYTVMLSCTIFLTYIK*KSFRCLFFLPSKLHSMCF
*KGPSGGYDQVSCDMQELDASMGEVLFSMC*KELIMERLVIALYSSMSSCL*GYRRDLIC
DLLLSNDKLCFSSFPFFFFSVSFRLFFCWIYHDEHLFYCVIVLTGAV*VQSVL*SIFIYI
LYFLPRKLTLNRFAERFILQKNWKT*TEKKKVKEYVKSSSFHRNMYNILSLYFAKPARSR
KLLIIWSITSGRHCRRRLSQVCPRDPSPHW*CIH*IY*RFVCNYPLQAHKRPITAHLW*S
KRLYVRRRIVDVVLRTNCIAD*A*ICLEMPLHGEFISVYMVSRKN*YTSQWQSQGKHSLK
VLGTTTK*IRLFICLPVLPVG**QLS*QTLSGL*RPG*CLQVKAPKERTLLCTTVSNNCY
ELMASRAYGRALYPHCLVFRKVPYILQFTIP*SKENCDGRGKMGLTSI*QILKPLKSHRW
EKWSPSLWFTLFNY*NQTYKVSGPMSKNLGSFL**N*SLLMMVLLDFIRAYLQT*YGPFH
PLALPFVYTRTLSIGFSK*RLYDRFNFL*ISNDKNIKSTKEKGEVI*TVTGRNGFFGFYY
F*KIFVIILQNVKY*RKTIFNFLVTQSG*LFSNIRFSSSSISRGNFLGESSLLGIVFSG*
NLSLCFQFGNNIFVFPTNGSRQLTQGGVLSTWLQSQNSQCLWDNNSLLLIVWRWDTFKDL
*TFQSGLTTSSLVRNHTTKSFVEDSRWGSEMEWTTGLIESGSLSQEIMVL*FVSEKFTRN
V*FFSSNNNDFLTV**LLSNNGS*TTY*MTLTWLKIIIDE*MDAHSKKWIC*YYPLNKTC
FSRS*FPSLSISMF*RIHNLRRPFCIPPFCGCNIFIIFLGDS*TLCTMSKSCGWERKTHS
IISAKSYVPSMTTTGSTDIFSICSSPSVFKEK*YV*R*RAIIQCDY*IANLIIITQQPKI
EFPCSTYIDPLQ*HILRHKLGECTTGTIAHRA*PRVSVAGHGYRGRSLASG*FSRAGFVL
HWRA*EHS*AEVS*K*SLGPTQKNLMFHE*MYWCYMVYRCFNCTYVVIRIMNLHNTSRYI
QQGNLHF*SAFSCYAQMTFLYCCFFLNNNLKAVP*GILAVFL*MHSHSRHSPLHVT*AMY
PLTVRVTFEGRI*TGSF*T*LLIH*CIR*SLGVLSQRLQCLFGRLFYS*IRFVVVSPLWH
*VLRDQGKC*F*YSRIF*RFLEGLAVQVFGIDLAGMSLWHQ*KITG*QHAPLKDSA**IG
KVCSLSGKAKW*SVPNLHIPSFAASSLFSPFFFYFLFWRFP*SNIKINKLL*LSRLVAQR
VQKS*RIKKFIQ*KDINREFLFI*SLI*KV*DIS*RVFVLYCLIIHMGSTTLNFNSERNC
SRLRLLLRPWMS**KFGQ*VEFFVIAGRFHLKSSS*LVKTFSPSVLLSPSGQLMKIQEQV
FLQIWTCAIAAVLSQRRLV*SYSIYQHSTCSKNHA*LHR*FSNSSLYLVDQLFWAPSRRL
YLGTDYASRSSATPFEKTCKMRSCQR*ICKYPLMKYYLRVLKEWLG*SSMHTTVVV*YIC
FHPATSLMDFLYGVHYR**QHCCYWTCMYSV*FLLWCNFHLLHLLPS*SCLHVDPLLG*H
LMMTIMGCVGGPAVVIEPLPVTFALLNR*NLR*CYVATGCCYHSYHK*IVIWA*GDSGNN
PI**FLVPAI*RSFAHHLCL*YNQTVAP*EESLDLWESF*N*P*HHFYRISVIPMIRSPG
*I*LQHAS*TQFWQDQDQCLYSSSRLYRAQHSSSSCLCSYQW*LLIFVHNTSNHIRQF*H
KR*PLWQYSSYWNSHLTQPQDRLTS*EHMSPH*QALGDPGLYTNYTYH*IFVPYW*QTFI
ITVSLQAFLC*LNAQFTHYYLNLQSSIEPVFI*TSYHPVLSIPFLICLCFSIFLFTSSMD
HNLFRNFFRPIIYAIFPFKPLKNIL*DLRSSSPSDFFFSFFFFW*FFFQK*LQ**GLSTW
T*PSIVE*FLALKTTSNRIFYKAVRKSRRG*HIEKKPLFI*VP*GKRQRKRSAYYN**GR
YARTSATRGTVCQEKKGH*SL**MQKEKS*M*WSATMYPLYCVLL*MYL*EAYEENTELR
KLRSSNTGQCYYWSIIKYCGGSRRFQSK*TPLKH*NRKGYFTGCFYNTCK*QSI*TKKV*
D*EHKVTIED*QVQANI**GLPAVT*YRQSGYSCVLADLSQF*EGLAVVFR*HCERIYFN
RK*QFFSDPTSTFFKFKKLHSRRIFT*HEK*LE*RLQQQGTRQCRYLLQYPRW*RNKNNS
TTKSDRFTIREKYLGTLLCSSPILSQTIVH*TIG*VV*DRPKQLYV*ANAIFTIVLRCNR
CGSIILEIHCLK*LVKGKVSTG*RLQVLHCSKETNRHYKCP*LEFHTSNFNADYILTMFR
TFINVLHLYRCRHEKCFESRLS*EIEPQFWF*SNRN*DEETPFLYNL*TGRLYQCNAGPT
EIYFPRRF*PNSPPGFIR*EYH*GGVPT*EPTLRFIKYGDFE*TYKTIFDFK*DHF*TIS
DKKN**YNFS*DSY*LGIKVEKLVGFVAQRTDT*RRKY*S*I*KGKSFITFVFFARSDNI
IQAFYSLFITQHEC*KCRSLMLPESPELYCRGSNGY*VSKRDG***FINWFILVCLLYNF
LLRCRSLILHP*GAIA**G*C*RIL*YFERRRNW*KRSYSTQGF*YGR*QDL*FIEPNF*
KTKLKNYPAYCVTFITIQRKCLFSD**FLRFETSFRRFIATTRILFFPGYEE*LFIS*E*
RKHQ*LRYG*LPK*YTYFRKSFK*STTARSSIPRND*HV**KRSEQFLIY*YQT***WPI
KYS*CHR*RLYQE*RRHPY*QCIRF*QQ*EQCIK*LQPRYH*QQLQ*C*WQKQ**Q*YY*
Q****SQQQQQRQQQQQ*********Q*Q*W*******Q**Q**K***LRH*D**QFTVL
*RVSPVTNTAFTRQFEHRR*RGDVT*Y*N*KRTKYD*LKRYSWSIRSVRCSAIWEIPTFK
LPL*MKTLSLIYIL*YRGYSTC*T*A*NVYVCIYI********************W**TA
ITKENSTNPGSSFP*NPIFTYQPHFLNYLTFKSSIIKRKHE*YSKQ***FLYKII*FSNS
ISYMRNIFIIGTLS*TKACFIFI*TKKLTYILGFPFLFIFTANESAK*VLNETLDGVLDK
LLFSMTETFLSYNCGADSKEKV*SVRVVSIESERPCGIPIPILEEIFGTFVSFVKKLSRL
SSSAHM*LNEASFSSATEMESFVSILPRS*SPSA*NSTIVSILPSS*SPSA*NSITASIS
SDP*ADTSSDLPVPHVIKTA*TLCLVVAAVIVGIGTDQPLSSGKPNKVVVALSPSFTSLF
PMVILKTSLSILLPETFGTQSKTSKAFASYSVNSNLSNGEIKSAPTPINSGLLKSIKGKT
YFKISRV*TLIHPILLNRRPRRNTNV*AEYEGK*FLDMKLTTWLMKSFFDLNLFFARESI
KREREGCLYAFASSINESAAT*MPVKSLRSIAFKNLGRFAINAKSSLDSVFAIIRLSFNK
FNLSKNFHVISKEFADRNPVITICCKPSKRPSQLEGKIATKHCTVSGESKSILEMNLLKH
DSTSMNSCS*MLLKHAVMDQNNCGKLIKFVGSSSAMIAFKVIKICMANPCISTFPSDIVF
ESL*SISRNIS*SKNVNNDLNI*NDLHAMCLTEQVVAHFKAILCQVT*NSSKSENIEIMF
LINRSIVFGDLAPFFIKLSYDHKACLFLSSFTVSSDFS*LGANPNINVDAILHALS*ISG
T*WSSKQMDICSRRGIFAFTDSLKFVNKLTKKIIESCAFEKMILFPL*FSRSQIFPKKEY
LLLFIGSLNVCFAKGTMYFGSKLFNRVSSSPMPPGIFAKYNTISLAY*TNNGLQ*FIEEF
MMYSSDTCIFWKELPLPREIHSCSTSFGKESLRSIVM*NRLFNTINVSNSSKDFNVNLFT
QGTISTNKSLFISKGNKSSILTKLENILKHKS*ESSSANMLEISFAVDL*TVFEEFASLS
LNTLV*EELCNFVSTAESRSTANVLVSSLSATKPYKPKETNSSSSKTKLSNFKTDLQSVV
*YKTATEGCEWCETHWKATSLNSLKFSLFLSRRFSKARTPRFFTVVLSESNSASIQASKS
SVSNEITIGNSKSSSNVWVIGSEHKTTIVSSTIICNLFFWNSIPVVIAVLSLPLSVFFII
MAYLSSDIGSYSP*PHHSFKKLKHDARAWKGNNSSISGCSLTAI**LNIRPAK*LRSD*Y
S*EICTESFSRNCFVFCKNSDNFRSIHSSLNIISDFKYGDKIVKI*NISTLIWLLELPSF
HATKNTSIASTYALKMLIFIELSPVIIASLIIIYFAFNKGRTILKIDFADLIFWC*TVKI
C*LFFLPC*GILDGICSFWSNVEVNEVHAAIKYSFHWFTIVSGKTFLSLKSTSFATRRII
SCTCTSLIQTIDRHNAIAIGQVLKTNASNLGKALCHSAASTPYSDSASLISRPLLYLEFS
RLNLVFSTALNVALCGLIKVVVLHSFNKSISLVPRSAAKWDDDLECPFDNFSVFSIIASS
NLKIILNIWMPNLRIFASCEQRKNKPFPSTSSITVTVFFHSSFSVSLLSSCSASIGNKRI
PSKPVSFLFSSLLDDWNSSNQHSKSST*SINNLLYSFDDKYDML*LDCVFSSKSNEYLAN
HVIRVYGFFLDANALSAF*LLEEIITSE*TAFLDKISIVDLYGIVREIERQHGIASMMVP
NNIT*SDLFLLESLSLEKLKPNGLNAFDDCFWC*FSGDQTSEPMLESNKRNNL*K*SDIS
VWFMEEAS*T*FTVILFKFSS*SLLSSSGNLGLSFVTSNPLYVFIVKISFS*LIFSRLEP
LKDCRINGIKACSIKKFGCKNPIDINASVNGFKRPKSPVIQFSFFLVFRYSCKSLVSVLV
VLFKVSGHLYK*TQTNLDKPTAKIILSFRLLDLTFEAFASNNDSHCLENRSGGDAHKIET
VNLKPLTQYLLSACSLLAVFSKVDIASTHVG*LTSAVNEPAKGNNSWLVTSAYAKQTGKF
SVFAKNFDKLFMKSALSSNFSNG*FLNFKYLIPRINK*VLGSNSGGIYAGIFSRSAINRS
LTDKNFFSDIEPSSSAKEFQFEDLIKLVDIESGSVVFN*VKTISSSLSDKSSSSLLEACL
TISFSTLHRMYILIRDFLSARNASSFATSIVFSKLFNCEFAMDGLEVALLLLLLALINGT
LLLKDEETCLFMPGRLLVLLLCLYFEVVLLEDLDSRLFIKK*ACEGCAFSNSYSFNSFSI
SSEAELAASDLVFLQNIIASITGFGFFFAM*PRDLIISSKLGSTPSPRISTIGGSAMSNC
CRHIFSLFSA*RINFVKSI*RAYSEGLFQSVAICCLKVVT*SSATDFAVMSGGADSCILC
CFCSGSSIEILF*SLCSSTKVGGRA*PSPVPCCCCCRKSN*LFREVPSDISVGDGISIIG
ASVTDW*RGNVLSGASFISSKTSWPEGSISIDIWLLLLEPSALFVGGKVKPMP*SLWGGK
VNLEAILMYNKTKKGY*NGNTTNNQNFHTLTSHVLL*RPKSTFAFSLHLPNPLSQFLQFY
MYFPVWLSFRG**YNHNDSTNSQCM*C*YR*FGRDGIL*VTSMSQRELGHTSR*VIPLCS
FFLGLHE*VAKKKLKAGNRYEFFKY*NLV*LFK*IVDYVHFTCNEGVTSMII*LLAVSFH
*TCFNWEKAEQLGLTMTPDELNSAVVTFMANLNIDDSKANETASTVTDSIVHRSIKLLEV
VVALKDYFLSENEVERKKALTCLTTILAKTPKDHLSKNECSVIFQFYQSKLDDQALAKEV
LEGFAALAPMKYVSINEIAQLLRLLLDNYQQGQHLASTRLWPFKILRKIFDRFFVNGSST
EQVKRINDLFIETFLHVANGEKDPRNLLLSFALNKSITSSLQNVENFKEDLFDVLFCYFP
ITFKPPKHDPYKISNQDLKTALRSAITATPLFAEDAYSNLLDKLTASSPVVKNDTLLTLL
ECVRKFGGSSILENWTLLWNALKFEIMQNSEGNENTLLNPYNKDQQSDDVGQYTNYDACL
KIINLMALQLYNFDKVSFEKFFTHVLDELKPNFKYEKDLKQTCQILSAIGSGNVEIFNKV
ISSTFPLFLINTSEVAKLKLLIMNFSFFVDSYIDLFGRTSKESLGTPVPNNKMAEYKDEI
IMILSMALTRSSKAEVTIRTLSVIQFTKMIKMKGFLTPEEVSLIIQYFTEEILTDNNKNI
YYACLEGLKTISEIYEDLVFEISLKKLLDLLPDCFEEKIRVNDEENIHIETILKIILDFT
TSRHILVKESITFLATKLNRVAKISKSREYCFLLISTIYSLFNNNNQNENVLNEEDALAL
KNAIEPKLFEIITQESAIVSDNYNLTLLSNVLFFTNLKIPQAAHQEELDRYNELFISEGK
IRILDTPNVLAISYAKILSALNKNCQFPQKFTVLFGTVQLLKKHAPRMTETEKLGYLELL
LVLSNKFVSEKDVIGLFDWKDLSVINLEVMVWLTKGLIMQNSLESSEIAKKFIDLLSNEE
IGSLVSKLFEVFVMDISSLKKFKGISWNNNVKILYKQKFFGDIFQTLVSNYKNTVDMTIK
CNYLTALSLVLKHTPSQSVGPFINDLFPLLLQALDMPDPEVRVSALETLKDTTDKHHTLI
TEHVSTIVPLLLSLSLPHKYNSVSVRLIALQLLEMITTVVPLNYCLSYQDDVLSALIPVL
SDKKRIIRKQCVDTRQVYYELGQIPFE*TLVFNNLFTLMST*KS*RVY*VNMILLCIVQQ
NSIYFYYV*SSSLESSSSLSPTGAKPGVRPGYL*SLTKSLSLISSLNCFLLNLLLLLLSV
FAVETVSFKMDC*MSSSSSRTSSSKSHDLKF*EFLLINLFKYFLSWSVNVPSC*CFFKTW
CFASCSSCSLSNLCFLTFFFLTSLHFFLIL*TSLFCNCTLFFKFLSIN*AFDPLFTLVLP
LLALILGTPGKRFDSSPLTTEVAWYLDVWLSEDDILA*LAPSLSCSYSKQLFHKTIFPQL
PAIFPYSLVKAHRKIFQRALGSRVYIHVTI*YPPRGKKRRHQFGTEKRKSLSITKTKLKR
KKSIEKNKGNQRLIWWK*QHKEAAQFRASANASGTI*VDEHGDE*YTYNSCRIGCGCCSL
*NKWKAGVRGTT*NHYSKAEE*CTVGAATLPL*GYSKPSKGKQVGDQGNRRHF*EYIT*S
GYLRNKVGYLEKEYR*RISVR*GFIE*TLGCLTVTGERYRCP*LLLRLTRHQER*HYGDR
SRLF*KETNKNISRFQCEGQKFGFRIKIF*RYEDCIGRSRYRNKDFCTYIQQN*RAGKIT
CQSGYILTR*LFRVYYKR*FIVQNGYFQNQSSCGIEKFKATN*TKID*AKVNQQCCQPGT
PQYSIST*FSFHSSCTKICSN*KQSYCPTNRSFGRRIRKATTIGKKKKGT*FTFTKNKQH
H*FHQRKAVRAMVSSRTLLSVR*IRRFITQSNGER*TEKNRKNC*ATFSCFEV*R*GGLF
KAFRSN*GY*NYTVIEAD*FLFGFFVGGC*STTKRSKNSSW*GSPTNYR*RKRKD*LL*S
RS*DQRKN**TTFYSCWRHFKRVSITRFRMDGVVVQ*SFERYSSR*DGFR*NHPIYFSNN
ISL*S*ERHRPFPSHCTFIHNNQLDFRI*KMGSELKHYYIQRYTKSKTLFTASNKGWKF*
RLIDNI*VYY*R*ISFIKT*LGSYDH*RRS*NEKCSIEVIIHNFSLLSYKKQIDFNGYSF
AEQSTRIMGTVELCFA*NFQFCEDF*RLV*YSICQHRYPRETRINGRRNSVNY*KIT*GV
KAIFIASFEKGSGKGFA**SGKSYQM*TVWFATTVISANAKA*RAICWCRD*GGYKGWY*
RFEQ*DYAIKKNLQPSIRI**SGRCCKPLKR***FTFQSSGQV*ITG*SATEIQSLRPQS
ANVFPNDSSYGYYGRLPKNERFEVYEIRW*H*D*RKNRNAECI*CSRFRLFLFPFVN*SR
WFGFEFTNCRYGDHL*YRLESTPRFTGPR*SSQNWTKE*G*NFKINYH*FRRGSYFGKSY
AEIGH*RQGYPGR*V**QINCRRARSFFEKIDRK*NEQG***QSRIR*R*VKRYFGQKR*
*KNTI**N**GENEPRKSRC*SARPESPSS*IDSIRRATQSIQRRH*RTFQERGF*TIGK
D*TKEKSLL**RSN*RTIFGGCRR**YVFRRCH*KKT*ST*KKEITSKWYKRE*NRNPGK
HA*SIRNFID*EQ*LHCSCG*GN*C**RDYSFQVKTPE**KEKDH*HCYGRRQREYSRRE
YISRKRGR*GGRGSKK*LR*NYKWFRIQEKETETDRQDQTKQNNCVGE**W*ASRRKARE
*IAREEDCSQKN*N*IQVAWDFSHGGKIGGRNARTVR*GRLPSKDVHF*KASFETRLSGL
F*SN*KTHGH*YYIEKLQEWHLQNFGGGKASLTNDV*KC*IL**RGILGLR*C*QVK*VY
**MVQGTLFVTFSSPHVFFFYDYIPFPSNTLSSLFFYLYICL*NIYHCNNKIDRANIIL*
VTNILWLILWAY*CRKIITRRRWTS*LRPFAIPGLRKGPLQIRKRHYT*MIGKGTAGVKT
YM*VRFTITV*IHWVCTIYTLTNPCVI**DHILFVFRPQFCFCHIVAAAEYR*EERRKRF
SFSIILLPNFPKLKFRLKETTKEKESSF*KILNFTVMLRFVSSQTCRYSSRGLLKTSLLK
NASTVKIVGRGLATTGTDNFLSTSNATYIDEMYQAWQKDPSSVHVSWDAYFKNMSNPKIP
ATKAFQAPPSISNFPQGTEAAPLGTAMTGSVDENVSIHLKVQLLCRAYQVRGHLKAHIDP
LGISFGSNKNNPVPPELTLDYYGFSKHDLDKEINLGPGILPRFARDGKSKMSLKEIVDHL
EKLYCSSYGVQYTHIPSKQKCDWLRERIEIPEPYQYTVDQKRQILDRLTWATSFESFLST
KFPNDKRFGLEGLESVVPGIKTLVDRSVELGVEDIVLGMAHRGRLNVLSNVVRKPNESIF
SEFKGSSARDDIEGSGDVKYHLGMNYQRPTTSGKYVNLSLVANPSHLESQDPVVLGRTRA
LLHAKNDLKEKTKALGVLLHGDAAFAGQGVVYETMGFLTLPEYSTGGTIHVITNNQIGFT
TDPRFARSTPYPSDLAKAIDAPIFHVNANDVEAVTFIFNLAAEWRHKFHTDAIIDVVGWR
KHGHNETDQPSFTQPLMYKKIAKQKSVIDVYTEKLISEGTFSKKDIDEHKKWVWNLFEDA
FEKAKDYVPSQREWLTAAWEGFKSPKELATEILPHEPTNVPESTLKELGKVLSSWPEGFE
VHKNLKRILKNRGKSIETGEGIDWATGEALAFGTLVLDGQNVRVSGEDVERGTFSQRHAV
LHDQQSEAIYTPLSTLNNEKADFTIANSSLSEYGVMGFEYGYSLTSPDYLVMWEAQFGDF
ANTAQVIIDQFIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLANEDPRYFP
SEEKLQRQHQDCNFQVVYPTTPANLFHILRRQQHRQFRKPLALFFSKQLLRHPLARSSLS
EFTEGGFQWIIEDIEHGKSIGTKEETKRLVLLSGQVYTALHKRRESLGDKTTAFLKIEQL
HPFPFAQLRDSLNSYPNLEEIVWCQEEPLNMGSWAYTEPRLHTTLKETDKYKDFKVRYCG
RNPSGAVAAGSKSLHLAEEDAFLKDVFQQS*R*IQI*KT*KYSHINT*YFYLNVYGQPFY
LKNDLTNIFFDTFTFFFCS*C*HLLSLFKII*FNVLFM*TFFY*LYLLFIQESFFTLY*Y
RFFPPTSSSGVFTARCFSCPHPVEKKSEK*VNGKGEGGR*IE*ISFIHHAQLLLIYTQFK
Y*SGFQRVCRSYSHNLKRLPLLQAPQVVLDMR*RRN*PEMAIWFMHVQED*NQWHNWPSN
LVTIVSNHISWIFPSQKKL*HFLVFCELIYLMVN*IYCTTMPVRVVHSLHWMQQMLQ*NN
ALRSMCLVISTCAVNCRSSLLKRKEPLSSLVPWQELCHSPLVAFIPLLKLLSTNMLVGYI
*R*SPST*E*LTLLLAVWLLISLIKGPCLKPQYTTSLKVGKLLIQEKPWLRTISPCQLMR
TQSNWLKIS*ALVTL*MFIEERSPTSCVLS*YLFLTGYWKKDFPKNLNWTKLIML*SRNR
RIRTISVSPSSIATYIYIQDSV*FVHHVRTSIANNRSNANVQLLFKYCLRLVVPVCQIPV
TSLILFALTV*NALGRNSLISHRALLFFFFQNCHCLFINYMKLFCIYLRIPSLTSKVRTA
YSNIYIYSVE*DTIARPFELKETVSLLPSRIPTIYSPSFIKIN*RARKHLFSATQLLTFL
*KPQYLS*PELYF**VIYHNFSHTPLQSVLP*IPRLAQLLQQFNPFQYRQCVLKTLV*SC
STAIFGFIFVSFS*TTFVTKIAAENFLMRTLFPDPDMPFFGVSRQSIEVSDLH*EEPENS
H*CFQHSTA*QLCIS*IRCRLVCIWKGFV*EKQYLR*NKRKKNTLLTNIQSFIFLQK*NS
QLPLLR*LVLVPSCLLYHTWMFTKKMPTNIRGPLRTNTFTKLLLSILMATL*LLLLQKSL
LLLPLLSLQHLCWLQPPPQPLRIAPLPLLFHLLP*PRMRKSLMPLHLPLPQHLKGHPPPP
PPPRQLLP*KAALFLHLVKKLLQHLLSCQLLPQPNLVLLLPLNLVLLPLHHLLLLLLPLL
LLPLPLPPPPPLLLLLLAVVVSTVIWPTFQAQVRNSKTALFHVTNSHLVKVSFLLTGLAR
VDGPVWKTPTLPLAVHARRGPTVPTPANQVCLRPNGHPINHLTVDLSGVCCVKMVICTVL
TLTRITYVNGVSRLPMLFLN*ARVSPFAEPTTRALKTWLSQPMLKGVALCH*PLLTKILT
LLGKAKRHLLNTTLITPASQLKMGVSGVLLDLVLVTGHH*TLVLAPLVE*HTYH*FLTQT
TATH*TTTSR*LLLMIHPMSSVNVFTKMVSSLAVLTGVPSLLLPVKLISSYTIKLRDYYF
SFFFSFFEHISPPIPHTITMVPFSFYRYLYCPPFSFR*WPQCFCTIIQVNLLDDQI*PRF
ITIIFN*QVVFLDREIFKDGTILNRFT*ENTYCPIPIRNLRTLFIFSFPASFYCSLFLDS
*K*YICSSAIVSKGILCRFTKSSHFRIRT*RHNFPHVVFSAPSACRREEDLRR*ALPRHY
P*NITVLGNCGSKRENADGEKNFWKFTASDGGTL*VLPFFS*RLENSEC*EIKRYALPIL
IKAKVHKNNKV*SNSRKDTGNPRYLILTDK*N*DQIAY*YHLRFAYFKGYAEEEINCVQS
LRLTHTKRRKTFQESHD*LQKLKKNK*RRKSKWMPYYEAGAT*TIRRKREAERTNGC*TR
AAYLIIFWYNRDS*YRRREYQQ*TSGIIANRKVSIASNKNIKTTWV*RYSRTKCMRHWPS
GAIFKRTIDKRHKRTRKDTRVKSCETKPDY**MYGK**NK*FDIKQDS*YVHE*RYK***
QQSSYDTVSDNDKETQDKRLRTCKSTRP*KI*I*YTYSVRS*DRGRIPSNTPATRRIYFT
YACKSVDEQPVYATSATTSATDNAAVFISTRDGTTSSASYNELKLGVPDTSDELTVSFLE
PAWPLPTKYRCSSGNEYGPTGKYIRAAAPAATWSGTRPVKKKF*S*KVTKCQYFHGKF*V
AHAKSPAGFVPKARQFSHSYTKTSSSHMTCSNFHFYHLISKTISLPNLHSMHPSTLLQFK
KKYISIYMLQCYYYDFFAFTPYLISIMNKQDIDNICCHFGFSLLNCLVHPRCSYPSERS*
DGGNNFSAS*PPPQICAFHHIFLEKMCLGSDDVV*ATGLFFVGPDENSNGGYRTDKRRHH
LFLDKEAISR*WGI*IYIVKTASQLLVILVETLLSNLSTATMAGATSSIIRENDFEDELA
ESMQSYNRETADKLALTRTESVKPEPEITAPPHSRFSRSFKTVLIAQCAFTGFFSTIAGA
IYYPVLSVIERKFDIDEELVNVTVVVYFVFQGLAPTFMGGFADSLGRRPVVLVAIVIYFG
ACIGLACAQTYAQIIVLRCLQAAGISPVIAINSGIMGDVTTRAERGGYVGYVAGFQVLGS
AFGALIGAGLSSRWGWRAIFWFLAIGSGICFLASFLILPETKRNISGNGSVTPKSYLNRA
PILVLPTVRKSLHLDNPDYETLELPTQLNLLAPFKILKAYEICILMLVAGLQFAMYTTHL
TALSTALSKQYHLTVAKVGLCYLPSGICTLCSIVIAGRYLNWNYRRRLKYYQNWLGKKRS
KLLEEHDNDLNLVQRIIENDPKYTFNIFKARLQPAFVTLLLSSSGFCAYGWCITVKAPLA
AVLCMSGFASLFSNCILTFSTTLIVDLFPTKTSTATGCLNLFRCILSAVFIAALSKMVEK
MKFGGVFTFLGALTSSSSILLFILLRKGKELAFKRKKQELGVN*EVKLLESKENVPFDRS
TTEKEELV**VFSNRK***VFFFF*SELCNN*N*S*QHDSLT*NG*Y*VLPLLFSAIFCQ
GRKYAGGAKFGDSGFMFLARLLTDPLSHLLILEFLLVDKTMVKLKGLKNLYHCSKKIFLQ
QKK*ASNQRSKELILA*KK**SLSTTIFY**KNNR*LMKRLL*VNHDQTTNFCNA*RIYS
QGRT*RI****CGQIQLRCHQ*QRRRKI*FSF*NR*RIKF*YGALFKVQP*AKNASCRSV
CLHRLFFNRGRVYLLSSAYYY*EEI*HHRRVS*CHYCGLFYFPRGGSFNYGWFS*YIWKA
AYCIMGNLSLLLCLHRTGMCT*LRPNPGFKVFTGSRYFSCYCNK*RNNGRCNDKSREGWI
CWIGCRVPSCWNCIRCIDWCRIILEMGLEGNFLVFGYWFRNLSSFFNLIDARDKKNFGGK
RLRNTKVIFE*VFDIACWFRKKNITFRRS*P*DLRTTY*RGFFSTFKNFAHTRNRHFIVH
CRPAIFHVDHSSNSLNNCIE*KVQSICCKNRPVLFTCRNLDTDKYYLCWSVLKLELQNKK
G*IQQMD*RTRITADGEI*R**KQGSRTYSL*FSLCIQFSGGKVASSICDTSSQ*HWLYC
LWMVYFGENTACCCIMHKCICKFIFKLYFDLLYYFDSRSLSV*GFYRNRLLKFI*MSPIR
NFHCSTDQDGREDEIWRCFYVFECYNFIFIAFIILSPEEWETTIVR*D*GK**VGWKVSW
*KFRKSFDVKKKSRKTKKSLPPLSRNRYLYFITKTYGII*SI*NFFEEIT*KIFTFFFSF
WLSK*TKHKLLQPKIKLEKIQNEQ*GHFLVTDSLSFIIFFTYFIEKNRMLNGHKYKCIYK
*YCLVSLEK*MKNEIAYKTDIKFKTEMK*AFKIN*KVKRRIENY**G*RETGNVLELKG*
KIYGGDFPIHTLMLLHKIF*V*S*HIMQRFILLVKFMV*LLNFIF*AVYLFL*IFNSVKH
CLPHVYDICRENWGNLFLLCIAR*LYRHCLLEKWRWWSLQD*IVCRC**QKGKLSRANEG
WFSFGIQSWQRF*FIEVDT*LNMLWCTKNISTMITIPINIIAIIIVAIVTIVNIIIVIVT
IIIIMVINIIISTILVRLQCFLRLEYNVSVYKTKSVL*LH*QILHSR*F*RIKI*V*ACL
LF*FFFLLLGFL*WMHFQRLCV*DFKSIMTLTRVSLVPILLE*DF*NFFPKILHRLEIFY
EC**LRIIHYCSNECYILRLFPFFPYLSCRRGG*IRVV*LIFVNRA*VGVGVRIRIGVRI
RI*TGNYSWSN*RAVRTRFFIKI*SNGCV*IW*IIREIFAYSARLIH*VQLRLKIFQVHF
INISNKMMRKKKKDLKKRTEK*LNEYDNMIYYHEL*SG*PNGKKGNTKKVRL*GKKKSSF
SITKTIRSFFNLNKKTRL*KKILFRMQT*KNNTTVPYLYIVHRNNLNQYNMQENNEVRNK
HNGTPGLEKV*NSTRP*ALGWVTHFNFATECHMRC*PHKIGSTICKLRQIPEKIPFPSTK
FNRPPPPPIYVYQLIQMWKGNILDDSFFRNLSLPRQNLILVFVRERCADPLRLPSSKSRS
TNGRGEKT*SRSSQPQKPPRACCSAHF*CVCS*DKVLT*GSK*LYSARS*SSHLV*FCML
I*AYKRST*GPASAGPCEKEVFTFSSSLLWK*LESDYAYA*EKKMKEFSQESTLAYWAQV
RRGACNASVFKRLRN*STQICRCTQEYIINHSKHISPRKE*MPSSQHCGHARCLRKILR*
ARGNVICLSTLFFLQ*TYNKSLIWSRELNFGCVVRMEGVSETQIEATYHFRSSPAQNQSS
ANFFLGTALPHLREK**IIDKKYKERGVDELFYKIV*GVRETPRTFFDIH*QDYPS*IYW
CHYPLMASCIFLLSFLTFLKIGKQ*KEKKKKEKTCIILNLLENRQPLIFVFLSFSSLALV
SIFYFITTSFSLKSIVAQGKGKQTCHFYVGQLQRQINRSKERSLFWATVPVVKLRC*MFS
PEVIFPKFMSLLFLKTISMIFSLTVNISRYRCGILRAKRNLTGYDPCLIQIRNV*CYVSV
LIHAIL*KMSKINGWVKSLIIVKASS*S*LH*SVT*ETMKMNLTQSHRTISNRITAFLTT
TEIT*IAPQTAKT**VMKKV*LWLKRSVRYVIWNVALS*IKVSTKLSQKPQELL*PRAQ*
QPK*KVTVDPAVPLCNIIRHGRTHKRIEPKKRD*TNNIISYRS**YSYYFIFFM*LLPLL
KKNIAKYHKSFYSSCSFPSSMCSR*VEGVGFLLDCTTNKLPLLWLRFTLPSLSGELSSFR
LGEDAIFAGFLMSSPTSFSLPLSSDDADDEEIVDTREFVDTLSLVIITGFCNNLGLSW*S
LDSLVLYKISPVGEMKSEFLLDSDARENSGLSKLLKNGFSLLV*DTSASFTDSSLFPGLI
SDSLIWT*SWKFSLAG*SIYGESP*NWVCCVENIFDS*S*TLLVNLCEE*VVITHHSNIA
KKITPAIPPTTMKTVPLGISPESKI*GLPFLEGGVILGIIEEDVELDKSGKEDEEEATDV
IVLLELAVVVEEVEVVNFGRPLLAMVITVILAF*VSIYSIFNDLLK***VLLT*L*CYNC
FFAPMRSFE*SQVIY*IFFKCLYHILQ*YIFSLIFHFPFSILFLERVTKLFQEQYRILSQ
KEKARKLNFICLRKARTAKPITSQDRKVSLCAFCSAALSSAFFASLGAVALRISCIFRNK
GKSPIDVRRNNPAKKIHLKNLPASLVVYSNHIL*LYFCQSYAMPLKL*LRIFFSSLSMPC
TFRFSKI*PNTHLVIFTK*SIR*H**REYLME*HIRKALAGNSCTVFRRNLFDDYFINFF
FFCRIPKVITLQK*RVNG*KLLS*IR*PVILRPFLDSN*YRSHW*CNNLFDHVTTIRVRL
FKKGVKH*NN**LIRS*LLGVNCFFQ*MESEMTKLPIFNSSWYSDVVSAFFSWIC*LTSI
DVSYPDMTYLIFYLSRYIT*KGCTQFCSIYPPICKNSFSIDYS*FVSC*TSSTCVPYILK
LHYGF*FEKNC*TKNL*LGTLSLCKR*FHRGYIARRQ*KCPWTYSS*IEQDQFTSLPGSS
PIGIQDRNDEIQEQNKQLCQ*PRGKTFNC*QSVPRCGI**EY*CYY*SMLCSRERKDSGS
STNIFYVLCLCKH**YRSRPMSFNCFRRFFSNGYRSCINHFEKRLAN*VDVRYFTR*SNR
SQN*DQFNRKGLTELGQWVSRC**SLRRFLWWLYSSTSHQVS*LGYFANSIQVIRFSRD*
VGYDICNSRVGQNFKCNEGAL*YFLPSL*ICTKSCSRQ*SKEDGSHFENNQ*RENAPLKG
INCFGLR**PICWWIRC*FSFNTDQRG*QCLGKEVILPIGYSIWGCRQI*R*RIRLFRMF
ENYRWNP*GEHTFDKVLQGDVI*AGQ*INRLI*TVYVQFYIYIYIYIHI*RNLCVFCIFK
YI*FWRHFYKRSHDIVTISIFLRFSCPVSMIEDEFIINGTNNVHIAKYHYFAMFKFLKKS
PICFFVFMANPTSTTLNPFMSFVIEEDASNDEAFLPFSSNCNLLTCSRNNLISFSKPSRA
RDSLASFATNGLSSNLLFFTVNNFKMFSNSSV*LILADTSNSF*RNVFCILN*CVLRSLT
YPLEASSKCIKNRYSSFALATSSVICAISFLT*SVTFSFRS*MLAFVICICSHLILF*IF
NRISASGILQVYRLLIDRTVRFTKGMLD*SVKKVSIFRMFSIRTVNSASTV*NVLSINLN
VEFCETKGIFDTFALV*YSFNCFGLHCSAK*FSSPSNV*TEKLHVSTGSVCRPLSTASFL
TVCVLLCFTGMASV*TSFSLELSERSVCMPDSA*LSSNEVCTSKSAEALTSRALKASPP*
GSSSVLISSSLS*DSDILSSRSLLSDMLSSDSLTSLLCLLSFSLASSSEDWWSSNCFIAI
FESKFSFSLSFFNAIPSPWTP*FG*PLLSLFFEVSFISLDLLS*STTAC*LYFGSVSLFS
*LFTSCDFGISSFAVVSKALSEVLTDISLPDT*PSFGSSL*SFLELSPVLSSFAGRNGFS
TLFKVMGPFSLVSLVSASSIGETVDVLLLFIVELPNEKAGVVELGLVIFVANAENGDSDF
ALT*FPNTGFFKPAMSILALFFIVSVSLPMGDFCASSSTTSPSSSEGVSGNLVEDVCSTV
ESVKSLPLTLGPLLSCSSLSSLISLVEPLLKDPFSVSSFVKELNGDLFPNCEEKGEA*VP
NLKVVSEPTDSRAFENPDPKEELPKSKALVFGFVEVLGFVPKGVEEESTSLLDSSSL*SP
EDGKGDVESTSFGLSTVGFEIVKFDPKSSLLAGAKDDEPNAAFPNMDPELVSLLDAVPNA
DVPKEGLPKADPEAGGSADEFPEPKEGVPKEGLPNADPEAGGSTDEFPEPKEGVPKEGLP
KADPEAGDSTDDFPEPKEGAPKDGLPKAYSDVDGSLAIAPNAGLPNTGLAEAGSVASCSL
DATPVLVDETDGKSILNADDPNEGAPKVEEL*DCRLLAAAGCVLRKVKPDVFADVKGFSD
KALLDSLFFFFSSCSCPAIGIFSDVGERDFSCSKDSRFML*WPLLIAAT*NNPTICKLPS
LFNM*TSGNRSIVSTPEQGSRIVPEVTTSTATPIGFVSLSVSSLMGNTARSESWEGSITC
FESHILTSLEHDDASTFTFASGSIKPDKVTLYIYGNLTICPNGGVISKVS*NEALPSMCF
IMYIF*SYETSSSVSDITLPKTAKKSCGERMVTLKGEYSSTGSSSNSDGRENSNCFSISP
FRHAKL*KLLSFSRTANCEFVTSKEVTFCASCLVDFVLKSSADKSLTEFKITKVLLTFFN
WKTGFSKEVTVRNSLNSSKSNEYNAFLVETKT*SP*KHTNITSGISFSHLNVNGVESEVI
*SLSNCNSPTTALLPEAATNKDLLFEISRFCRDANGSFSLKEGRICF*PKNLKPKSSEVS
VGTSSFKEDML*WFCNQYIYIYVRFSAKIAIMKLNLHAKSLLKLERRQINLRNMNWCEAA
YV*QNKQA*TPMSNTIFSPVYACNYPSVLCLFFSFDQTIEKTLVVGHDKSCDVPSHLVS*
ILLYNIN*TNVRKKKNSIKSTNPYLVKFIRK*NLSGRER*RPAKFVDWFSQL*RIERHTH
TQRNIFIQISLVRQCSQA*ICNFCLNLRNRIWYVSGNKFNVHIRTCLRL*SGFSSHLQIA
VNVLKK*SSCALPVVSRQNKRIFSGKIPD*HSIACT*TRSCVICDVSAANKPAVAQSNTS
DKVLRLQDVYRSSCCKRFLGVAQIKFGVLDGLGSQKCVDITFPTRCYLGKFDSCI*PVLV
RPTLR*RHSLLPVIKPSFYASLDGAFCHALLRLQSKIHTIFRGC*NIQREGVGVKKVPIE
*AIDISRYIVEKS*CHRR*FLTLSSSCNSFTRE*NRRAPSSLFFLFFLFHFCNWKREKRK
GIAKGAFNHVRQISIWLKNAEAQSQHRKRTKLLNAENYEQILQCVISAESVIRLIC*AGR
TLLE*EISSR*KRVFASYGAALATPLLEQATS*LGCRSE*L*SVLIPFMVYWVI*KNE*D
KISNKVEDNLLSKITHTAAHL*P*SRMNIYTSPTRTPNIAPKSGQRPSLPMLATDERSTD
KESPNEDREFVPCSSLDVRRIYPKGPLLVLPEKIYLYSEPTVKELLPFDVVINVAEEAND
LRMQVPAVEYHHYRWEHDSQIALDLPSLTSIIHAATTKREKILIHCQCGLSRSATLIIAY
IMKYHNLSLRHSYDLLKSRADKINPSIGLIFQLMEWEVALNAKTNVQANSYRKVP*ERKK
KKI*HSMRLY*GARCSFFLLYFINNSVFLRFVSCSVLSF*FLLLRAFSKSRLRK*LVLRR
TRFGFGRVLVRSSQYNLRIYCTVHTSLFRVTSFLVMLNQCVY*ENYVVSYTKQQRILLYV
TEKNCCRDS*QYE*DYYKTAAKEKVPEQLSFKREHETGGAGKDF*TRNIRRGRYCRQA*T
KGNTVGRSK**VSRKCCIVSLTDYKRSSSHPK*PECKGIRRPGP*E*CEFTRRRG*WGQP
SGRCS*NE*KNKPSNTSENFVIIIITQCT*C*YPKPSTFFERPTSSDVERTKKENC**FH
RRRGFGSC*RRGFK**GT*KKYNRTRKCGKRYRV*RLR*GHRRCGKR*SHGTQLTNKTWS
SQTG*R*PT*CNNKFHV**RIRF*IIRYR**QEYCFIQ*PI*RRFFTCERDKQQPFKYEF
FTSTKSKKGFCLQE****QEFSYSCFQAPQTEEGHI*GFWW*NKTTDCL*QGQI*CSQKD
D*RRRLRY**PRQCW*YSIA*SGVARSY*DCGTVDRKWCRCKYQVY*NVRRYSLDRCFRQ
WTLGCCQVSS*KRCGPNYT*R*RVNCV*ICR**I*I***RRPKDFA*NKKKVEYSR*KMD
*QSRNS**QI*KWQ*CSHNRSATF**YHKSQKRKGR*LTFNGFQY**ESSGRGILLDRCY
F*SGKRKTV*SFEGGTFTIRWYVCRKWW*DRLKVIFRKR*VWP*RYYKYLFGIRISRKSN
FKG**NIRFNGSCRSWPSWNC*TAIRGRCRSNQKR*KGSYRFVLCQKQHNGNNKQ*RNSI
D*KCYK*LFEEAL*R*************NI*T*KKERENAITHISKPKKCHS*N*RRRGR
YEDAQSGRR*L**RS*CQGIYNFGFAQEIG*Q*KCWYSILIGLEKT*NKCLAR*RKIKKY
LTTLYGTSFSKEGKICRDK*NT*RNGC*KRSKTQGRGRIQKEKIRKEKKKRTGTTTKAGR
R*EKKDRRTGEAESLRNGKIGKSYFRESKKNGKGKRNGRNLL*KGSKGLISVRTEDY*LQ
R*T*LQKIFAAILFCRRKKR*ICARLASNDIVEGYRLALKGQPTNF*EDSRRSLAPDSIV
EYVEIHFPVWR*L***KEQHGK*KICCKL*WG*FGHKDWV*AFGVQKIC*FAHGVD*MG*
RCY*KPRKKKRN*RKYDSNINKRICTMEKR*AEQSAAADAQTAFSKNTSRVTG*ISTPYE
HILRPPADIQRTILVKQFIGPLAYAHT*LHFRFIKYYSC*HNSI*SYCFVIIISA*HSPI
SFFDFVLFDKATNEYSKKCHGPLKITEGFRKYRAKDEKRRISFDLYFINDCCIKQ*TNYF
NLIFFAGNFHNGITPHIHCKEHV*QTLIFVLSFKRYPFTNIRGVQAQVLQCCVLLLLKGH
G*LGQDLFKQRPFRRQH*QICPKDGKICQT*NRKRLQII*QNVKSFHGKLSITRKSKQLG
TYPTASGDLEDLYTEKAMLHL*LKEYF*G*ESHLGSLV**DY*PILKLQRL*TGNGS*NQ
TSI*SQKMPILGEVILKFNLNK*TRKIKLFRIFRVWGISRLFSYIRIWS*FSRLIT*FLV
PSSANIIHCYFEEEKK*SWKIGKKKSPI*KIKMFKSSILWGGKGQSEPKCCVAKICHFPS
ALLPMTLMMMSLLLNLKHSLKAAKKTKIPLLTSIH*IRISCRKLELCSQMWKT*EQYWKV
LRMLD*HLKSSNLRYIENH*SRGNYSMSNIS*C*RQMPNPTTTPRNWTFY*VILLKI*ER
TSMKVG*NHGSALMI*LICCQRTLIE*ATISTRLSK*AVVRHYPQSFFSDLLFYGMIEVK
V*SLF*LTIMPVY*D*LPYRIWL*HGLKRF*QRNNGTPYRKTNVKIFQ*IMRNCFLPQSC
*LPFTTMYKAGISASLLYQDRGDVNLVI*SMKYSQVAKKSFHYPQKQFINLTICPL*RKQ
YLTYTIYHKPMSKLT*PQRIFILESVVASLNLKLIWTTK*TPNIYQFILKGLKLTLA*KG
RLYALKQIKLSDS*YNLFQLHFLKLIHKSFTVSFIYNMDENRKEI*K*KLK*LFNIHNII
GKQKCNQQKYTVSFYH*FPFSLIC*FWLS*FVRILCNFRYSKSYPPLRC*KPIVLALQLP
*QMHG*RARSKRHP*QYTMIGK**HHHGFSIG**CFLLFD*IQNFQQQVFPVCQLECQRY
PVFQTHRILALVQRHHPSTKTIRYHYLSSIDRIFQTTKR*H*LVEAKQLCQ*LHHLQFAL
VTQPHQPYHAANKHQGRCF*LDISKVMILSCSRPRRDGHLGQYQI*MPYA*LKNALTMGT
FSNWHITSMGPPLQCWTPLFPSCTWLRYLARIC*SILLHRPNWNSMLSPPPSSCKTTL*L
IGQQMRRLLPTIPWLA*PML*FLFYVDYYSEIKVPLLEHNNSQP*WIHQR*LRISMIDLL
AWWKMHINQMIY*RSDHRIYSFSNLWNHGLSLRFPYRNPWKCAWQTQWKI*QYHLGSCLK
NQDRNAFDQQ*NDSNSIVMQRPYNLQKPKINRQ*SVL*NNRW*NSYKMSLDRKVVVQFPW
MY*QHHFHFSFVIFLCLSWAKYLTQQLFYHQRHQLNDKRISKRGPVRNL*LN*IGRFEES
WSIKFQCFVCRPLRTQP*SLVWARKALPGRQYPSC*FDRRTLHCFQNPMGF*SSEWRCLH
IRWKFWFFHHGLEWNQDFAKGC*W*WPVTHS**RTGRHRSGNSKWLEVVVLEYIPLGPYI
PSQHI*FHFCRIYSLGRLDRSGPFA*ERHWPDDKSYISIFCLAR*K*QKGSCKNDNDDNG
Q*VHLHSMEAGRYRRTSVGMV**QAQMEV*TSSAGSCS*ERRSRST*YNLETHWTIQKEL
TSFLEE*PTVGEARSDR*LEEAIPSTDRLDTTGSWASCFGPLRR*VGHTQALPLVVAVAA
KVCPFAREPVAAYKR*DRLAVRCADAYRSWKWWPDQFAGVTVLEQGLGIVAAPWKGLHPV
AAFPSDHSSFQLQQDPAEA*IVLAVVEGWHFVHTGAELVGKHVSCDETFCRWSQTYIFMS
VSMRQKWT*VPDKTFL*CYFWPVS*CTILLT*FCFSSFSFFQFSFSSAVNGKNKKKKKRT
AKR*QICSSGHVQDCFSSPDSA*IDCIKLKNL*QWLVQNAHLSVLCIFVTRFYHPNIALI
TFLLPGILGGNLLKFSIN*LRNLFF*EHDVVYKYRSP*EQSGFLRFQKFMCLGAVNSLDL
FLVWTFKSSGRRKIERKRKFKRSSSFFLLLDRIQ*KKKKEVVVRRERNKW*ARRILIYST
*ERTSKSFLLVLSCTENAISKMVRRPFKCSIHNCLQLLTPYIISSSRPL*Y*LLVRTS*P
LLQTLTPLGQSYVTTHH*RRTLPYTCV*SWPRIRLYSLTLLENRRTERAGMASNWQSRS*
DLGPDSCKRTRTSKC*ETVWEIGRFPLLKNLPGTRCSNGLL*ETPSKYM*FVRKRR*RKS
RTLT*LNRIPKGKTPAPFLG*PWTPLKVTADPSPITKSLFRQLVCF*TPTGMVS*LEATP
HWVGVTTALSSPFLGRTGFTHGLLVSSNWCLILLMRQDPPPVKSPTTVMSVVLTGNV*LS
RWEHLCMRLVTYWVVLIRKAVLC*EAIPL*IGLS*LKRLIL*ELIQLVLVLPSSPRKNVP
GTVSIR*DFCTTPLSLYHRIITIHRS*DLQNWADTPI*NTLYILWVTAVAAYYRPQESI*
LKLYVMIWPGAILNTCRFP*VDRGLNGKL**H*MIYVPGCPRMNSPSLAIPSN*KFFLLM
HRKPSSTSSHLC*MFSH*TCRNMGFLKMFKVSNHHFMVAATVVMLSASSLLMLD*SLL*E
YTMAMH*MV*GFITRKNQLEQRMLPHPSPLYHQEIISQKLHIVSKIMLQ*TKKI*KVYSL
DMKHKILRMLH*NRVK*SLGLI*GAELGLMLSKL*RVMGE*PTCLVTKTEVGSLNCSHLM
ANIS*V*LAESVNGSTPSELFTELYSN*SRFFFSYFFLFHNLVISKYIY*IIFHIYVDIL
HLHNSLGKRKTVIEKYKQKTATLHDCVEQYTLKKKKKGWFYHFISLFE*FIKYF*FFFFF
FFFILF*T*LWLRFMVFALISSLSLLSALLG*SFPCNRKLLFFNMDNFSSTLSISKICLG
VAADFFTLGTLEAALLLLAKRGFTLF*FGTTLGRCIEIEVPPPSKMLLEVLVAISGADNG
ILESPFSFLMLKLLPMRVVLLLPV*ALTLFLGCSDNSLWDEDAEVGLDLFLDKKSLAKLL
LALGGAVGITEYLLSL*TRPTSFTLVVFKSVCGTLENESDASSYSHNDQVIPYGFGSRQY
TQCNGTSKLAIIPILKFIK*PNKALATTRCVIIRTLSSILSSSVITGLSLLITSIYDSPP
IPGYLYLNLSFCLFSNSSGKLFLISGYVIPS*SPALNSSNIFICLIG*SSSLKY*AVPIV
LARMLVQTKKSL*MFPSVFSLFFFCCMRF**NISLCLAMNFGRLLANLRPRGVKWEFPPI
RPLTLSSLSPLLVIQICLSAKLKFNK*YTVCEAKNP*ILYAMTFFPTSIILMYCKFSSSS
IGS*AFK*FARRLLKSFKELSGSLPL*SGPNNLSLIFFCTSA*SEQTDSKNKTFK*GLLF
LILARTFFLLSREVFVASKIPTDPEPSNK*SSNSSRVSMAHLSLNLVESAFFGSKNFESW
SFRPCSLANFLLVLPTLNTLQ*YKE*FKNLDNLFVINDFPVAGSPTMTITNFDPLSSFDM
RPSGDVLDFVKPGTSMVVGLLLWCLVGDLMSFKSIRVTSFAPSEGGM*SVVSFVGILAFF
SCVSSLICNRCSDFKLVALFSGESEGVFSSVIPGEFQLLDIGVSLKGLF*KSGKCLDNSS
CGPFSASILSSELRDKRS*LES*LGATWCGDCVGARSISGGTGDVSEKSTGLNMSFYSSC
LCSLE*TLLLRLLLLFLLF*LMAQKYTNRY*KAKFISLDLPVTEYLSLSIYIYVYLLLLK
KEYANKIYNK*SMYSTIN*FAIVSNGAIKNK*EKKSLLKKSYVP*FPYVVILVFRDDHVI
*T*LLLSVGYPTRII*QIRSIKRRVILLPKMEISKR*KNYNYSFGNITDLKEP*LSPFEL
YRYFFSLFERKPVFLLVSSTKFS*FNKDFNFHVFSTKFVCCYFLFYFKYYCSSFINKLGM
SYLLKAVI*VPAKQ*DLLEVSSGILPMQLIMQALYRLLRQLPITILLTAIIIMPILLTIE
QILQTIQ*TDIMKATMEGCLPSSLRQRGTPLRLNNYKM*RTLTIHHRIRSRFYNRKQVRQ
LQHIKTSSKLWR*HWGLRESLTKL*SYRVVRMRMNG*RFIAWIFTIRLICYTGPSQNFAP
HKHARG**RRTNMNIFGHFKRVSPPFR*VPLSMWNV**GGVKTNLMTNLFFLPKSPVPSR
RDSSNE*FNQF*GDYSEFMRIFTVIILMKFLN*IYKPY*TQVLDIFVFLHKSSNY*DRLI
LVRC*N**WS*GIGSIVYLYKSACRLYSSMHGTQKQKYGNILI*HMDGRK*KHSSLLYLY
L*FEIVYWSLNINIGNLIL*FRIISIR**RHGCIRICLIVQFWCYRGPHIITIYIIVFII
FYHCAIGITQLILINAGMVIG*LGFPI*IQV*FLCYEFILVLYIRSRC*DLQIIKPRHH*
FIRIGFKNPIVTTTNYAVLLSMQHKLSIRTSRIW**CTVFPGMFRHSTFT*C*RHHWY*I
FFSVRGLEFM*KVRCQHIIPF*IGF*KF*SSF*KP*FDFISQRIELVFVNDFFECPHR*I
RQ*KVGIP*NEVIPFKLWVNVEKSRI*FGYQYIENQLCFLSQ*SGIYC*RVLNFHNYNFF
*FSA*SL*IIKSFMQKVFLLKLLFNLSIKRQLG*EWILFWH*IARIL*RLLKLLHGLFCL
L*LFGTRIFEIRLQ*FYFLYLDY*ISPQVFQTRNNIIGQFP*CLRRAGC*GFMILVQNCW
*VLYRAITQWQKKLLY*FILLRAWLVLILDRKEWELYSM**S*LLSNNFILNRSDFC*VN
DHRLDDISPS*KPRCKNICWLRSCRDQYY*WRSRILLLLLLLSKSLTL*GRPSPRQY*SV
G*RVFPLELFPVVIIGIWDSNGYIGVRVDIRRTIAYDTLQPSRIHRQRPIVLKR*ITSGR
NWLSIQIALLVYIGCQTAILKACALLLLLLLLLLLLLLLLLLL*NVGMIC*SHTSRMLLQ
VMQVLKI*LLL*QHIRDRRGHCVVFRHFFFF*CCILLLLTTFFL*KASKEDDQMQI*EHS
NRLYQFKGSTDVLVVFPPPSLDRCHSSRLESLLPSSMEYVMP*GEKPREEKGNPILGPCR
NVNQYILYLMQ*STLNIQMIFIVGSAAALGIQTLPKFPSLLYLVSPTQVRQFVR*TMQYI
QIQYPAWKVTLALFSFPRPDFL*RSHYPEK*TTQSDHPRELCRRRSKHHGNEMFHECPKA
PL*LVSYHLVEYNIRMSTLSLLGHSFYVVDNSGLS*YL**LQS**ESCLY*PLIFLSYRL
AVRSPVLIVGLRMIFEGTIFPWSKHSLWYEYLRFRSVQTHN*KER*V**HKVVLYLPRDK
TSWVNCPASVFVPRQ*TQLA*PDLGSYCLCTIAGIALRSKV*TSVVL*CR*FPSLPRYRI
YVSYTRKHSTQDQTSNFLFLTFQ*LYRSRQCVQDRLIH*YRSRCLSTLI*LYHISYQTHI
LSSIFHYWCWNPSFALSPN*TPLPFDQ*SSHHL*YYSTRHQFRPLE*GAFGFFSHQYFLL
MHRHLQDRLA*PTTLSVGPNLRNIHFYSVWLLLH*CIHLWNRIER*TSHHRLIREEILIL
NSKGISEK*SYFLG*LSLNPLH*T*YYL*IF*EI*IPHPVL*RILVLSL*FRSDGRL*QV
FFFCES*YYSEHLTLNI*YSKFFS*FLRCDGDEKKNM****QSNKISEIS*TICCEF*G*
SDSLKHFFFVMSGSTESKKQPRRRFIGRKSGNSNNDKLTTVAENGNEIIHKQKSRIALGR
SVNHVPEDILNDKELNEAIKLLPSNYNFEIHKTVWNIRKYNAKRIALQMPEGLLIYSLII
SDILEQFCGVETLVMGDVSYGACCIDDFTARALDCDFIVHYAHSCLVPIDVTKIKVLYVF
VTINIQEDHIIKTLQKNFPKGSRIATFGTIQFNPAVHSVRDKLLNDEEHMLYIIPPQIKP
LSRGEVLGCTSERLDKEQYDAMVFIGDGRFHLESAMIHNPEIPAFKYDPYNRKFTREGYD
QKQLVEVRAEAIEVARKGKVFGLILGALGRQGNLNTVKNLEKNLIAAGKTVVKIILSEVF
PQKLAMFDQIDVFVQVACPRLSIDWGYAFNKPLLTPYEASVLLKKDVMFSEKYYPMDYYE
AKGYGRGETPKHAIE*FK*FLLSLVFLLHMYK*LVSYSSEHLFYCLNVFDGLQAKLNCLK
FKTMPSNLISLLVKPIFILVSQANPNDIVKFFTEFAKHISMDFCMETVMRNPGFLIEERS
DSSLLRLRLNFFLFIAAYKQYT*NRTS*SKPDQQ*EDGQENCNIARNGEE*THNWIGVLD
LEDRQERPYDIISKKKANNYKTVHETKQTFTMPNR*LFTFLS*YCI*STRSHQQFLCISF
KYIPLHGNASGNECKAEKLSVRNYSFRH*IKL*PHSIIWVRFYENVVISVSCWVLRYSAA
WFSFHT*FLLLHHSI*VGYG*ICFYRGTLMNINNSIPSKKYFRYNDFEN*ELTVASGHHI
EFSIFHPNVEAGCR*RCAGPLTGPCLTAIAPHACHICMSHISPNCLVEFSQ*ESNVFKSH
SIDEQLTRISLFDLDNSLSKRWQNSCSE*WSAIKFAFFAYGCSDILLLE**SIVY*LMFS
YVLLLPS*NK*P*IFITTF*CSSFSVKKEQDCGRIVPFSSANVRLCHYLRML*TYCVAFS
KVPAGWVATNSSVWPSIADAFKP*SPAIGLVV*EVKQ*PGVNSSQFINKLAEPLLIIVVI
LQEYFISISTSSRKEFFKQ**TSNRFNFLNFSTFSI*LGSLITIIQDMRKPPTDYRSSRV
RITVTVILDK*YSLMKSTEPTSTSFYGQVGKAPH**CGDHRFKSDWKQFFSSARHTPCNE
CTNSLFKKIIVCFMFCLEKHIVRIFLKNFEIICKLCKKIKEPL*KNITKNVTDDIFIVLS
LF*I*NCSVNCSPLAKKRCPYWYLYYELVVGFVAYKLR*HISKNDSDHHHKVEGKWEEQA
RLVKRGRCSVLETGTEKELGECGRKYSLAAAVATRAGLVGVKSIFAVVYRYFPDMNTGDR
GCCRRMLGLTKFAPLDLLALLEKKFERCMWTTFAFCCFF**SSCHLRKGPSFLQMSRMRA
RRPQ*QVSALWNGTWK*IFVLAWVWASA*VLPLQ*T*NWYLY*QQQ*QQ*QHLHQW*N*Q
M*RFDEPNTTIRNLWGNLDQK*APESI*SENKTAGIATLRFPSATKYPEF*CNHLLFFS*
NLPDLSWASLFGQDQVH*SGSLCKTGK*GPAVRA*CCSNENRCNCLPALKK*MKKTHWRP
RR*TLWMSVSLAAKRWRTTTVRLKIPQK*TNCDCKSKKIEFSRIQPCKRTAVG*WKRCHL
WASL*APS*HPDTAARCPS*THSRSHATILRSC*G**ACH*SDYGPFWST*TADSLSARR
WHFHAMLLTEPSFLAWWVMLRLVFC*TGKVV*SYPSEYFYRADARRSEEWRS*RAAIATF
VRGLGSELFVGWETGTRSSSERSAPPPLPRSLRPEH***SLDV*TAQQWRIYS*PF*Y*V
RR*NWPAASPYPVR*RGRDADSRPGGCPLSVPCHC*C*KRDISCWRRCL**GILSLPLCG
EKNWMRTENEQVKTLVHE**IYICMYIYVEVCTHVHAQATDATRPGIHICTYIYAHIYIY
IYVYVNVYIQLVISRAEWAEKHSIVEKKREEKGRGAIAMDVVEYREGQAVVQWMRFEAQR
KGGASKHRTLSAETGIRGEGE*GKSGKSGQSNTHS*HSYKVLLTCLHVWSHKLGDSGTEA
RVLFWFPVSSCAFRIFSHLLALDPLSVLLHKKSYIYNIVIIVD*SKISNK*QQQNGKTKD
VL*QITRHAQRRIRVCLGAREHYYIRI*LWQGHSRSKLRRCIFKQRPFASAAAGCSLDEW
DSGIRFKRRLGQ*CAGGMAPGTEKSFHRKNI*KYWAQRRVSVYFAWGRDCVTIANASRLL
LPMDKGQRVDDKQYCLSFCGPGNRDVIAVPERFIPLAKKQQHIGRWHWLH*RYSGFGRP*
VERRQHGFHGRLGSSSKRWACSSKHCHLKNHRLHQAIWH*SGGQVPIPVHRRYL**YCTL
GPEVHY*PLEFFRI*SMGGSQWHAFLYFTGTTVCSGQVAVVF*RLRTVVSLC*RIASDTP
GHLQVFSGPCEWVYQRQVQLYCWDTHDCRHIEIRTGHIHFISCEHRPRCAICFPSSVRYQ
*PCRPEHVAPFDVAHAFDIPHQR*LQKCNGYCPGPVS*GRI*WIWLWRGKSLGPGHVYRF
NNALSAHLQTHL*AA*LGCPNEQRLFERILERAGILQPHDFGK*RRLFDFGVQYTCLQSN
HTKNLPTS*FILGQAESSRGNRRGTK*TI*QIHRVYAGCPTPYLVLYFILGCLSNKTRSF
TEFVDKKKNKRKARSIHKCIS*IFTSNIYIYLFTKL*YYKLIRYYVGTSSPTTFAVLFTF
SSCVNLLPGLYLSTSSSYSLWLSKNLMMSKACSNISSTFCPWATFFSHFISFCNMERNDL
ESAINKFKDLSLTGSSFFHFSNCLLMFSCESL*FCFLAYSNFVIIAFRRLPQLTILLGLS
YFRMALMSPLYVRNVLGLSISLALSLSLSFQLFVIHLSLQMKL*CNLRYSLFAKAKRRGW
LNLQFHT*NRENDYKL*ESR*AMAEKSIFNEPDVDFHLKLNQQLFHIPYELLSKRIKHTQ
AVINKETKSLHEHTAALNQIFEHNDVEHDELALAKITEMIRKVDHIERFLNTQIKSYCQI
LNRIKKRLEFFHELKDIKSQNSGTSHNGNNEGTRTKLIQWYQSYTNILIGDYLTRNNPIK
YNSETKDHWNSGVVFLKQSQLDDLIDYDVLLEANRISTSLLHERNLLPLISWINENKKTL
TKKSSILEFQARLQEYIELLKVDNYTDAIVCFQRFLLPFVKSNFTDLKLASGLLIFIKYC
NDQKPTSSTSSGFDTEEIKSQSLPMKKDRIFQHFFHKSLPRITSKPAVNTTDYDKSSLIN
LQSGDFERYLNLLDDQRWSVLNDLFLSDFYSMYGISQNDPLLIYLSLGISSLKTRDCLHP
SDDENGNQETETATTAEKEVEDLQLFTLHSLKRKNCPVCSETFKPITQALPFAHHIQSQL
FENPILLPNGNVYDSKKLKKLAKTLKKQNLISLNPGQIMDPVDMKIFCESDSIKMYPT*N
SFKLYAFFYIKICPTFTTILQILTLYKN*GK*KFFHQHGDILPSVLSLNQNLCLFCFYGY
VLNYSRHIY*RCRT*HHVLSQVL*YLVRYSFSGDDILENFPIGICSICSELVHFFWLKV*
FAMNHRALHRKGTV*CYHNLRRSIF*PGEYPH*DHSLAYNEEYHFEFSCL*D*IIVRNFG
KS*KLSPDAL*YFFLDP*YLFHYGEN*KLYFVKVCYPNDDR*AC*LF*TKYYFWKF*SSL
RAS*RQSGKISEYLDLLSTGNFPQKYADISISAHSQNYRNLL*LNCHFQYSFVQQWIWQK
KNLLHHIASKFHPSQRA*PSLD*VFGILGFSSRFCY*RSNFSFLVHVFAYFQYSSLISLW
PCALIMHLLGLYSQSYPSISWPLIILGYDWC*SMILTLLNVVRLQ*I*VMEGFLLSSSHR
QFFSFFFFFSE*FTFFLQEKNMGASLKY*NH**Y*CT*SNNKINYDFCYY*FRRKKKLTS
KKS*K*VVSSGIEPLIPALLARCLNQLGQETRNLLKYFM*I*Y*Y**RFPIYMIALNYFI
SSKCQCR*FALAVTIYS**RFLKKTVIITRQAYAERRSWKKKNIEQYI*ETLKKSPSRQV
TGST*T*VSSLIQVEFPLWDSLLSSAKKIFFD*SVDQDYL*PPIFS*TDPKTMNTPQISL
YEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIVPHKQGLNT
LRAEVDAMKLLRNNKHVVSYIDSHAARSVNGIAYEVFVLMEFCERGGLIDFMNTRLQNRL
QESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPR
NTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKICYYTTPFEKS
GEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQNKPCPIRNF
YLLRAMNQNANTQLAGEPSSTTYVPTQKFIPVQSLQSINQPPNMMPVTHVSTTPNLGTFP
ISINDNNKTEVTAHAGLQVGSHSNLTSPLMKTKSVPLSDEFASLYYKELHPFQKSQTFKS
VESFQSPQRKSMPPLSLTPVNNDIFDRVSAINRPNNYVDSETQTIDNMAVPNLKLSPTIT
SKSLSSTKEIAAPDNINGSKIVRSLSSKLKKVITGESRGNSPIKSRQNTGDSIRSAFGKL
RHGFTGNSVNNSRSASFDNNNVNGNGNNTNRRLVSSSTSSFPKFNSDTKRKEESDKNQRL
EKRRSMPPSILSDFDQHERNNSRTGSRDYYRSHSPVKKTQASAKTTSKPTLIPDNGNVNI
NQEKKESIQRRVHNLLKSSDDPVTYKSASGYGKYTDIGTETSNRHSSVRITPITEEKFKK
TLKDGVLDIKTKSNGKDKSRPPRPPPKPLHLRTEIQKIRNFSRLQSKKLPIERISSEATE
TIVDVNVDDLEADFRKRFPSKV*NLLSHIIDYVILKVIQNVQIFFRQSFEIF*NISCHSF
IYLFVSIFLLYAL*SRQNVVNDLLSRSLTT*IWCLDRTLS*VSINSLVDILGSFVVAQEF
QHQSSRSYSGDWVSNTFTSNIWCRTMAWFTNDNFWTYVGAWNNT**TD*SSSTVR*YIPV
*VWCHYHIKTLWFSEQPINHGIHNLFVIFDLTVLVLVRFVDFLTDFSE*TITLR*NI*FM
SHCQSGLASCL*SFQGNI*CNGCNSSCCNFGYSLCGISNSCTCGLVNVCFFNFNVQVLSI
FSDDNHVNWFTLFSLYRLNRTNISEKAHFPP*SNNW*GVTFHLSSWRLNCTEKSTLTLFL
QHFNSLIRQRLSCFLECLETGVEINKVEA*AVLGVKVFQNLLTSRNDFLTDTVTGDKTNS
E*FASSVRC*PTAGR*SSSNRSKHLFECVTILVI*ICRTNIIIA*IQS*LILNQLRCPYI
TVEPV*FLVVLSSN*SHLKNIFPREKSEKKKKKKKKEWEFSVQLKKSRWNLRTTIT*HYM
CCSRLFLIIYRLVR*RWRKEAAHLEVEVLGSGGFFFLRRIQCSVVLPRPCRVTCPCCH*F
SFFNYLLFPDV*DLLFLLYTMFNGRNSKEGSEHLRFFQSHLLLCFFLHSQRIEFISGMVI
CFDHVPILLRFD*VHSSLDNTFTIEWSSYLKHMAPIVVFITNFVFH*NLRSRQLPWMLFV
KERSEPILNVC*FRWPVQPFHAHPFVARVGSCLVKSLIVGMRLFCYVNKFSYDVSIGRIL
KTRFTCKLG*WWDRRYNVVPRRCFFQQS*FQVSGRPLKDVYSICLYLHFSEF*DLLLEWC
AMSFFLFQASNEVIFLDFCAVSKYYWFYCL*LALFCNCRSIKEISTLKEDAQE*RPNEKC
HKKAVY*LSWVRVLVQQILFA*WCK*DPKTWHTSRELITIVIQ*LMEIPCRREARRDTVD
VERGAKLCP*RVIIFVLQDRLMTMNKRSKC*IK*VI*KNSVLKTVMITIYSSNGPMILQI
SYLDYAVQERF*NFL*ALHYPAGLRHGLILQRRESMTM**RLTVLKNFLLYYQKNLMEQD
L*EGKFLRNY*RCPLILRSH*KHLPINRDV*LHIICLLVLRWIYSSQNWSHSCKSNWKIV
HSQ*L*I*HY**LPVNLRREHLIIKNTGIKIRGIPTFVLQRVRILLSLANYRILKL*VRI
RLLKRVIRKITLIRTVNTYPILNVGNKMNLECGSFLSWMRKRIFLHLGMFLPMHTHQKMD
TPI*AISIRILKTVNLNNVQWSQYRF*IAAVWLQAQLILT*LMMKF*ARRRKLQLMMNVW
METHVL*MRGAAPSRKTHYNL*HQIYFKKTLKFRAQRSGAF*IVVYRIASPQQSICFRPQ
ALRQLVIQ*KKMKSARVARLKILPSLIRS*QTKRRKS*IHQKASKALECLWK*IG*AVSR
ASEIFQETFTKTAKCLI*KLESATHCITLLCARGVHILMTVLLIIYHRMKP*MRLSDHLQ
ALIVFNVLLGPRG*TQRPIKQLVQQKAKI*KLRAESSLK**TLFL*TQRTRKKAIKSICE
**YSSLCTLYIVAVLIFI*IHKFPFVHAIIQLLFSSPQFFRVKDHQACYKCI*QWICLNR
YYLERRSYQ*I*QLHCKIQDCLEAYKKRRS*HP*FHNVYNGAVFPYTT*LLDAPVETMTY
LH*AVFG*STHLYPQIKSSSSLSCSF*YE*NQCNQECKSVFRLHTRWI*QYQE**HL*KI
*ICSQALQ*SNSQ*CQIFERFA*FSNRIAQYWSFLILLPCDSSIFLPCYGIYH*LMN*PL
ARCIL*IPLSV*RA*LVH*CTTSEFC*SQLHVVDPGFC*DGQRW*KYEICSGILLNVIDQ
SPSTLLRTKNRPASFFYLYFLRSFEYPMANIQ*CQTGKNCYKVL*PFL*I*DRQQKNRWC
SP*ICVGKILVWTLEVRSRHGIGRRTFPSCQPDLYQILKLSYLQRGTPPL**GLQLTLLV
L*NLDLGVQCLGYPVIFDYFSRFYLLSCRCDSKHAKHINLCTRLRPFRRSHTRIICLYTE
TWGLLIFFAKQSMDQFFYPIVHFALLAFVSKSMNI*MMTCTDFPPMLPHQLLPV*HIYMI
HCHLVSPLRICILHFWS*KHSTTYQRISPELG*NETRKDLAHLHCLYLFRLHCCHRRYHP
RDYPKGHSLSPIDHPLVHVLYFRAHPPQLRQELCYSRQPLAFFFLALDVQI*ESSIKRHK
LFPFYPLHPQYRNHRHCRHRTLHPHRIYGQYLLLRPLMFLCFRLQFWQKIF*SSSVLVFL
FSDSHGNYHSFPSQNCHSLQFGHFAIIPPSH*TNAVYSLYYIIAKYAMS*IIVVLRRKNF
SDHGTRGIASA*SEARDWSGYWFRRDD**EDEHR*RIEV**YWKGCA*SVGGSYSIREAS
FSVLLPSAHRVIA*IY*RGAVCGRSR*RLGNDDQFVQKLHAEWTNLRSMFLSVIHTTFNS
NLV*SWWFGMRAFLHGDTVHFIFHNYDS*RVGKTTWRKTIHFFYQLSVLLTTFYHCIFAI
PVFVWIF***VGKRSEK*I**VGVVPGSFEK*LEFQSN*LRLILLLLSICCTTVAIRAYQ
VHTFFYSIGRFFHYFSHSGRRGN**MVIK*LEFKHVDYFLIVNLRRCDYRIAVLFVSDLC
HPHMAVIHPNGVLIRTCFVYGMWTGVVWYCESKRIRHRELFIFCVYCSLYL*NFPQISYY
RD**NFKFVQRRLAETSKKSAHS*QSFVLLS*CHIEKCRGVMGVLYS*RKKENR*FS**T
H*HSIIRKSILDI*TILEIFQEFHL*CSAIH**ILSSYN*DGKRISFPSYSNQFML*SSD
VLLGNEDYSSITKKK*QTVAQESQDHEGIVLVQSLHINCYVYSPDFTIFR*AKERPVHMG
LQ*KVVWRRSTRNYSRFMGILELVQHFLYYFGIRYRINRFW*LKLMHCQKSRITSFAKYA
KTKRKVKYQLTYN*VIDDICFKCHS*TIFTFG*FLFLLLFALVPCTFIVKIPYAHHYFLI
NTMNILTHTLICRHINI*IYNISLKYYFYYVVDFNLKPMQIILDNFISVFFFLFC*FPRT
LFLLLSQR*EVLKMIFILGLLFFPS*KSE**EESILKFGNATYEGIGIECRNRPN*STPI
*IFYNG*KIIKSCRYRLYS*HISNSAIASFKEAASKSCKVFEGTTCL*FDITVYFCYAPT
PTARRW*LWEALLQKENKTVLEIFVLSL*CKRSPPQVVQIQTFTPMSRNVLFWGLFVGKD
**VL*N*SDC*SKQTLRAILLAT*CNS*YEVIRLLRGPFRIT*CAS*CV*GFFCKQIIVR
R*RGLTTVVFSIVS*IWIAFNCD*NKNGLLHTV*RSIFSCHYHI*SSENEADYNIG*ID*
KC**SPEADA*RLTL*WESG*QGIKTQREIIIKNDMNY*RFLISCLETQVNLQIIM*IAF
F*KQIYGYIGYTVSSPR*YRKP*QNI*LYVIVDN*RLKISINEEVSTDLLILNKRGI*NT
RRLVILIMTNIIVIPVVTIH*CDDSYSSYMYLP*HVQLIGL*HSFSIV*ASRLTFLLQ*A
QSHLNVYELYINIRCKH*IVTIATHVTINYSRSNSNYRGY*YGLLICSQLSMNSN*KAVI
IRDKYCIFLWYIREKWVNFEIIVGIPLLIKAIILCIQYIY*KFSSRI*ESSKWNLYFYIL
ILRLFLIPFYSLFRFICFIILLHYQSLHFSFLQLQ*QLLITCVTI*HRI**YIDSVTTS*
*MMVDFYSNRFLFLQFSGHIYINKDHSYLLIW*HVFLFKSS*SNPM*CNGYHITFSPWRP
GFDSPLRSYFLFFFF*GLFRQYFYH*SA*SHIL*ACSIFSGIFIV*QGNTFL*VP*NKVL
N*SMIALSIKL*VCCL*FYLLFTIYCFILLLHDYWSI*ASSERLNTVTYNDKNITDSP*K
TSNKLHLL*NLSFGGIIFPIAKESKPINL*PNNPGKVNEIDVEPVAPTNERTSANDWTDN
AKVYMLISNNAVIQ*NLDLTNGA*CSLSPATAIVPLSSLLFS*LSIEPLSKFPLGSKHSC
SL*EVASSASLGWAGSSTVMLIGLRLEARVYSETCGSSSGFAPP*VISIQMMTLLTAMRS
G*KRSGKERINIEPRQNLPITIQIELGS*FNIKLPKVSLPKVKYPDKPTIKNSAVDKDIE
LLITKVIFSMLLSFNSFIMGNRFIDPVKAKIIMLKVDNNPLKS*IFHQHMSFLNIFVNSP
FPSSNTK*LNTRIDMYASAKRPRILEYFN*SSFFTKHRGMMITADAIIQ*FLSPPNSPGK
RSPIRTK*LKPTPKH*TIIAKSKIGAKVG*VSMHNVKKEEFLGLIKVLEHFDSTKRPRPD
VTAANNVRITPTRTPSLLKLYGMASVPAPTIVLTRFAVDERALDVASIP*NSFSL*CYVL
IVEFAFPLTLVLGVLSI*GSNLTSDEEVMNV**EVKDVEANPFMLSHVVHTDNTEDTKLN
IKTLIDVSITGIR*QGTVGHKGLRWPMKPRIAPTAKFFHILTH*RTSCPLQSNIRRTM*Q
*SQPHFPSRCHRSCMHL*LAL*KRKGRF**LYRFWQ*KI*RIP*TLVSRGQEIALEAL*S
LGIAPEWMLIVLRLRAQDKVSLSMHIAGEMVIEVHLWHRQ*RV*QTFLVC*VYWKS*FIE
SFRQICLFPSHVSLKAVS*NILDKRR*CFYKLEVTPWPKN*CN*ILKY*K**LHCHQNLH
ELNMNCY*CKQT*MWSEDC*VHRQFVDIWRSW*TLL*FCSYV*MYRKHCIYSITLKFSLL
ISSITSLSFMEGL*QPGNSFSYSLP*SNSKKISMQGVEWSSMSSPFLGHTHRHPHPKL*P
SSKVLRFSWLCKAFFGQCCSDECL*PMSLK**TSSRSKVIPNPIE*IGASPHLSVQKPPD
SSKNLK*AL*ISLSNKSTRAISKLLQK*HKL*SSPSRESSSIGTLERALSTRYCIPSKSS
SLLT*P*FSSKKSTINFSVNFGFASQGKLTHLEISSSSVSRIL*LNVNNFHNVPRFSFKP
AVFFIKLLVVLNKLGTVQYSSVISTVNPYFLLCLAISKKGSYEMSQKKSTSGSILQYHSY
LETNGCL*KIPE*NRHIL*YDSILPYIIPRSFWSSNEALNCNELRTLAGNSHIISSTVPN
STVALVAA*IWSLK*SVKGSSFKKTYGYLNHLLKWPSILLIVFSTSSISSFLVSITKDAF
ILE*AGFCKYSFVSVQPRKNGSSLSVE*SCKE*GKLFGSCTISFAKNGQVPIQ*SMAKIH
PKKRKPYRFCRHLSSKNLLTFGFNLIAMLIASNYDVYSSPSLVQLCL*SQIVSLMYTVNF
SQFFFFVFHLYPRKESKNKKSSH*NITI*CNIIQS*SGRFAA*NKLVRP*SERSRRLTC*
FSDQGNILCDLIWFQRL*RWSCFGGISLSTTVFFLFIPISIVFGVLFAKQKCI*ISTFIY
TL*KI*VRVHA*LVG*VVEMGELRPLSRTMAITSRTITSLKIRFILIVVVTSRVFRSIPS
P*RSSIVSSSRVSSTFVCCISSIFVGRRIPTTYCVTSRVLLVLRSAIIHGIGVHIGHIH*
*PLLL*FLYFLLYRRIQSFFA*FNEFLVFSLSLFNIFLKFDTGTRNTVLFKQAQPD*L*I
SFFLQISYLAGILAIITLMQRS*IRLQCCQSIFILIISF*VKILINLINFRFDIKSSFVL
AGQVLVTNLLNSHQS*RQCTLSSTVSLVLLKLFQGFILAEKLFAFFLPEISSEMINT*AK
LNNEKKDT*KHN*GIEEKDLIKDKFSVQ*KGLHTSNFFF*RKFF*LQTRAMFYFVASLVF
ECATHLSWRAMTSGIIISSMLWCFSSKRTQSPFLFSGDTKMTCLFLVCKRFPITS*WLYL
SRACVHL*SSMDSSVSNLNETIIA*VAHDSTNLLKNLGTGSRFTISLPSGVVLVVPSVSL
FAPILPLSPD*ILC*GSLEYGTKKSLTAAAK*NKQPLLFNSLAILFSDHKYWLTVVNGSK
SSFSSFSIYLS*SFLFFKTFSANSGLILPSESM*SKNKVLMLWEKDLLYGVNENSLCKKI
TLYPFAKNCSALDAPRVPAEKLSIKRTVLFSNGTVVPPEVIRTILFLFREYCKSINSLAS
LINSSI*AGLGLVLKYCSSSVV*ATGKSSSLIVRSIA*LISVTDV*I*GLLSTGRGGIAI
V*RKKGVSAANLHSL*QLIKALCA*LS*PLIQMSC**QCL*KKKKNVNNRSLLQFLSFGE
FGSSNSSLANKVGGKYPKHRLHIKSADFRHAI*SLPSVHS*VRP*VVIVASTFLA*SGFF
LDFFIINCNSDLSRSEKKNTLLIVTASLLPVTFKAVKC*HLCARSNKNLIVNRVCSTGIR
FSISWNMLYLKMRYVSMTIRHPERS*NTYETTL*QNEQHETKPDLP*LNYPKYKCLNN*F
RSEIPRFHHLV*FIFYIIYKISNIP*INLINCFDNWLLP*DCLY*DCQDTPVLLEPVIQH
LVALKVTNCSNEPSKSRT*LHHTPV*ALWIKSQEEEIIQNSQ*NAFLTSRSNHL*PSEVE
MTRIN*KTLSPK*C*TCL*YLGRMMPVVLCTAEDIY*TPLLSGLMILYKNKVYLK*HSTH
SYKDYINISISHQISIKSLMQSRNFPKLNLVLSVSTNDSERFGTECHQTS*PKKLP**HI
LGY*QRKPIILSECTNQRH*KTPWKRLTRQPH*LKDSSQDSNLMLMETLSSVPQPTYKKN
TTLTMIQKII*PRIDTSTP*GQEDLTINQCQIIETGEITTHPEKNV*KIGYASIVRKRDI
A*TNVEHVRRVLTDLELESKDQQTLFIKTLPIVHYIAIPEMDNTAEKTIKIQNTKVKTLF
DSGSPTSFIRRDIVELLKYEIYETPPLRFRGFVATKSAVTSEAVTIDLKINDLQITLAAY
ILDNMDYQLLIGNPILRRYPKILHTVLNTRESPDSLKPKTYRSETVNNVRTYSAGNRGNP
RNIKLSFAPTILEATDPKSAGNRGNPRNTKLSLAPTILEATDPKSAGNRGDSRTKTLSLA
TTTPAAIDPLTTLDNPGSTQSTFAQFPIPEEASILEEDGKYSNVVSTIQSVEPNATDHSN
KDTFCTLPVWLQQKYREIIRNDLPPRPADINNIPVKHDIEIKPGARLPRLQPYHVTEKNE
QEINKIVQKLLDNKFIVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATISDPFPLPRI
DNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTF
ARYMADTFRDLRFVNVYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKKKCKFASEE
TEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINYYRRFIPNCSKIAQPIQ
LFICDKSQWTEKQDKAIEKLKAALCNSPVLVPFNNKANYRLTTDASKDGIGAVLEEVDNK
NKLVGVVGYFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQ
NKNEPARRVQRWLDDLATYDFTLEYLAGPKNVVADAISRAIYTITPETSRPIDTESWKSY
YKSDPLCSAVLIHMKELTQHNVTPEDMSAFRSYQKKLELSETFRKNYSLEDEMIYYQDRL
VVPIKQQNAVMRLYHDHTLFGGHFGVTVTLAKISPIYYWPKLQHSIIQYIRTCVQCQLIK
SHRPRLHGLLQPLPIAEGRWLDISMDFVTGLPPTSNNLNMILVVVDRFSKRAHFIATRKT
LDATQLIDLLFRYIFSYHGFPRTITSDRDVRMTADKYQELTKRLGIKSTMSSANHPQTDG
QSERTIQTLNRLLRAYVSTNIQNWHVYLPQIEFVYNSTPTRTLGKSPFEIDLGYLPNTPA
IKSDDEVNARSFTAVELAKHLKALTIQTKEQLEHAQIEMETNNNQRRKPLLLNIGDHVLV
HRDAYFKKGAYMKVQQIYVGPFRVVKKINDNAYELDLNSHKKKHRVINVQFLKSLYTVQT
RTQRINQSAPLRELREHTKLLHS*E*ILHTKLTYVTCKT*TQHFQ*NTQKLNFAKFPKEH
EDQY*PTLDNSTKHKTTLRERKMLYLKMRYVSMTIRHPERS*NTYETTL*QNEQHETKPD
LP*LNYPKYKCLNN*FRSEIPRFHHLV*FIFYIIYKISNIP*INLINCFDNWLLP*DCLY
*DCQDTPVLLEPVIQQNI*NIWSLGPVG*GTVLITRGSAVRSR*RPYFFVQISSTTAKTV
SKKYETPTMYFFFALYCSIDTKNPYKINIYMFAAMRMEKKLKKLTYNLNNGHFFGFC*KM
IGPSYS*DPWGSRPYYS*TGSNNRSFCCFGYFWGNLRGVSELFYFSSLCSSVR*MVTSSS
CYYCFHIYYCYYFCSLLTALCPSISFYLYKSLSQGGRMHRRYIHSQAG*IHVRYQSVAFV
KLHVYSLSIG*NSVV*ILWLSYHRKMHFHQCSALSMTFFQHSHRQNDRHSHSYNRKLFEN
RSHLG*HLLFLINKISKY*DIFLLSVFCYCKACRTPSSIYEDTVIYNGRLHYN*CK**P*
GSVVSNDHP*TRSKYISHGDNSFSNDLFANNYYTLALPPLSHRLSHNLLFQNTVLGHVKS
SVPLG*HLHPLWKEPIIY*MMTSHFLSVLYPSHTAKYRYFLPQITMST*YLSSVVRFLCI
PHVRMLDLSHSSHR*FLVIFHFFMDQEIEKPVNEL*Q*QETKTKDKRLWKSL*KY*SHIF
I*YINEFTDVPLYMLTQTLSFYCLNDSYLVICINHHIRLSC*KIFFEEFSLEKNTCDGNK
RKLDKSCIK*CVI*KITG*RKINS*QSKKIKRR*VLVKQVSLSKSKSCLSRIVVMMP*NQ
IRKKTKNPSNSPCTWILNQLSSRKELKCLTDYKRNTMIKLLLCHVFH*RLS*RMEPLRKP
LLGKPLRWILPKEFLNL*QTGYVFLRLMVNYGT*IDHLKAKPTKKSN*NC*ISNLTKVRR
SFGIRLPTSWVNLVSAT*VPIFV*VLQLMMGSFMKWLLEIV*KIYLNLQKEPSPKLISQD
WKALPRMLSSKSKNLKDWSCPKKIF*KCFIIRSIRLTWYRQRFQMEVLLPSTVAVN*LIY
VSALISHILGVSKLSNY*RTLLVIS*VMRQTTLYKEFTVSLFQTKN*WMLI*SSWRKPL*
EITERLVKNKNYSYSMKCPQVLAFGYLMVLEFTTLWLTC*EPNTVREVTKKSSLQTCTTP
NCGKPQVTGPITRKTCLLSK*RRKLSV*NQ*TVQVIV*CSSLENVLIENCHGELQTSVLS
TEMNFLVPCLV*LVSEDSNKMMLISSVPMTKLSLKLKIFSTFCNTFTAFLDLNLRWNCPL
DQKSTLERSKPGMPLNQN*NLP*RNGVVTGRSMLVMVLSTVQRLTL*FLTL*EDGINVPP
SN*ISNCQTGSNWNLNLKIKIARVTKDRS*SIVPF*GLLKE*LPF*PSILLVNGHFGYHH
VKFWLCQLVSSTKGMLKTSVTNCTMLASMPMSI*PVTLCKRRSETGKC*NITSFLLLVNK
K*MKNLLTLETETLWNNRVKMLLFLLKKF*NSCVT*KMKREVTTS*LNEILCS*ILTYLI
YVL*RIK*V**RNLTSINYFFFFFPSIRCARIQYGRKQFGMQMVFTGSV*VTNI*KQIQE
PAEFGPNIYLYTN**PYAIITPSSRSGSHHISRSAVNADICHQKRNYR*HYHRQKILR*I
YRIHDPLKHLIPATDLYWCSLYFPMMKTNCCRRS*FFPRKTEQDCRFALLQLGQEIFYPY
YDTIL*DPFGS*RASR*KLRLFSFAAV*LSGLAIFSPDFGTLCKSTSTTLRGSLNLISAS
YCTAFDFSEFLLFDHVERLQSRCHHICWNSYPSKHLWGHVRSTVVYTWTYQQNL*QKIKP
LHPRQNSSAP*HL**PWSCSNDRQMELKIQLKTQANHPTSQL*QWIYRPSITPACLLHPA
IRLFHEIQ*HFHKPF*TKASS*RVVHFPFPYHSGHIAVLLLFPTSPCSTLEIRLLLKTKI
ILSIDT*KVLFCVKVALAHKAFTLA*LTPAEIKTQKKKEIMYKQVTMNEISCYGLLR*LL
KFVSSKIDCSSVLLMSKNWEPQAGEMVSVLVLTTF*AAKEVIPEQ*LLKWNSGDGSNATI
RTPADLTL*CPHYIVTLHSIGTVMLYKIFCLAV*VRMQRLQWDKDILFLIFKVILIFCWF
FFSFLSSEKLQFLQKNTSSYSIRTDCEELGGEHRNRQKIMDYFNIKQNYYTGNFVQCLQE
IEKFSKVTDNTLLFYKAKTLLALGQYQSQDPTSKLGKVLDLYVQFLDTKNIEELENLLKD
KQNSPYELYLLATAQAILGDLDKSLETCVEGIDNDEAEGTTELLLLAIEVALLNNNVSTA
STIFDNYTNAIEDTVSGDNEMILNLAESYIKFATNKETATSNFYYYEELSQTFPTWKTQL
GLLNLHLQQRNIAEAQGIVELLLSDYYSVEQKENAVLYKPTFLANQITLALMQGLDTEDL
TNQLVKLDHEHAFIKHHQEIDAKFDELVRKYDTSN*FT*YLTLNM*VF*KKKKIFHVYAY
ILF**SRIRWYHK*G*HGLNKII*SIINKAETTFVTLELCVK*LILAE*FNDFFLKVCTL
LFIFWHFELILHFLYDHAPLI*ALGKSTLSSTLNGVGSGALTSFICLTVSISATGSLGSL
SLKTTTPLFPLNLRTGTNLSSLIKEIYLDCCGSIRVILSTL*GLEEYLFL*NSSSFSFVS
FMPFLFVSLSFSFSSCSFFFSSSFGPFSFFVFFALAFALAVVERTAVATFSTSLPLASSY
ILG*LNASSLA*QFI*NLGIA*SLPRIPMTVVGVKERDKK*ASGNQYQNCENMTKPTTDL
VSNVPVSAFSS*IVTLRPPAFIIPWATHAPNLAKPSWCLFVITLKKFLLISAT*GFSFSV
C*IKIMDKAIMAA*RTKSTGSFVSGSKTSIADCKPLPAQAIPRANAVPHLT*ALCDLDRS
WTILGTVV*SRKRTNPNAMTAALLTSSLESETATCSNLLTAELFPVPAYANAIVNAPP*R
NKDSSLANILVIKSSANS*RP*FISAKPTARPRVILPCCVSWEYVNIS*IASGLPVPSIQ
RPIPNAAASPDVAESLYRTSFKAS*TSILAEPIAARPIPSEAPCNNTSTSSSPEVPLFST
IMFFR*SVVSRPKPA*IKPKPYNEPPLINLEEARLPGK*GAMTFLPSNKLPL*ITPKEAV
AVNLAQF*ALPNHGKFALINELSVVPACIKPLATLTAVWNKENFPSKDDLDLFKRPMSMF
LLFKRKVL**SQVGSPDRIFNKAGS*PWAVSSVTKISSNC*DADETKSNAI*ADNPSSFS
SFNFLNS*SANPASFKFTTTLLSVK*SQLGIFIRKSNDFLNIEDLNLEFVTVVIAKVNK*
LIILTFSEVES*SNLLFKALSMISNL*PSKAIPKANFNSEAFKHFSIIRSKIEVNFGSII
SLV*NCSSLVYCLEASWTYISILFETIVSTNCDFSSISKRSFAASAYFTADSYSPRL**T
LDAIKAAISRSEKVSSSYNASISGSSFEISDHNWSTTLFIDSRAYVLTES*FSLNNAKRG
AAVVKDIFSGYI*TQSILGGLLLDRVPQFFFPWIQSIILLCIQFCHRK*MKCALLLLKSN
MLLPALNPRNNGNKRQIEKARQIIVHES*DSTLWSLMGNQRLFFYSIPFQHILHTMKIGE
DFKSIHIFLFI*VISIIT*WKLWQKFGSTFHIYP*FHFD*QKRCLPLDKRSRRENQKTVS
RYYDRIRYH*RSSKHQERYDEYTRHVLCSLDRSPKTSN*LLGSSQNRQSYLH*CIWTMQ*
PPQYRLNFELLL*SHQYVVSGLYLVMKPTQKSSC*VHR*MNLHRS*LVHVDKHLKQHLQF
CWP*RLGSEMECPRQYLLRH**HKPRPS*QRIVEQITFFQFLE*LVHVVLQNQIYSTIHL
M*KLVWQYLRP*LSRYHSIAHAGP*LLQELIIANQCDHTQ*YREFFLLLPNT*QRLYSMY
LYAVQWIYHLIVLLN**SHQLPILLRILNWRMAN*KQQYLY*RHILGLLDWYLCKNNQYK
LDSWHAVVFFQSI*FWILYR*RVRL*FFQSIHPQVEKTCGTLLGNPDP*RF*LQLH*HFP
TVEYSCHQ*KKVLKPLVAL*CLHDEVVCS*MTELVRLRLHQESQKSSWHVGMNLVNYRQL
NKTC*GGNTRNQCLLLFNVTIIYS*NRQSIF*CSSS*PSYVLNLGDSISFHNGDSFPA*R
I*PTINLSAVRLTAKFFGVKKKMWHFVYIWQEQECNIIDSARDIMKNNSTY*LC*KFCSY
RFYHASWYGCRQRLLGN*GSASINDSKWNKKGLFSNTIDIDICRTC*RLP*RVQLLLQAF
INHVCEPH*MFTPNNSIAFVVFDYVIDADIPTVSGYSF*LCLKDTICVLKT*LIYI*DLK
NPIQYA*FDLMVKINCIFQ*NSQPATEFPFFHFRAHVSF*YCFKYLYENSFR*IFHIRRD
INK*RIHAAILIQFRFLQYVQNPSLIRHH*GTFQMYSQRLQETFM*CISIFQ**PILKFR
AFLHNIYAINQLF*LLINIPILLVLVLLCFFFGYYQLQDCGFEPPICEMIHFRESEVLDR
NKVNKLNAILGKLGDGFTGLIN*AFYSHIIGKRGKPLDFVYSH*LLIYCFLLNVWW*LI*
*LYSFEKLDSLL*KFLYCW*IIYEGF*RLLFRYFDNHL*GIPENAQCLRTRRR*YSLRIA
FRL*FVKYH*EPLNRQICLSFAFCYC*YKSVCTFFIFRRLYLLEARKRFLCFIIR*KRLQ
HQKLTQRRLSIYFVHILIYSNCVGIVFNFVIYDL*SPLNFPPVGIILTDNIFEC*FVKSN
TNNVFFHLF*LFSSIP**SYYARDSMFGEGF*NYSFHLCAKIL*AFRYLGIIHCF*LCCN
*KPGANGFS*EFTIILRIQFID*QIIETHYREFGVHF**VIDRSYDSLKIGYYIY*HNHS
HENFLYGFCRIYDISPFS*IDSQYKRVHFVWIFILQKT*IVITLFKFRSLWVSFNQTICH
KNQN*IL*ITIISMRF*IFHR*LQIFFHILQKRNYIYVY*LSFRIINFFQHNCGIIDHSA
*FDEQICVHIFGIISDVYFCSVNICCIQVIFRKI*LKIYQVKLERQFFKLSFLFIGETFH
ILIDYL*VFL*MLLCISY*IVKTILTSAFERTDITFEVP*EVGVCPKQSLMDGEKLGCEN
LTFAKDFIKIFV*SFFSFHSNSQRIP*T*CCIFQFQDKFFV*YNCSGSE*SIIFFCNGIQ
CAYFIIYCNQIVFL*ILSRINLRCYPSCSFFILLK**SC*LLLLVQIKVNKGMFCILLYT
A*LDQSFSKSGVNVVV*H*NLLITLEHSLLLILLEVSLFMEHSLKSFALFSFYLFAISRR
SLYSVRK*K*TR*QIW*NHH*TYKKQDELV*KLYKSRWSKKT*FTRHIQDPKKWISLMII
SIENQMIGLSFSS*TN*ILNDCPPQFKAPGYQNFQHTLVC*K*REDLRVK*YMFLTWAAK
LYFIYS*NNRERAG*RKKLTAVSYDHISFL*LTI*YNTLINGLKTALSQKSQELCLINN*
*SQKQRQRQK*LLNSLKNCSKQCSQCLLVV*PFSGGCSLMIYLLTNGLYRRKLKKTTISK
TRLKITLSKSRH*LGANRLKQIYYWIGWRREFSNPFV*SV*KPYH*VYF*RIPPIS*KIT
FLVLIMTKRIMSILM*T*VAIKKGAKMPTQRTRQFLY*IREGWFNS**DDLS*LPNPWNL
YPKKSSSL*G*CLMITSMKIISRSCSKTRLLTKEQL*RSPQI*TTMLLTSVL*TRSIIKL
LFLFCRRQHPVWKKLGTRTLLE*TPLI*FCNNKKKINLKNLFLQNPRILSQAKQPMCLEI
F*ILRKQVYNQLNLFQITQSRAFVVANVDWKFPKQPPC*RLVKVAVKHYTASVMAIFYIR
QLRNALLAFLDLPWILNGLNFRIL**LERFLGSW*EKRRDFRPL*QNSLIVLSTSKIRIT
K*KRELHSPYLYFS*MKHYASIMGENLAKLLGTLRALYSLM*RELSYQILESN*T*ITNI
NGTLPPVPLKPRASIKRFCLTQENKSSRGYRISLT*EKSILKLFLRRQPYRSLILTQACL
RKIQ*FLAKKGDVTILMST*RKIKAQLLMIR*KQKILMKVYQQRFAKSASLKRL*KVTGS
ENRIILCSSFKQALLQQIEESALNIPNFSLARICLK*FLYTIIMNNKVTLLPPRVFFCLS
WSVMVNIDRRKSDRSVNLDDQHSNKPPSESLISLLSLTSSMSISSLLSLLIIVAVLFPPL
YISGLPWIMSFKSVFSFFSLSITSFIMVPFLLISLTILCKIELSSKCITSPSISKFNCPD
IINFVNSSLISSKSIPSVDDK*ENCSFFDILK*KKYILHLMITAADDDQLGSKKRLSMHI
LFISPCQILKNLLKLVFINSSRQLTNKGVI*KNCFKSLK*IKSS*LSKGIEISTDIFTII
INSSFDIKFMQSKCSDRTFNVKGSEVIIVKNFVQQSKYLS*RKYETQSNICILRSEKESS
*TTS*LIRSFSMEFNISKFLRP*MIFFTLYSISSMPLKFLHSRDIWVIFSKC*YRLVNGT
SSDSI*NIAF*KLCEIISRAMFSSNPPSNEK*GFPTSWLFSRLTGLNPLSSTKISK*GVL
VHWTSCK*LMPCMAHRFRSSFSP*LIESK*PMRSINKGPLAP*NMSF*MSRSCLLPTILL
CGSKLFLSARYALSKINLLNLGASQKIRKKENVIIVKNIKLLKMY*HVYYIYKLFTVKFD
YKLSNPESRNKAKVSCFLVEKLLHLFQPRNILVILFELGICTNERG*LFIDTSTFQISFQ
RFL*FFVQV*KRWAMVYQFSCYFGLSRLIQSSIN*GVWSSTINIK*TFL*IH**FK*DCR
FACAFFRNNNINVGKVV**SIKIILINAVFILLGIFIHCVVVRQISNLSYVKKNMNCFA*
FGSSNYFSFILTGCLY**ELIFVQKVIK*V*RR*LW*RFLLNFQFRLQNITYSLGLLVPH
DCSGCETSLRVSNSKNSPR*FYYGWLGRSQNASSDGTVNAS*EHYLLFVSICDSLCIFGK
*S*PLLK*CVNKIDPYQLKCSGLLC*ISNSRWFYFTGKLKHRRVLVKSV*QESQ**YKII
*QHSFALPPTS*S*YMIRLLFLKF*GFCFIIMQKKLFT*LYNLHRNMNYIMKGSMMRK*K
GQDERQKKIVGDITDTNMCILENFLISVTTSNLFGQSFTSTKDLLVSVLLLLSLLSGSLF
NLFSQTVSD*SVSWFELLSFGNRVVDQTETNRFTTTKLGSETENGDSVLFSLVDFS*FFT
*FILGDISSVWVQDVNNELLSGQQWVGDNLSGTNSDSVRL*KIK*MEAKLTSHF*QNTLV
I*TEQLIRKIIQKHYSSTFFFILSNPGNLFSLILRY*GIHRINISIIAILVF*P*SPLTN
LYFKLVAPNVSLDLFCWKFLP*LYCIYTATHNAITGIELTCSLFQFLLVQYKFDIPFLLI
FCRYLSVCSELRIRWLKKNN*LTPLSHHYNCLATNLLDIQRAGQSLENVWDHSDGYTQGS
GCGCYRHD*GHSLP*ISKFRELSAPASHCYQANKRIRLPKRT*THWAPSRE*HETSLVVS
FRVIN*TGILPGNFFGRESFEF*LFSFPKKE*NMYRCS*SKKSLWTSFLLKAQLVPYLLL
ML*QI*STVNSSDIHKIVK**QYTNEGKTILCYM*SVNFFFFLYIVIAFRILIQTASSK*
VRDPHRWPPCYGGIHVTFP*PVVRSSFFLSYSHLSYTSIFLPVNLCASPSILQDTFAKYL
ICYLSAHSLGP*RTPLQ*NFV*LAYPCFHYHPAP*QRADKKFQNPSSSPLKTYCFCF*MN
ARTIKQSKIL*LSHQ*HCL*SSRTAQNSSEV*YPKDIHLVCPQFAALGSPYTMSC*KSLG
RVFSDHRTSM*LGLKNCTEQLQQNHLKCPPSDL*FASHKL*KPVYHTWMKWQRHSPQLSF
GRLIQQLSIPPNLLDTHLQELYSLDLYHTCDCN*FAF*FLHLF*KSSFFASLLVDH*TFQ
PHPQVFWPD*YLQPLPLAV*TFENKS*YHQEKAIHLNQNVAGYFFPRIHQILLFLNYLST
RSF*PLSNSNSL*IVFPFLYRR*QI*LRFW*IQNLA*VYLETSYRMQEYQE**WSRVRTP
RDP*LMNAIPYSIGQSILQICSNVVDSSWQYVPLQ*SIR*KSNPCYQEHQIFDHQRIFLS
FHQTFQKWNYLYHLLENACNLEVLFLLRWYRSLFLGIIPCLSDIL*LWVSHLVTLRCFCY
LEVF*LRIFLFQFLSS*LYF**LQFSNLPFLLGHKF*KVELLKIFAQLWPFLQYRKLSRP
AIYQILILFRIILKTIS*LYVVHLQLLL*P*QQPALESRVLKLIGNEFPKDGDNQFPGHL
PLIPPLIVFLYAPLVQQSYIFDHKSMMSY*PFHKVLWLGKVYHND*LQIDYHYPIY*LH*
FVV*LK*PNFWTDSVV*GILRLRHSICLILYSIGILQRIFLLATVP*YLVPFQVIDLPLL
NHKLAARDLKTS**LDT**YLCSRPNFTSFPASLRVFLRCTSC*SLQYVFLFSDPQSSAR
LRKKG*LYIRLITSY**IYHFQAHSMYSM*ICI*IMIRLVQAFATFRSATVKLLHSYSHL
YSLETVQRHEPLLNTSLLSR*RHQEHRPSFEQVLDSPSEEHRYSQSHSCLRTLPHRSKVM
KNRRCFLFDQLLDQLHLDATTENGFDRR*NPV*VASKKHLLLLLTRPYLSQLCLQNPILL
HQTELTRLKFLGTDMQMILSWHSLEPV*NLRCSDVSSSSVPAKIPKLLIRQ*NKCIF*NT
F*IFLISRVNKPV*LRM*E*WLQ*IPQQSVLQPALSNPSS*VYQQVIGQM*HYLRFPTKM
WGTKVLLLLWAIHFLVFFSPHSSKRRIKQSIKVKVFEIPH*KAHTR*LGHVHPLVMEGLE
IIQESNSPLSCLSSTRKYCHTNKILAVQKAYSMRPQLLEDHNSPTGYRLVYL*MNMNREK
MN*MLLKTQCYTFLFLMEKNFGPLA*KLWYSHRKMVR*HLHVLQRRMETSHFYKGRTRPS
GLLR*TGHLRQFHTLYI*LSYSLRQWRSMSIHLYHTVLDI*SCILYYQVDRSF*HLNHIR
YWYPPSSSRNCNLKTI*ESFLSHHLDGSMAA**DRGI*ENKKCASKSSSTQSVATVVSTY
LVF*F*M*SAENHLSSSAIPNV*ES*AVRHLAQQGHSKLFQ*TFV*DVSFLIVTILTYCF
LSLLHQAYFPCLYWKSSAVV*TQSHGAVHRNHLKRQGLWLPTLC*HYHQNAHPFNSMLNG
LSLTSLILVELCLSYLYN*MYFAILHSLRYLAVFFYTPE*FFCDGKSGK*S*NTMRKNVK
EIILLAYMIVYMFCLKKFI*KRS*YILTKRNRSKLDKEREKCHQKESTGT*LTSFWSRSS
TSNHLFIVNVTFLLVGIFFYCFRWNCWGNTIFQFHI*HGTRHR*LFGWNWRCILLII*AF
GKRRCRLLFREFCTLWNINWTIQF*DGSNMCSGLIGNLLINGKLNSSGGGLRS*VVHTSF
*TLLPTVEMHTSNLTH*WCLQEKIQGMRLIDVDGTISSHIDNGLLRDFPDGFV*FLQFLW
HIW*ALNRTILCN*ILFHTIIPNTQVD*IT**IWINNLEFTRQDTTRVHV*GHWFEAFII
TKNLGS*GGWHWCHSQRVS*PMFNNVLS*GFPIPHAKWFSVPHIEL*NTLRSWRTFKSRI
FTFFLGQFTGGFKSSMVNSFEDLFV*SLSFFRFKG*TQHHISIGQTLDTKSNRSMLHI*I
SSLGNWIVITVDNSVQVVSNDFSNLV*SLEIIACSFTIF*NLNECW*GNRS*ITNCSFIR
GGIFDDFTT*IR*FDST*VLLVCLPVTCVLINHERCTCFCLCLQNGIPQLLGFNCFTTTF
SFVTSI*FFKFITPHII*TWGSTGRKQSPRPILLNTFHEKIRDP*SREQISCTNFFLTMC
FSDIDKVEDICMPWLQEKGESTRSLVTTLVHITGSIIENTNHRNQPV*STVGTSDIRTCG
TDVVDMKTNTTCSFGNHSTFFQSIINTFDRVILHGN*ET*RHLRMWRTSVE*SWGSVSEV
S*RHQIISLQHRFDIATMDT*RHTHYQMLRTFCHFTVQS*QVRTLQCLESEIRILEIPIV
HDGRVQSIFVFHDNVVNFVRNHRSMLSSSWVNPVV*ILNNFGELLCGLLM*VRDGDSSG*
SGIIRVHSGHVCTCFSCKIVQLNGSNTGVHTRNNTLGYLNSINTVWV*TV*QTGDTGGNF
IELNGLFAAVSFNNVHLCGSI*FIAAAILACHIYFNLDMR*EKGKEEGKRRQNSSAFIYV
LQQNTKQYKER*HEKRNASASHNTVLRFNNRLLFFSHLVVWSSPWQPGFCPFEQRLGVVA
ATTTKKKKKKKQKNNGTQCCCDNRRQITWLFLLL*EN*QPRTRACSAT*FKLKQAFTFFS
FLFFFI*QLKIK**MFTRACDSFLCMYVCADFLCACYLLLFLKKKLATATAPASTPPATT
TPLSVSFWILSSTILFKAPTCLLLRSCSNKVSTYLFAIEYSPSL*QPMVR*YRHSRLRDS
ASL*MSVRIFTPSLSSFTSVDLISPHA*LNLDCMVAVGPPSETTCWRRISSCCG*SGSYA
SLRVGQKSTLVILMLYGCALICASMCRFYARYMITSVQNSGNGSFALKGVQPSPLAVFRH
KCAKRLVHEKK*KKIDELSS*ERYYGTNSTRKGSTDAGHGRFEHFETWYEKILG*TVCPG
AGEFQAESAGYRGLLV*R*RC*TKDD*FSGR*HWCVQNF*ECFCCRPRYR*WTHVI*TAS
NGIPRETGRDRLF*GKRQTR**YSRGHRC*QFHQFPASRHL*W*LEAGKV*HCVG*RDPR
CHFIEWHEDQR*T*CSRCIRRSSGKDFEKRRYFLDHFL*FHTR*TSKDHRD**FENVENN
KIPCFPIWRGPGCDHM*CSIC*TKLICFYL*FIFNVISLYLFRNGFNYNVIQFIRGFLLT
SLYGVLCRITVIIYC**SYEFFALQRTCKSFLHSEPLDQLDV*NDF*DTTRPHNNTRLLD
VVLTFIDFDDTNTSFLPAFFYVGKLVQLRIDLIYALLRLFTRLDFLFLQFEGFWFVFCIF
*GIR*LFRSTMDFIFVNISSFLFTFRVIFCFVFQYVEAAAK**T*TKCKWLLCFAVRGW*
TFSTGSCISIFRVLFGNTKPSSKFRCGTKHEFILLFVIFHNTRFYGLSVVNLDLLMRWFL
VFFTFLLFLLIIFIGCF*FVTRFFRLFILIFFPRSLRSSI*FIDRIFNCSLFHLRIFPGC
IATIGLTHALKVYAYLFCAN*FVDILV*VATELFKIQAFISSTSPNNVNFFKKKLNTYIT
AKCLK*KHITNATLKITYIYVYFFILSFTGQSIIQFFYPIYNER*V*HH*LE*FFPATQA
RHPLVSGPEVRTFLCRDTLPARPSENHSNF*LHYQYRLA*LVSMLQGRS*NIAPLLEHLH
CMEDRL*VIERLPKSHHLWQASAIDSFEVVILVM*Q*FRMVVPDRQRLVCHSLDQMHRCQ
FSSNRLPLLDRSRVLC*VFSGLLCYSILC*MRAVFLLFCYRGKV*EREKSIQIN*CAGNH
RQQVAEFKYYLYSIVGRFFGSWLRLSSP*VSRFIYRSNSSSRSGGGEQWPVSTVPRVQCG
TAVSISAICGGRSFPAWQPGSIISFGGI*CTCACKPSWKPAVSVGIASAS*AAAQSSWLE
IFNGSASFYVDYADSVFDLDTSVYSNLLECHFTTYWVFENYEGVAFTLLGYLVLDYPNFF
DLAKLNKILLQFNFVKIVW*PPNKYRSVGICVLDMRVNVRIPIL*SPV*QLSIFDLGKFD
VFVSLEMVVWRSFRKLLHIVLQRG***VCNASDIWICLSLRIWVIGWSFVR*RWPWLEKS
RHVVWILG*IIIHQG*GADYFFKVSFRQSMTVLCVIILQFFFSSDALISYEGRIQWC*WD
L*AKQVGEQDMNEIVMKRTSFSLQP*KGLTDISIRNNDKIFAWDFFFSFE*VAL*GQNIK
KKYVLIH*FIYTEVSTGVPKYTHKSLFLFFFFFFSFLHFVNNII*IIFIFKKSNISIL*I
DKKV*GQDLLNVRLLRLQLTTFVVTS*NFVTS*KNYSPPLLNEWL*GFIYLPYCWNKNQL
SSTN*YLRY*YIIIYGVRR*RK**EIVI*ISGS*NARIDNVIGSMNINI*NDDNNIYRIV
*NCRFPFMDS*ILEENF*YILHT*YYCLIKNGIPTIISKFTNSSHTYLR*QDRYTFSTFH
EGSDRYLTHCRCGGSDGGFCTITTTATILT**SP*RGIVWYRCYLSFATLGISNVQANIT
L*ENRIRIGTDKLFIAYVEIKFC*SCDCS*T*NRDYCLKNCGEIHDGRSRSGSEKTTHSY
VPCGWLQFAAIYTTWL*RDLRRMCPLSRGVYQRYLLF*VLK*RLHYIPGSFPGNFAGRL*
*SW*KDCCLLWLQHDSCLLTK**SKSVSQQWKTCCDLIEVTTSYNN*SGKNTIVTADTGL
RDLLTNRLSDYESRNLVYHIVASSYSPAPGLDTVLYNSLRFKCPAIFLKFHFFTR*PSRV
PSFRFLFFQCV*LSTKRAHTIELMRTHERNK*KSKT*TESWWCVHFSFFITPRKLNWYVL
FVIVA*I*RGILLFKVAL*RQNIKKTTCVDL*TCIHSSKKVHTKIHAHINYFI*HAIFRK
FIKFR*FIKTAPQT*MSGCKGSVL*STSTIAPSCLHTTSTDTLNFLAFNSVSSP*FQTIR
SKDSCFFLSWNFNSGLLIAVLMSFSRCFSTCWCKWRTNFLECELAVSLIFSGSSCASCRT
KGG*YFSWQWTWSNS*SSVSPFKYVSKSCKSSKTFKDSPLFVVMVDILGPFAFLSFFVIL
II*NTLLYTVRCFVCT*SCFDR*VNQDLPLRERYEELRRRCKGKGQ*RIGTADAYIRTIA
NRRKGSSQEQKVERIPQQ*HLMAKRQCPLILFKLYPALIIPVPLVSSFSRIAAKLRSMIS
CHHYTASRGCIVVYYEKYLQYLLK*PTLF*ALWPSG*GDRLEICWALPALVQILLVSLFF
YFYFFFIAY*LSDIFDSLTQIGDHAPIIISSGMLLLATVRRIICAMLFTKTVESPFRWDP
LISVCVGCFLGERKRRKPG*HDTRVIRYARTQGIVRSRG*EAVLISAEHRNAVDKCPENK
RRAGSCHGIGATFPWVTMTFDRFHVVLP*ILRPSEKFLFFFISFSSLTFVSFHIDYAAES
WQELLAEWADYVCALCIVTDYICFASPSYFFSISVSHMFPEIFLPSSSLFFFFTINQCAL
FHDSCLLDLRYLCG*EWCY*VNSGQLGSVLI*PFPYYTNTTSLFFSLSFSIPLPLPLPFF
SLLFLLSPSHLSINASAFPSYIFLFY*L*L*NLLYSLSTYSSSLLISYTHMNGPPTFTQY
RINKFSGNGATHKIRELLNFNDEKKWKQFSSRRLELIDKFQLSQYKASEQDQNIKQIATI
LRTEFGYPVSCSKEFEKLVTAAVQSVRRNRKRSKKRYALSIANGSGGNVNNSISSNSTSD
DEISPSIYQRSNSDFLPSSNYAADFQFSNKFQPLMSHQSHNGTIFPTVGTQNDSSPSVTS
TQQKYNDIVTMLVHDLVTNVVPLSEQALKDPYTGPNLSHFATSSLSQQPNITTNIPIDST
VPFFLREKLLLQIQRSRTCQDISQAAGSIDIYANLEILGEMSIRMSIAFVIERFFSNLVS
SSMKYITAKTCSPENLALLSQRLFGAATRHNLSHFPAAQVQLRLLYLVIGGIVKDFGFDP
TLYPLSEIIHHIVMVQYPLASSCASEPPSSSPNKRVKRSPPVVSSDVMLNNNNTLSNRAT
LLTTLPMKPQSANKDVNRRVIIRFNDREQAFTFHQLSNGPPTVSEVLENCKNLFNIINKN
KNFGIFHNDNLLNDESLAKLFDSFSTSEIHLVIKDISTIPLQDAKIPVPITLPKMSCIGE
NPSMPSIPLVPQEKDDPKKSSLTAFDNILNRISKSPMNEENSNTTLNTGTSTSNTNNNDH
NESVPAPYVTKNKNSFQNGNLPQPVFQPLL**KYKTKLSTYITA*YTFYTIFFSFSIRVH
IYVR*NNNILLIHA*NCCR*FSNSSSSNGGSSIT*ILYPSEYSWSCKDSNVKSDSSLSWN
PTMALYTIVLTLKYFALLSPSESETFPLCAKVVGKFLLNSSNSSSGNSNLSRVASS*SS*
TPT*NSLVLLIDVRGPPFVYVLLFALPLVFSFSDIFRASIDSLSKDASFCCCRNCLSCSL
NSLGHFSFIKSFRTVHLSLPNFSNCPFSLISITVNFSWFINSLKSDSDNFSKNSIGI*GG
KFMIFSCHIPLFVICFLKLFSLKICFNLL*FI*VCEGVIVPPFFAWRARSSPFVLVVGIL
PLLLEFEAMFKL*RADISL*EGFILLFLKER*CC*ERRGPVPVSGFLGLLCMYF*NWLWF
W**KCRRRG*CVGEASGPPAVAAAVGEGRVV**GICILGTVPGGAPNIGSIEVENGP*GG
GARGGTPTGTGTGVGNGVMFSFFRRLTSGEKLKN*EGGVEADGGCGVTDETWLAYRGEID
LLVSSGALRTSLLLSLISGYRSEGESLVYGNR*TNRS**SHW*VFKVSSKFSRDSLSIEF
FRMTMQL*KVIKGGTMEVIGGSIFTCKILVWYMIPPIKYFTWAQVLPGGRLSILMGIPFD
CEYVFFLGAAFVLAVELSVAERATKALAEAADLAL*CGSRVIIKQAYCKERQQTLVYQPT
ELEAKTNLKKKKNERNKCGRKSC*LNS*ASVKTFRKAHERRPTLRLWNNTMHTNKR*HLK
NGVENIFHSPNFLRVFQGCEPIAQNKRSVN*DIIELKRKICLRHTPWSIVPRDITLYGWE
EGAAIRMCGCGSSPLPSREWKTYGLGAKYHHVSFSSLKWDSYETRHRVKRKRTKAIL*LS
QSTAMTWHGPEGFFCLSSLGLTPPRVNSETSRKSVSFSRIHEPACAW*IAGFSLSGFLYG
NNHHHHYHCYSCDHHH*HNFFNAV**WYVLLLFLTHLFLCVF*F*PF*PF*PLMMCEFLF
SFFLFFFPFFFFSYSVNHFLSFLFILSSCSFSFN**CI*IFRKYLLIAIFFFPSFLVMKR
FNVLKYIRTTKANIQTIAMPLTTKPLSLKINAALFDVDGTIIISQPAIAAFWRDFGKDKP
YFDAEHVIHISHGWRTYDAIAKFAPDFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNA
LNALPKEKWAVATSGTRDMAKKWFDILKIKRPEYFITANDVKQGKPHPEPYLKGRNGLGF
PINEQDPSKSKVVVFEDAPAGIAAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIR
VGEYNAETDEVELIFDDYLYAKDDLLKW*FSFIFLIKLLR*K*NKNV*FPSISDQLYNFI
SA*LNNII*YL*NTNRKI*TDVMHPFLCRLRMICRDRWFAQIKLV*RI*HRNKKGRFNLR
FCFISYYKSVFF*YDEKLE*L*KECLFKFIS*TSFQTS*QPQFVP*RPS*QSFVLQSRKL
*RFFP*HSWHIWNHRKLWKQSCGSWRQ*RIVLVSKWKYLVEHYHSHHTLV**PTS*RVGH
ARYHLGS*QP*FC*NGCCLYVVKRKFSH*C**SLLYYPMI*ELEWDCSI*KVFRRC*MNI
ISFQSFNSGEKFIFHLGRPRSST*KLKSTYCCPHYWILFVHAV*CFNVMPIYLKVLA*LI
PLSMIWFFLFLSGTLL*IALVRLLTSFSHNESSK*VHNKFIISFHENSKK*FSNIHGFLL
LKVTR*AIFRVVRC*SILSFNQSKLNQKNITSAKYYVLPVIYYLQLISSSTFT*NAIETF
QTYPPAAMKRLLRARYHTV*TGAGATDRKRKS*NCYWLLPQASIPSPPRRTVSLPKGMNF
HGKGQMKRTIVGSGTSESK*K*KFKNSKKKKLKGKHPNNTRYVTTSVHRKVVTKTQSQFF
RIYD*SVQENKFQHVIGFYPCLVTLIQVEGNSPHIFYNGKKLILKLRKFVSFLS*NLIYA
KECY*NVYKCTLLGIASGKKAVKKFQSFNSFQQR*LPFLNQHSKVRKQHQHRILQAYGCG
SVWRIQS*IRQSFSCQPRIR*L*LYCLKKNYFLLRYS*RFEKLVRPSQR*NLEQACYLEY
KGFDQTRTQNCWPS*LGSKRRQRVGPTWC*PGSMLLYPSSRLELFSKRNFLKTLLVIYLC
VCVVLFTCKSHTIY*LT*FLCMCKTHLVICIYIYQGIHTVCFSLDERQRRNRISANESVH
RSKVNNVLQ**RLIQ*AALVF*DHRLCTFLRALLIV*HGQ*SLHFASIGILWLKVLLSIA
PNLWEF*GRFRNLGILRWVQNGVNKAGDSSAGFNISNLYIYKKYIYIFIYGS*NSTTKVN
RH*LL*SD*SKPS*NERLLTLEKNMELSSPSKKTTTSPINIPGGNRDNLIIGPHSHSFKT
DPFSSNNSSLLSKISTNPSLESPFSSKSLLDCSPVQAVKKSLESEAKTHSLDEETNEQTD
VKILNIADFPTDELILMISALLNRIITANDETTDVSQQVSDETEDELLTPILAFYGKNVP
EIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRL
LITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLLVSVEEMQKYAN
LLYKFWNDQ*NAVLHIIHALPLPLLVLYISISDLRNAYISVIFK*FNIPFKSVVFHISSI
SPEMIAIAIE*KKKLFAQINHNLPVKRNSVLVLFSIMLSLFFPK*ELRTFRKSKNIPNVE
YK*VYRRTDLA*NVESTSPMYFDEEQLLKYTIYAYRLSFFVGICSLFIAKSCLPEFLQYG
KTYRPKENSKYSSILERIKKFTVPKAYFSHFYYLATFLSLVTLYFYPKFPIVWIIFGHSL
RRLYETLYVLHYTSNSRMNWSHYLVGIWFYSVLLLILNISLYKNSIPNTLNMNAFIIFCI
ASWDQYKNHVILANLVKYSLPTGRLFRLVCCPHYLDEIIIYSTLLPYEQEFYLTLVWVIT
SLTISALETKNYYRHKFKDNHVAPYAIIPFII**CAH*GIHIHIYIDAVKNHFTFTIITL
PLIRQQRLVYVSLKTKVRPYLFEAVGKSKYWHSG*DLSLPNKRLDILGISDTFVT*NEDQ
NYSIPIFYLIF*ALFHLNLLLLEA*STQ*KISSGFLKLIQYSTISLLTAIYR*AIEKK*Q
SEHLCGITLI*KRKGYQCARKTSETNA*PSFI*VT*AEFIQLQQ*STRKQCRFF*LTSRR
FI*RCFRQFTN***PRTT**A*HCWR*GKF*NENSR*FRQFF*PFFGFAS*VFKHRYPSF
DV**SPLAG**FQIY*YCFVTTVVFKQYFFKSPLIFKSI*HKKLVQVWFTHRTQ*STHRK
RNTSRHDSCVR*E*IRFE*TI*CQI*CRYFCANPII*TVQILLQFILFSSCIIAGRSCTK
NRVFIIVYCTFSICADSNHGKGSYR*YSEKET**RVKQ*TVSCNNEKSFHTKQRLKSWRS
HKSP*R*SYSR*FGSFTIK*TIRRVIYQN*PTRWGD*LETTCCLSLDPKSI*K*LN*QN*
YNSLCS*EIYS*IFR*SYL*GFHFKPFVCR*YSMGEYCSSFQWILYCLCRLHWQRY*ASY
EYNYS*G*NWLIRARN*QYFQDSLCMCFCPVNSFSCICRFPQ*RLVH*HFEVSDIVFYHH
PCLFKS*FRFSQKCLCTSDRTR*NHS*NNC*NEYNSRGFRPY*IPSKRQNRDAYSE*YAI
EENTLGYCIIHVGNIRHCIRLCTISGEL*K*LFEQF*SCLINNKKGYVFSCT*YDFNSSN
LP*RYSHF*G*RTYISSGIT**NCYC*IYRVGWLISFQKRSPFNFFITRTFW*DFKLRNF
TSIPI*F*F*AYGYHCS**AIG*ILVYAKRGRYCHVKNCGKQ*LARGRNR*YGS*RSTYF
GYRS*KIKQENLRAISKRIQRCLFVNAKS*STDESSYHQVFRA*S*IIGSNWCRR*VTEG
CEVLYRVIKKRRYQDLDADR**S*NCSLCFHKCKINISWPICSYDNKSHKTGRCIQSAGV
SKNQ*KCLSFNRW*IPGNVFETLRTGIF*CRGSFTHCYCLPLYTSTEGRRCFGNS*NDGQ
KGMLYW*WR*RC*YDSMCRCWRRDCG*RR*TSFFSC*FFYNAILSPHRITIMAW*ELLQK
IC*IGSICHA*RFNHCNLPSGIFHLFVVRTYCSLSRLVNGRLCYLLYNGSSLFINS*SRY
RRVID*NIPRIVQRID*R*ELII*DVLCLGSIIAIPRFCNSIIFSGLYEFIRY*FHKDGC
YQLHCFGCK*INNGCLRNLHME*NNARH*NCYFTILHCIGSISWRLF*FRLYDYRKLLCW
TFSYITHLDLSCLDGKGNL*KATSSKLCKSARVCHSIIQLVWIFLVASTDYLKKIYHISK
YKFLFLQRRYRLCIILFCYIFFLLLFIFFSLYFLK*ASLAG*Q*QISCPAQIT*YFPLHF
HYLFRETYHPRY*QLVFGNQLHVPKEWISKCSQTRRTFF*KSHGKRA*VRQNCEDYCHVK
A**VCR*VMKRLLNPNHYYP*NHHRPAQLDKAEERHR*P*IGEHWQHVHFRL*R*SKRIF
LKPPKGPI*TTSQHSAELFEEQLRIQSTQI**GYPKS*QSNKLTSY*MNNCRFPNFFYQL
NTSRLLATNCKK*YCEQRTNP*LNPRRK*GSNST*RTR*KGFSFVQNGLTICKHKVWHYT
LYPKCISPRSKDEGTNHRNQQIFVNIA*ISNNLVNMIKHPLLWNVKSHIDCWAYESKHRR
TWQYRQ*NTSTNK*YLPKRNHQTQQGKNQTSSV**E*PPAIF*CVQLCPNMELDQRDIKI
RKTQYQYIKSLRV*ASPKRNLTWNRPHKVL*RMSRNTT*AEFYSWQNHC*KIAYHSWIES
HPA**IYN*SRFYAR*NN*QERETRSTKPCTNHPTVGTESCA*MTFLQS*CPNTKCK*SK
SLTHLCPARQPASAQSICCFYEPFVRR*STEWSISSTYGYCASCP*ANWSTQW*TTR*SA
FPTK*WALCLFGRKRAPKWVLVANWLFVASSVPPTARWHPRA*KGCSGSWRTT*TWSALL
CDTFCRIS*PFYGTR*R*YPGTI*PIASTDSTRL*RCLTSF*PGLSS*SPEKKRQKQTSR
GLLRTHPVSSPVAEKIHVWATMAAAYCP*ELSDSTLAATNAASWPLWCRALTHT*QTGYR
CRCY*PWSQNDQQALPHIDSWTCQHSN*TGSSCRAHNSSAASNSAVATVKPQTSCRTPLA
TKGKTRYTYSTGTRSTSLQ*SQQRTPSAKQNSPS*TQVRSDSLRRCDFCRALSAEMQSGI
PTQRASSSGRSWIALLRHPASPCSGEASSCRPYNQYICPSIPGWQTRLDGQQTSSDTVLW
*SPSIAAN*IKKKKKITTNHQIKQNKTKKQRRKPILYMYSPKLLRNRAMMFMELASNKTA
SRPT*QTAPKIRSRNASHPHR*WASDSMTTNT*PAAAAGSMCMIMISDDE*W**RF*TNG
CSDSN*GDGKTDLGEITAGCGTATQGYCIALNGQEAMMCVCIPKKKLMDWRVYYIYSYVV
CLYMCGSDCACICVLACVVQCVCFNVEMRL*HVIGKPQFARRYFIFFHQRKKKATLQSVS
*EKTAVKEV*RRGLSIGKGVCVW*FIKEKGMRRERQRMMSFEDKDKDDLDNSNSNNSSEM
TDTAMMPPLKRLLITGSSDDLAQGSSGKKKMTMATRSPSSSPDLATNDSGTRVQPLPEYN
FTKFCYRHNPDIQFSPTHTACYKQDLKRTQEINANIAKLPLQEQSDIHHIISKYSNSNDK
IRKLILDGILSTSCFPQLSYISSLVTHMIKIDFISILPQELSLKILSYLDCQSLCNATRV
CRKWQKLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARIQQNSTGSSSNADIQTQT
TRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLF
TGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDS
YQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDI
RTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNE
QETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSH
DGSIKVWDLQSGKCMHTFNGRRLQRETQHTQTQSLGDKVAPIACVCIGDSECFSGDEFGC
VKMYKFDLND*DLCVVFSWSKTSVVPRIYMLTYIMKNT**HFTFILFPGKK*IASVSLAF
SIFSFFPSSFSSR*NS*PLDAITPPRSPSHAKGDVKGGTEDKAYYIDGDDEEGVRIKCRT
RSIICNIVPSTVLINPKGEGTLLYKRARPLYIKAIT**NTYRFRNP*NIEYT*NRQEPNS
*GASFGNSLIINKKR*YS*LVLLLLSVWPPPRNHKIY*WMNL*IFLITVPTTITMET*MR
I*ELLLV*ACTCTLPG*TLWSFCTSPGDYLM*NCTDYLRTSFKEIRT*IRECILMGNKFM
PITRL*ILERTLTHIIKTSVN*ARRKTKSLLYHMIISSMNPRKMVILHLPFTRNLENWLR
VH*KEDPSPYPLLPNLYSTKLALRVNMSI*IM*ILGYCKEVKVSISIVFYQ*SCSMKMRN
P*MLANKWFNKMF*ISSISL*RD*VPLMAVVIAYL*KIYYLKTTKTNMEIHGYKTRRVYS
YLVQILIIVEIKKRSLN*VTMTVILKMTMIVTTL*TV**GNKTKTKLILRTG*RIC**TM
TTII*KQEQILLNQEPTCLLETLKELLVFTTRTFQY*VTGTVRV*NLTYF*IFPVEGPFF
CKKLRY*LASTTWL*LAKSL*KTYTLIRRLS*DIHGMHGELFMNQNACIFLMPMASYQEA
IWIFLSSPLMIYTIQMIKIAIYHNWSFVFNT*LGALIVLGRNIGTIMIRQTIKLTW*RMK
RGQGPQQTSMITTR*NIVFSETHSIKEKNKN**YCFTYTKEKKKIRIRTFYFYLKVIFFI
*NNILE*CSFCCFLYLLSFFTFYSTPDVLK*LVIIQ*NVRTGI*IHTIIICSGNSSVHEW
*RSITRLRCRGSEK*VLALSLGRRF*V*R*NGFFQIVPLPKFTDSVASLGISSTYACCRT
SYTCIRCSLRKR*NL*V**ARITP*GA**VGRWLCLRLL**I*ALVQSCIRSRQRMIRRR
LMQNWFSRII*PFNTGEVTNPLLIFIFILDEIL*TARISDFPLFQFISQSSFVV*VSS*I
VFELYQFHQMFFLPCIQINRFHFRNVRSQ*SMYTSTFNANENTK*PGSPAWM*LRLTVGT
MTVSWIA*KST*CLLDWD*RRHRL*IAPRSMLLCTVEASITFTFVTISTDLIRIIESKIV
QHEIWKRCV*VTKLNSVYIIYVPIYIYIYGTLLQFLILKHKHLVFHLGKRFGTSEPQVHG
TSSN*GNHGWRTTDQNLNVVHCSSGQVFLDDILGNVSYTTSPVFTVRRV*VVNYLKLGRL
HGHQRFQFLLQQNILLMDVPKD*RDLGSVVRVHGNSFHDLIHGRNTSTTSNHP*MGTAVS
LIMIVPTRALDLDRVTYLQLSNHLRNVTCGVRLH**FKVSLCISIQRCGRIRSGNILTID
IGLNYDMLTNW*TEYVVSMR*PELVHRSIMR*DGFFNQRK*LEVIPFGIQHRLGLRSDNE
LEEQRHDHDHDDHHKLLSINSHLRLLN*LSLLLKSQLNAYFQHFFFSFIFSPYIIRIFIH
M*II*RSRKSP*WYRFTRKFSTVTFWRVVQS*KGL*A*CTRPCPSQVNFERQSCPQTVLG
TSCTLVDQSPCRRRC*FARRADL*TQSQLIVGYV*SKSS*T*GPLPRA*SHHHGPVSVST
ARHRLALKD*SLWAYVPFQELSELQKRS*IPLS*YTPEWAECT*M*CLVMAGELGPGSAE
C*TSQSIYH*HNQKRA*SIVLWGGPGARFQSSFCSCHLCSVPSTTNSASQAASS*FSPSG
GSSRTAKFETLGNTIGFPEDLLPIPQWRPRGRPAVL*TWPVSWEDCATRTGMRLIATFAS
FSNTKSWFSQYEG*LPHYTVASEWH*AVYTSMKATG*LS*SSACTPPSWSAAACIAGNTR
SLGAQLVY*RSPVSAAQCST*SCNAGRTTVATAARVRVAGDVPSAFPHISMNA*SSTYYR
EGVLIPRLPVMVLTHQCSQFNVVCFILADIFPYYREKRAVD*SGCQKQENCNLLHL*PI*
FVGRGVE*ATNHSHQCRLMPSPAL*ARNYRKYPQVFPKKPRNCPVWRNPPKEWSRNVWAR
*RTSPNCQESTQSWKIRLTPSN*FTTTSWV*LLSTKTDRTITLNTSTNPSTSFQEAWLPS
*QS*LMLHLRLRHKTS*LLQAPSKNPRR*TTPSVKWL*TPVNV*TRCSPPRNNPWLRHSC
NSVMCRLRLLKLEFNKIP*FKPNSIKI*GKGSLLRSVRPISAARMSIP*D*DMTWQELTW
QTTRSQKRKLP*ESKWRLWKTSLLKSLKTLLCACRRLFLTLTSVKI*RNWPRLKLSILKP
RLA**KSSYPTHLRKSRKQSLRLQKKKSHRQLSL*MTKTTLNSRPVLVFLSPSLYIYIYL
IQYHIL*CRTNIIIYLLAFVVSIFFVEKI*LLEEKKLLKKIS*QSPKGKVSNPKMDATQP
QYELSVVTQCLKSAIDVIQWLIPTITKFSQSHPLVFQLLFIFFTFYVFYKLLMNFITLVK
RFLYLTLVVTCIGIYMRGSQQFLTVDLLNFYNFVMSNRYYAFKIYTLFINALEREINTVY
HLAQMKMEQLLK*SETPLLTRNILK*LHILISKYSYR*RTFFLLDSSPSHYQILSYFW*L
VFSKLFITIVT*FLKF*EKLQTKLLQAIYPVAIEELKTTAAALYQESQDAQVCGQEVCIF
CHLPHYRR*YLHLYLSIFPSRTVFMELL*QERTTTERFDFCGQSEELLQ*CSRAMAW*PC
LCR*R*GYSYFGLR*SSD*RHLAKDAICVPIRYIR**LLSWSHL*YDAAETEASGGDCYG
*SFLQSMDR*FRIP**NEKVY*QNFQKRPNFY*KYQTTEPR*ERSI*GELA*MGRPF**D
FRQCQGKRG**SRTFFWVWL*KYPLMESRLGRLFNHQHHR*S*CRLLRRRDLSTYDKVPR
PFR*GQLLD*IRNQHYPSLENCSVE*SFTRRSRFTTRIC*SYLDLFKPTK*T*IQW*YCF
VDACSILQA*RVMR*WPRH*VLSRCPCPRII*IWAFEIPKSFE*IRFKSSFEYDI*KWEA
RYHINWS*P*GL*NSL**KIYIYLGSD*KYRK*RFR*RNHS*VYDG*I*WEYWFGYRTLQ
HRFNDLGVDFQFMPIRYSTCLVVR*SVPARHHIHLVLATICLNKKE*RR*NSCIEIYIKC
MYIYAYTALQIAYVL*TLTSGFHTSR*SL*YLRL*NVYLLL*NNYK*N*KSN*KSNYTAI
STDFCCFCFKGMHIFFFYVIIIH*FFPVSIVSRAACREKFLVFVVLKLHYSDH*HCYCQH
SHHGPQTLYLPVAAKMNNPV*S*FYQLLSNRPV*KFCNHQLRKFH*KT*PHLVLKTTLYH
PLKLSNPSHLESCMQSPFLKE**QNNSYKITKTFLKF*NFLEFWHKLTMNLLSAFRSL**
YHATNNA*RPTVE*I*MHPREMVD*LLAVLRPAWKFHTYHETFCTLFSIQFDYYRVQNSL
*ILAHHLVEVKFQNHLQILF*FHLS*LLFVPSLNISVCLVVLLPLAPSLNPYPIQNRHRI
LQKLALAIYFFLLVTLPPSAP*PS*LCSQAHFGLP*LQLHVQTLDLSPRKLKDDVRSSYF
YRRPDCFDAQQPPQQPKQQRPLLLKMMRRYCQVVKTKMK*IT*VYSTHYQSCC*RWMML*
*QQQLLESLLRYWIWWTMQK*LFYPFLPLVMQQRPILIHQQVLLEE*QVSM*WHQ*YRLE
FDEYVYVHLLEFLV*LNLVIFAMTEANYQHCSWDSL*KF*QPLQALLHYG*GKMKDFFPF
LLKHQQRE*QVTA*KRDQQRV*LHLLHFLPQV*QPFWLLFPIFFAPF*KVLICPAEIH*H
PMYCYLQHFVKQNTGPPHEQWLRYSVNSNRHK*FHPLRNLDPDLTPRSNLYRPARF*HLG
GPIPHWLTISRLTPSAVDATYTSLENAYIVPFFHHLS*MTFSSFY*EVKACQFPLVGNRI
AFPAHRSFGKGTQIYLSFPFLAGLKSLIFSG*Y*SMLFLWTPSLQPYTFPSLFLQTFCNL
EENLYL*YRVSFAMILSVPLAFAAF*LLFLNPTLACPFGKDCLCMIHVFRNSY*RFLNLR
*FF*RPYRPPAVIFYEPCRSTKHTMNLQKSKFENE*INVL*IIAFDFLS*HNETSR*SQT
KRR*TKESSKYQQNALKNVEAKLLITLQAP*SVY*SVGQ*VLEITHR*K*IKLLLHKIKV
SFTSFSLSENCETARGR*R*YDTYNFNIINISMWWNNIVRQTAKSPHL*TVCKKYVCFCS
LSFIWRFDSEDNAATDALVILIPRLIIPYF*MSSANEEFVFVTSYVGRKY*PRNSLIESL
PNRGSTCRSIPCQF*ELSLRYFSN*VFVSLTQRFRMSVDCTFKLGSV*RLKFAVMNFSFT
SIWKFSHNNDTLSLMKPSIVVVIFPSVQTSLLYSEGPALLWNVGKLGTSKFVNRVTICQ*
INNIKKPNSHR*APFEIIHQLQ*NSFDFLTFLSSIFSGSLLNIF*LISFVNW*GIG*SVL
RFRVVIKLFKTLLYLVKLVCPVRPLIWDITRFTC*FSS*NRILSIAMSKITNAKYMTVKI
IVILLHLRKT*FFTALSTLFSSLFVFRDRLIIEVDDVTSVLPPDKMEISFCKFAVKFLFN
*SQSVEFRRKFKLKVLEVSN*VEKSVIVPLKFCNDFNFLE*FPKILSNME*FNSRFDAIC
EMESLSMVIASSDISFHVSFISCDLVSSSLKIVLFTSRTSLINSVSKLIWSLISFCLLSS
MSSVYDLNFSCISVPTVDSILRSLLSKY*SIVLSMNVLFKE*LLAEYMACCVVTAVIVAV
VVAVVVAVAVAVEIDAKVETVSFRLTCA*DIFAIVMSMTEKEPQIVKITEVKNISNRGWK
IQLKNLCGSDKGLIMCTLFIFAVLLVLSKSGVDFQLLKPC*CSSFLLYMLYKGPR*HM*M
FYYWAETFLKHFSIMCCYNRTRTVIILN*NAAPNENTNVLPNLLAKIKISCRLYNQE*SQ
LL*ILFPEVEIVTHLSNITLHGT*LPPSPKLLTMIIGDSMTMTMKAKDFHIVLLFFELSL
SSTFLLTEIEPL*RLSCIRICWCF*IKNSLLKQSFNWKIQKDLKRSKVVKKKV*AHTFLV
G*CLLVRSIIP*TLIPTSKKTTINVVLMTHQRS*IIRYRTLLVILLPPPPPLLL*TILL*
VDP*ILLT*TIAQIWLVWLTKYMIILLPIEIL*PHNILLQLETSIRMIGLLNPAPIQTIS
RLHTFDNSNSRISDNSHPL*KLKRNPNSTVIF**ILVSYRICIRIWPLIQI*ANCRLPVS
PLRMILLQPRLMRPTSPIRLL*TSRCIS*T*I*ITTHMP*TIHPSWKHCRHFFNLLVLM*
HIYL*RIHQFSKVLCLDAMSQLEEEEYQSLTVK*AS*AKILKLWKTCTTHSRPRCPIFTI
IMV*AKLGMYQTSRSSTKQCRLVVFHNTMQKKLLIPRRTPHWVIRALFTRKVSSEIL*TR
HQRILQRRV*VIWKA*RRLRQLLEVKIGANLHLGNLTLILASLQNLKDLI*I*RRTHREI
QSLVLRHGREQDC*KEIELQLRNVDKGKRLRSCSSKRNLTKLKTRIEFY*KS*ITMKN*S
LNSRNSPKFIYVNMKN*IKTQIIMLMALIVATKMKA*LWIH*RSLKNF**SIQTLQKWIK
ILVRS*PSSTSHTLNVSEAILTMTI*ISSP*KVVRIQTTNHYPILKR*NNKVLVSTTVFH
SRMIRTTIYVIYVYKYSSCILSFLPLLFRLVTTFMV*ITFKTLLFCMYEICSCQPLSPPC
LCCMEEAL*TCI*FFKSIRIKYNCTDGKKK*SLYRLSVIFFFLFHSLFISYFSICSLIGA
NHGCPIASLAVNLS**SYLKRLSIRSIISSLPLKCLLPSLMNLCQGFLMYWSIS*NSLGK
VISYFNRYFSKSLVPSTLTILTSWSVLLVPWKNGSLLKIIEANIVPNDHKSKE*SYIL*S
TSSSGPLKNLDATRTLYSILT**NSASPQSINRNFLFL*SIITL*GLTSLCIIPIE*Q*S
KAFNNSNI*NLISRSVNLG*RIRKSTLSTYSKTKAGVFEMGSFIISNR*IMFA*PLCG*S
KI*GLMNFKTSSF*FV*Y*SF*NGKVVGGTFSLDKSVKILISLLIFFFLTGFNILITILT
LESNLTPWKTSEYFPRPTLFSIS*SFVFVDQSITVFS*SQYSSVLCLLIFV*TRASDHTL
HFIVRIKYSFYNPLFLSVYLTS*VPIQKTPSR*LQYTEYQQYMKSLNPFYYRTARFV*LL
LKFSKRWSYF*FFAFSSVFVPSDF**RFSTT*CCCMYLYDIPAIHVNISIKTVNL*LPLP
VRLYSLPQQRKQWLRSLFGGRYLLSFRNKQFPIDFSSETQCPQLRNPN*RHVM*K*HLMD
GTYQ*RCPFRSVLSGSRITSYENSGQFLFCPSAE*L*W*LYS*NCREKKEML*LQKHGYC
PNYCDLIGFF*KALPLQNRAH*NLLH*GPRGTRWRYRLHNRDLCKRRKSHWLRSPIFLKG
LRERGCLVDPLGIVLGNKCSTKAI*TNQYHDYSRSISTPGLNRRNLSVWIGERLLKIVNL
VPNLVVIRSSCLDSPVTW*DLAS*EDLKQHRIEHQTLRW*L*SWREFLYVT*LNSSPLFV
TNALIFTFSVVKKKKKNEHIYM**QQ**MKNLEFKQVT*RYKGKESGDVIHYIYVDVEGR
RKKKGTEEEEKEKGNSCGFKIASPFYLMSCRIIEL*YVYCRTQ*TLKTTFPQCGNFGSLC
SSHSGLSGQIV*QGHFTEIIMVFQFIYDTLALLRDVHSSVLN*IKVLPLITLANDCFTRL
VDLGIQCIGKFGTVVRSQTLQNWHALQKIVIHESLLERAAQKYFSEGEPV*SPQQTVGGC
YNGGSTRAVVHKSKFPETGAWPGRVDLVVVDVEVNSTLFDDIEVVPLVTLLDYRSTFGDG
LLLQTIYDQPF*VGIQLVEQKVITDRFFQSLQLLLGLFLIVIWSPIVKIVWL*GLTTNRS
TPLGVEVHWEWRS*CLFSSMLLFFLCLLVSVLFVRV*IKPTFKHVGVWVLVHKGGFEHNT
RSGS*LRLS*LRSGK*LLWFRK*NNVLCLKFRLPGLEERSLLFQPFIEIVGGELKKVGRI
SGVDFVLEQLQFGLRFLGQRRYHRLFLLLSFENNLLVVNDLPIYVCVKCV*WM***RSLD
LVEESVKCPFFSFPFPCLFKFSLFYLPLRFAPCQQNEEGQEFWRAAARRHNKCT*ANAIS
SAYGFCNKEEVGIRAQYNQYIIRQNKSGGYNTKKEGRVVIGCFVFFRSSWWHALFFSWVK
ISRRSRMLLF*AF*KIEKS*VSKIVGG*SEKYIKSFIFSTRILFPPPFFFYFLTYGLFHL
LSDQ*SRAVSLEMTFGSLPSLSFFYLPTKRNYYTIQ*ENIVKQHKRYHVIRER*NITTNY
ITVYSFLLRERNKERDKRTLHSIPHTQVQ*YTYIYVYCTSNPTYMSARKRKFNSLKPLDT
LNSSRASSPRSSASLPPKRYNTFRKDPKIVDHLNNASTKDFLPVLSMNSESKRQIELSDN
DVDNNDEGEGVNSGCSDQDFEPLQSSPLKRHSSLKSTSNGLLFQMSNNLGNGSPEPAVAS
TSPNGSIISTKLNLNGQFSCVDSKTLRIYRHKAPCIMTFVSDHNHPKFSLYFQQSVIYNS
QVNLLDDVELIILDKKNSFMAIILKDLKKVKMILDVNNSSININTNILIWSTASSASNKK
IKSIKRFLLMSYSSSIKVEILDHKEQILERLKHLIHPISSSSPSLNMERAINSTKNAFDS
LRLKKTKLSTNDDESPQIHTHFLSNKPHGLQSLTKRTRIASLGKKEHSISVPKSNISPSD
FYNTNGTETLQSHAVSQLRRSNRFKDVSDPANSNSNSEFDDATTEFETPELFKPSLCYKF
NDGSSYTITNQDFKCLFNKDWVNDSILDFFTKFYIESSIEKSIIKREQVHLMSSFFYTKL
ISNPADYYSNVKKWVNNTDLFSKKYVVIPINISYHWFSCIITNLDAILDFHQNKDKNDAI
NSDEISINNPLVNILTFDSLRQTHSREIDPIKEFLISYALDKYSIQLDKTQIKMKTCPVP
QQPNMSDCGVHVILNIRKFFENPVETIDVWKNSKIKSKHFTAKMINKYFDKNERNSARKN
LRHTLKLLQLNYISYLKKENLYEEVMQMEEKKSTNINNNENYDDDDEEIQIIENIDQSSK
DNNAQLTSEPPCSRSSSISTTEREPTELHNSVVRQPTGEIITDNEDPVRAASPETASVSP
PIRHNILKSSSPFISESANETEQEEFTSPYFGRPSLKTRAKQFEGVSSPIKNDQALSSTH
DIMMPSPKPKRIYPSKKIPQLSSHVQSLSTDSMERQSSPNNTNIVISDTEQDSRLGVNSE
SKNTSGIVNRDDSDVNLIGSSLPNVAEKNHDNTQESNGNNDSLGKILQNVDKELNEKLVD
IDDVAFSSPTRGIPRTSATSKGSNAQLLSNYGDENNQSQDSVWDEGRDNPILLEDEDP*K
HSHA*FYIFYSFPLYFYFFNILA****QQ*NN**YTYSHK*AYFLFCSFVFRMVNFSNEM
FYKNFFSIILTIRNKTVEKHIT*CRYIYVNMLAFILNVRKKTPLTFIW*IF*SSTLSVNL
VFYILYSTFEPLNEQHSCLEKERK*L*CYQ*SEINILHPCPCWE*FVKR*SETPGSMANI
DNLLCRNIT*KY*G*NNNRQDVNYHVQETLFKQFQSHCFQEVQFTSISVSEK*FQ*LISG
SEIDH*RNDPNDE*QTLVIFKPFGITNSV*RIAKHSDGEIIVTG*YTIG*DDPRNHSSNN
RNHDSYKHHQVILHQHTIKYTVKDGHENSLTLFHIIDIINRGIVDISLWYIVFHFLYFVF
VNGMFIESVLAFCKMKNILSNLG*TNRSDTDIINVQIGVANVREFLPCNIDLISFT*Q*L
YDWKKAETTNKVY*SLTNKCNTKH*NGSK*PNQAKQCHIA*TEIWRDVNDIILIIFRVLF
V*ITKFTSSTFVSLFNSFQI*WFQQLIILCNGDKHCLYIISGYYIRRRNTH*NAIGDKIS
MNVTNLPKQFFCLF*SLWFSEKFLV*PFCILGSNVLVKQIAVNNMASLCWGIFT*DKG**
T*FS*T*LKNCFPIPFQ*GFNVRARLQDPLRKI*S*QNCIELP*NN*CWFISFRNG**VR
FEHEWEKNSSMEAKT*DNKNRINKHG*AKP**LNTHRMN*TIMQDLNIRIFWRSDKE*NT
WSNDIFPNHSDIFGKPIHVESTNRPVYEKGKWRPYCAY*RNPKHPTIGCQDWAK**EI*H
YTS*NGESSQFDEK*SEHLESAFECK*NLENQPSSRVAHSVLTAITPRDKIG*STNDTD*
G*IRR*SR*SSDEN*VLHGVFSVAVVKINDVMN*VV*NPTHRDIYFRDQFRQPIVSYMSA
RQVVKMAQPTQNNLKYTKINFQQTEPNKSWKQIGNCQVYCGENYGNYEISNDIQQFQFEI
YH*RALSLIVWVSLCWWHTNSCAKVLFVLIDISSSVLGRWWDENRSVGPVYCVLLSSD*V
IKFILRTTICPHVNRIGLYMITVICLFFWLLLLLLPLCFFIFFVVT*RPR*NS*RIIT*W
*TIVRVVVLVLFRSLIMI*FVYVAKVFKIPMVIRILRWNVIVSGINNIIIIICCCGWHVQ
SIMTLLLTIFVMSSHFPR*IFNHSIIHHGESFLQT*FQVLGR*SWTYLVENHFTENILSY
YHIVLKVQCYM*YHYHNKL*RRKRMVL*KLVKNCSRG*FWSC*LIITINQTL*EITRIRG
*SI*HHGV*FSKHVPYQRNTDNI*YSGQTNR*SQTSFFEKCQDALG***RKRYLFGHVFR
IYRFELNGIVTDVTFNIRAWF*NVYIF*SYPFQQTGFMHVFN*APAFTRMEKRIVLSSFS
TTNTAGGAGWRIIIESGGICFLVCHLMQFIS*PGDINVRINIHDFHTSSLFDSISGTLG*
KNSF*NQ*QRTILNVILWLHRSVIIIFSMSSIDAFSTSFPSLMI*FFY*IENGKKIAL*G
ARTPNLMIKSHTRYRLRQQGYFVGKTTYFRK**HI*DACWNETLKYHLFSTIHVTN*DMG
EF*DNCWGFHC**RLIILCIRNILEVLLEDLGILIMESIFLYTNITIIPHSVLYVSFSYY
IINFCISASSNLDDSFS*FTPSSYTACDAITTK*ITLEFHSNSFSLF**TQQHHNVINFN
KAKLWPADFFSLVKVLSPVPH*YDNR*INSITWFLRSRNVYTLTTHFF*KIGQLNN*VRS
G*KKV**EKMHPIFTVEPLGGFYSRIVAGAFYLRTSWKL*INLIPICSFNPHSKPPNGND
H*VCYKPAYAYTIIKIQKIERGKW*K*ILKHFRNEN*PHCFYSNSDG*RR*YSILTKSGN
SSFALFDGLHNCVVDCLRNGNI*QIYL**KKGPSF*LLLAAKKLSQLLLFFPLKKEAAEA
DLLSNNRLLTRILVTSPFKILVHKVCCSKKGLFAHS*Y*TTPCLAC**SLFYASIFCIPY
NRVNS*ILIITSGLTYF*ISWSTILPQ*ID*TAPLELSW*ASVLQLHDFTS*KNTPLGIK
TQWKSVKQNKFRFLTWPNGNTLTIEPVTKSEEVHA*LLKAVFN*FTYTIARHSRMKTCVN
ANSDGCCIKEVLRGVEKAITWTMQGYSDALFVCHFQ**CWLRYIEMC*EEILQLIAALTL
YLHLG*WPVCFPNVW*IGLIHVKLF*KYAAQP*PPG*LPIGCLR*TYYIPVVKRVFTR*Q
QLW*LKRSLMGLR*YGFSLFT*TSQYIASHYHNIG*RRTQHSCGCVW*LVSQLVIWAGNR
ACSPYSLYCLIGVCSYCWNNKWKG*RRHKWFSTTKTN*QMATFCIRAN*CKRCYHFVYFW
RWTGSFFMWRCNRLCYCH*NCCYHKCTFRDY*GDQGNSYSLFITIKCRKSL*RIKNSSRV
VNCFSTVSIGLVPVPICVTFVISAGDNTYNKRIHDIITAFIRHLTTSMGVQVVENYYLFL
K*QNESSIRACLYLRMI*TSSTYANMRMNIVLILCKLE*KYSERLSIRVLALKPRLSIIL
NRRFYH*I*CVFMYLNNKLSNEDAKDTIRPVILLKPLKLMVHVIEHRRRLHYW*F*YSFL
FLYERRLCWCK*KRCLVT*RLILCSYDVRVDSLSNLCSKSS*SSY*ILICIYV*NYKF*L
*FSVSYLFFFFYSVRGPFPANFSLHMNVNKAWSKYDLTIRVTSYQVIHVGGFI*CDFF*I
VSLGYYLPIVTLNW*IL*FLERSEHCKNKEYQSCIRFIHDIFR*LADCTLCIIKRVKF**
VMKLIA*ETRMK*HQCRDCIEKLGNKRHLLIIAFLYLGRA*LRSLFRCYN*HA*QLSELT
LFYIQK*IFLRCVYIASFRRSKGRFDDD*MGLENT*PNIIQRV*SNAKGYLKYL*LIKNC
*RSYVCSKERCDIYYRSYCFTKEQ*V*RISFPLILCDFVAVVYSIYHGWVFLNWC*L*II
LRTFFNRF*IDCHGNIWIIIFSICMVGFSFTVGL*RRFFPLCLI*FCFLYVLFIRFWIFH
YGIIYDFFEQRAKLFFV*CHTGSKSFI*NIQFH*SLQFNCE*KEFSFNILEKPGFRQII*
VGVFICYPF*LDVNLLSEKTLQI*KYFQKHFGSIIVKVKWKLFTHTISPCCSVCRQFELK
YFYCNDYIH**SAS*PF*VKQAVYVFKCFVCSRQ*NNECV*TTYYSGNWFPN*SKIF*NR
ILVIPYFLYYFSPFFQIPCG**H*HFKVYFLSGTIIKILKHYRDTGNKIVQKQLQQLFIN
LDWVIPAKNCQFIDVELVQRTS*IFVVVPRIIWIHFFL*KFF*MNFQCSYLV*KFFLQFL
FFKMMDMVNEFSKYIVLHVNF*IPDCRIHKCFNSFVGNFF*FSFISNRYPIIQRKCDKAL
*ERTQNISRFDGCGIQQIVE*RQNYFLNAVLSLDFGVVGTCTQTVEYVQI*NSAISVNGK
QWSDVQFLIVNILVIAVIIGRVL*LLDQFI*FSVRDQQIANSFQVSGNVRRQKLCCLC*H
TDLCP*INFSAILQVIN*RVIQNLDKYTDLNNGSNF*PVDFFGQVFMRLDEFVKFLFYYS
C*EFGHRG*KFGSFIE*GCFKWVELFIEH*TRNDKNLRII*IAQ**RLR*NLDTMDPYIK
INVTDCHFQDLSFEAFKYLAYSGIISGFTVMILDY*MR*NLRNL*SD*YRVIAQQPAKIF
*KCNLEEIFGIVFNPDG*MQHGF*TNQIRHVLIPMHKT*FDDVIDNAINNDFAALSFGDS
AL*LF*SLVIGPFFLLF***LLG*LRQIILF*INSLLGQIVLEKI*R*RRNVSEASDFAN
*KRRQPSQQIQHKITSNYLGIIFVRFHV**L*VICHFQQFSHEFREILIKGTHFKVFSLF
VFLANQEVKFVQFLSLK*QLNFTNRFVRRFIAVNVVVFDASDGATTIQ*QIDKFL*KFIS
IFRIGF*PFSQ*FFNRNIF*SG*YIKQFCRLEILRNF*VLILIFFRAVISRRMRYRRLLG
RSRFFLLPFTTGI*C*FGLSLSRLSLCRSGIYVVIIILVFIVILTTTFFTFTSILLFFFF
MLRFGSDLIRFYVLCAGVLLVIVIFLNNLRFSPYSS*ATHSSHVTFVRALVLRSIAFLYY
FCLLEALFSLINIEERKQKNHLILRVTRRVAVRDESNRISSRQDKYELYFMLCWIKHNYL
TCVLIV*LTLIYSPIGSRLLFFSLRNFALMRIDNKCLKTELRRMSRLDV*LLAMYQYANP
FLFLF*IDLPLLHKQ**CQIFCRCLLEPVYLGG*QR*LFHEMRCSPCDISEKE*IY*KYV
YLNHS*IEKRKLKYIYLS*KKHV*KSCLFVPVRLDFLGNAH*PI*RLFPAIERLMEITLD
GCIHVFVLHIRIPAHYLLCAA*VTM*RQVDIII*RVVFRFPFCGVGPCMW**RYIHELTG
LIVLKVENIVGVT*LVCDSVEVVESDPFFVVYHHFEHGATLALSSGNLHPVVLCAAVILQ
NIIGMSPVIEFSCNN*FICLGAALDHVFRDHK*KIGHL*NSCARL*TDQYCSCLCFFFVL
GQR*MFDLI*LSPVFALIEIRGSVGTI*GNKDIYYKGTYIARQVIQS*INAHP*AP*RQI
LQK*RLAARPTS*TLEACYRVRSYVRSAVQR**WLCI*GRPP*TAA*VQMRSRMKTLLYG
CCSRFRSSSSQWTFQRRRRKLSPLGLLSLVGT*THWKAEWRSHLAHEGSHGK*QLCWSLC
QLVWNYRMT*PALCHP*CDEQCRI*HSDTQTC*SPLSSLQFVVEYDYENENVCCRHRWTS
LTEYASFYPESRSL*TPEIWLLQPL*HQLRR*DFQVSRVIKYHPGVFLEKRKLVRTVSSW
HDRSCAVQEQTVRKDTA*VV*LG*PQSHCNGVPGQRGGSAESKLESKKWILASKSRNFAW
THGLPRGHDLDYDVLHGTPLGVQCLANKSKCATPSCFFCFCSPSISFLFSSFLFHLFPKT
FFFFSLLFYGKGMNNNPENYILEELAQFGSPQKFY*ITYKLCIRRNSETKYLNRPTLVFL
YDNFLSCILFFIYF*KLSFFGHNIKFK*RR*NKKKRTPRLIKQN*NIMIRYFFSTLFKLL
LTISKLLTCKY**R*QPYGKPCSVTRPGVFFSFFFAHWRASVIYVKEDWLSSMGFGTRFE
STKYNKPASKQKLG*EGRTELIVFRFFIPEFFTTAAIAISVHAQIHFYQDVRHEL*DTNR
KVQIAVHRITRCPSIILHLYDPCARWKPSITTPDFPRYIQEGMGEVSGTAGEHKDAARCF
GKVRRV*GLQKG*GSIFESSERLHNCG*NSEKDR*DHGTYSH*GLGVRTR*EHKKGGCRH
GEEAG*EF*ASETDEDLQGSLRSH*RWGEFPIRWVYHERAKET*T*ERPGLWEKTQGSKE
Q*RCRNSSGCDKYRV*RIVW*ESGGFQGENRGWPFYTIFKEQIVG*K*KPLNCCHEENNQ
QSGRFLCRNRILPCLQSI*ANGPNLFERKLHQTLKRIHCSRDSRSVCERRCQSSQKMVQR
GAIQCLRRPTENLQRTGCLRRWPYPRYQGR*NSECKVIGSPRHPSLGGRV*STRNQPLQE
KENWRDCGW*RS*YLDELLCHGFHQRPRANRR*RNRRVEDLGVCARGF*TIHLIGFDVLF
CFLFLFLPIPLVNNSVMSHLRSPLFLLEYCIK*EERKKEIISQYI*TYDTIYLI*YHLY*
*YYN*YFLTDKLRNSFAMTKFGFREAKWKKMKNKLIEVVKNKLCVCIYIVSALAVLWKRE
TLFISGAKASYQR*KTKTILKNE*RRSSS*NKRS**R*RRLYTIQCGFGYGQFSP*SHDS
RDSHFSH*FSRSRNKYYGFGR*IYCTQIRFNTSTKYGYRTTRIQS*LFL*GPL**VFSGV
NIASVRRKRKYYKRLQQGLGNCV*SHGP*YWASYYTR*RR*RCSYL*IEKRSRIETDMRC
EKGYSQRARQVGSSSSHRVRV*SLE*AQTYRLLV*TGFCQRMASV*KL*IRRSSKRR*PL
RL*GSGRYILYECRICGVYSR*SSCRQRYRYITEKGCLNIVSSDTDGSRQS*FCIG**QH
RFKYAGK*RRRNDDGR*ARSLLQCISNG*YWIRRV**CLVVLKWA**RKKNK*TNRK**E
KKSFICMYVSL*LVL*VL*SKVRSKQKRKKKMKK*KEGLTLLFIPSTAVFKLN*VTTKYI
*GTTECQIYFSVT*FVY*FQIINTFGPTSINDFQIIVIFGPFEKLRNQ*FIDTTTQTFNV
CSVN*KLICIFPQFSESVSIKLKIS*SLPFVHGHNPTTVLGFSTA*VYNNAVFPT*FCQS
F*PF*LKMTLFCK*PTRNNYFTGPF*PFQTVRIINSSAHL*KLW*LLECLACSVVIVRSQ
LNNMTSLDISVFVKFSVI*RRML*YKVSFWNVLLFAR*RSTYNLFNLSIMQVYTTNKLRH
FFLVYTPSLLMRSFEDIVNLQARILKLFRMTLHTRHGSILAMDPVLNFRHSSHATVPFLE
KF*AMR*VYINDGRNSYNNIESTNDPKAIKR*PLMMTTI*NKWSFKEKLLKVSSDL*SPW
GSKIKQKIYELK*IPETVQVMKLTIPIMVVISRMVL*KVLILLMKIAVTKPRKKIIKIPN
RKLNQRSLDSTGLVTFMFLQVRRHRNF*EAAKL*LK*TKNWRVLKPRKKKKMRLWRRKIY
KTTWSCSNF*ESLTY*ALSITVEVVLQTVVYR*LYRVWVVEMMMA*YTRMIKLLGRPDRV
HSK*D*IDSQG*MVIRTK*ISWKKYPCILEEE*STSTSRESKNTNKKLQKVELFYPK*KR
DNSEKLNLHTRKISRGVSGEALRPGIKKKLPKGNVV*RSVV*ADRRGMD*LYPKEILLVS
VEARGVVNLMAKRNPVARSIVIP*THKQLA*ETV*IFMH*IDHK*ERKEKLLSFYFSSP*
EEIQISFLHLIQSDSQSYTYTLYRLPSFQTRTHTLFYKPRQYTIQKPKQLQSIFLHENFI
RNRQPAREKKKEFSKERLDREVVPVYRLRVMLDTKQFPA*TLCWMGGDFPPGGNTPGGFC
SGNYAVHATGFNNLSYLTKVDIHILKD*VTIDKSTICHKLTKKPQSY*TMGMFLLYRIIM
ANVMKDSSMT*MF*IGTFYFQYPSAYYKAT*QRTRKLF*CSSSKRLLSGSFKCYIGTY*N
*HITLMNDVGYQSMRISLSYYFVS*QQGSVALNAAFYFAIF***KNFREIFTNRIENFFP
HLNR*SYS*PKKGCWFYLHLSHQIKTRCCQVENFGLC*TSWLHPWYR*ANCPRLR*RCSI
GQGCFP*PIQVQIT*RNLHC*RRCSHWSIHLRW*KGFFERR*RLAIGFCPRRYHCLQR*R
KAR*QRCPSQSFW*LRYHHWSQPR*KQNQSQITIRCQEGYLF*RQRCHRCHCRWW*S*QT
IVEGWSCFPQVQIEEKLLAKDPWCCHESS*SPSRWW*PSTYW*GFYYL*RCRFWSKGWFD
CCQKNRFTTWFSKDPRLIFLILVSSFCHIILSIFLNII*FNPKRSL*SDISMHTFFSLT*
E*IQPATSYHRNFS*T*ACSYGFFCENTI*KTIA*INCRKYYEFCAFI*LSKAGPCDIVT
FWPFP*QIMIRL*YFF*PDRIILPPRVFYIFPPWHVLLVHLMYYLLQPGCERTHRLHHHP
HHYRHLHHHSHCYCYHRHLAHRSISP*NIHQPLIHYTRLSP*IEGFLNHLVNALVPDHFQ
LHIGYNVKLMNSKVSY*VPRGMPISDCCHYHYLNYQSLFLPIFHS*CSIFRLVR*LAAFY
SH*LPLDSR*YIGCLPLLSFVECLMDLKASSSLQEIRKDTLSRC*FYYLFEDRSCILHL*
IFPKEYLQFSLNYKSNF*ATENIGLVLPNMDH**NPKLNSSGFWPKAETSLHSGNCTLDA
LVPIKSLPSLHAQVCLAMQSFFHLHYRPRLFLS*TMDLLTSFQLYRLYRFSA*MTVN*RT
PPRSYKYYPE*CP*S*FPVS*NLVQQNSIPWSTYMFYLVSVKAAVQFYFSSTSS*ALKHF
SRMISTIVTKLPRNRDHILGVNT*NDFP*LFPLSHLSKI*NPVSK*CGIPTRILNDSTTM
CHSTVKDGIFRPMLQMTHIF**IL*LFSK*LHCVVVEKDTAQNGIECKI*RLYELAW*AQ
DYSLE*FHYTTQSMNPAYRMDQTTKATGHN*MT*LNRVVFSRVYAYLPISYPL*STVVTK
TSGPRT*C*RHYSSKDPERTS*TSHHSAVSYHPVSYNDILDIEGVPMRVN*NHTCLRY*F
F*VWHGCSRPLYCQTDRS*RWMVTLAWILLASLYT*GLFGPSTSMIF*LLCVQGILPF*N
LGSVKFLSLLSLPP*TCSC*SRCNFSRPQVKTTSIIQ*S*PPHQFYICSSKIYG*LTG*T
RSGGIASLGIRNLDKLLHTNLEALCTYSLSKNYF**NCLPNSWTYRLRTQYQSNMCLLYP
FVAVLDVKGYIADLISHFLTLHRHFAQWTTNIEKSGTLEPKSNLP*PTGLPPGNY*SF*D
SLGNKPPS*CNCNISPI*HEGNDTGKLQVSAMKIILLGRSL**YPYKTYYNLISLVRAPS
V*SLITDDEYKVKSFIHKQNHLCYLQFNRQACFFKSAYGLEGEP*LEGFLNGRLVLI*FN
LPLLSFGRY*KKISRTDITSRKKDGISSVVLVSILFVGEKIAPEGQLYVSVMSHNAMEHW
KSKLSKTSTSTYVLLAVIAVVFLVTIRRPNGSKGKSSKKRASKKNKKGKNQFEKAPVPLT
LEEQIDNVSLRYGNELEGRSKDLINRFDVEDEKDIYERNYCNEMLLKLLIELDSIDLINV
DESLRRPLKEKRKGVIKEIQAMLKSLDSLK*VCIFSL*ITALAEFIGCTHSGTVHICCIY
YIRDALSLFFYLRHHAETWHVITVKGNYMASVT**RQ*HVYTASYSETHHIIVIECVCFL
ITV*K*RESTSSLVMMNSLMIFA*FNSSGSYRLKSYQNKKSV*KGHIMSAINHLCLKLIL
ASFAIINTITALTNDGTGHLEFLLQHEEEMYYATTLDIGTPSQSLTVLFDTGSADFWVMD
SSNPFCLPNSNTSSYSNATYNGEEVKPSIDCRSMSTYNEHRSSTYQYLENGRFYITYADG
TFADGSWGTETVSINGIDIPNIQFGVAKYATTPVSGVLGIGFPRRESVKGYEGAPNEYYP
NFPQILKSEKIIDVVAYSLFLNSPDSGTGSIVFGAIDESKFSGDLFTFPMVNEYPTIVDA
PATLAMTIQGLGAQNKSSCEHETFTTTKYPVLLDSGTSLLNAPKVIADKMASFVNASYSE
EEGIYILDCPVSVGDVEYNFDFGDLQISVPLSSLILSPETEGSYCGFAVQPTNDSMVLGD
VFLSSAYVVFDLDNYKISLAQANWNASEVSKKLVNIQTDGSISGAKIATAEPWSTNEPFT
VTSDIYSSTGCKSRPFLQSSTASSLIAETNVQSRNCSTKMPGTRSTTVLSKPTQNSAMHQ
STGAVTQTSNETKLELSSTMANSGSVSLPTSNSIDKEFEHSKSQTTSDPSVAEHSTFNQT
FVHETKYRPTHKTVITETVTKYSTVLINVCKPTY*EIWSTISL*HINIKYIVIFNTWKA*
*KNKGSFTDIIGIYKTK**YYAAITILNK*HIIH*INAKKISATGN*TPIWHATSAHSDH
*TITEY*M*YCCISKCDTSI*QYVILNVRKTHMKQPYNKTNNMR*NPASPS*TNQTYKCL
NN*FRSKIPRFHHLV*FIFYTIYKISNIP*IKLIIRFDSSLLP*DC****DCQDTPVLLE
PVIQQFFHFTYPLYFMYSKICHLK*GPC*RKTLLCRNVGIKIHYFLSTNSYTINILSYTL
LR**HNL*EAVIEVRGS*NTKIDNVIG*RNI*NGMRNNRNISM*KYKFHFEDSYVLEENF
QYILYT*YYKHLSTMEPPTIISKFTHFSNII*PLLTTEFQQLSNYSLNGQESPGRGVLSS
VKE*LSQYSPAS*THWVAFSKVGTR*VAINSSVQPFIADTFKT*SPNIGLVV*DR*LISG
VAFPQIINKFADSLLIKVVILG*FMSMSISFQKNRLLNKTGLKLQFLNFFLLSAFSSVVS
LK*YIICA*LLVRSSRVNVWKLFATTF*MISFMR*SHLP*NTSFYGQVGKAPH**CGDHR
FKSDWKQFFFFERESFSNTEE*RSIDNANYLNDLV*KNFEEELF*FTRKKWQ*STL*FGI
IVCLST*IVPLELIKFLSPSHEYEEGC*GIKDSLLKLFP*ACLNH*NPED*S*ND**HCC
SLYSFLISFSLPVGMLHHPIN*TTMQARGQLLNHLHSIGLKNDNTK*DPKT**TDYLPTF
CPF*VEVLTKNVYC*GN*EIMK*RRVTSAVTFLKYYTRLIPTGTMRKLQNFIMLMV*ITR
WPHC*GKD*DLMIIAFYLVN*ILLQYLQIQP*ILMICKTECFHF*RKLTRNPKL*CGLLS
QT*QLERQFRHPRLIWNHQTLMVTFGPTGIG*AKEEVLF*LLLKRMFLYF*NS*K*WNFQ
KTNYHSK*YPREMNYQQSLLLKFLRPLKKRNKGST**TARQCLTLILLIHTFLFFRINGS
PLCSTHLKNTFCWMQT*YRL*GLITFSTLLLTGRAGYFCSRIGLWKTSKLSNTASKC*MK
WNPLHKNADLLEVG*FLIRHYRFLPKPQKKHLCITIFSKNYDSIMLIVVWL*SINLRN*M
DC*CLLC*IWMENCRGVCMVTRKYSGWGNYMLARIILSIPLMAVLLDLLMKSLKMMTDIK
AGCTTFVLRRLHTVTPKIDYYG*TVD*RLVKFRTVLKMTLEESQSILRVDMGTFQN*KGY
MMLR*T*RD*SFLTFLFIHGCKSRNVLIICIVHMLRVTDTQTLNLTKVV*SRLLKRNYDI
SMIFLEPGMLIEKKKSEKEMRVLIFIKYGAYIIRKMIID*FRI*FGNKLTISLKQKAAG*
GTRTVE*Y*VILNVF*RNAIH*LYALFVWIMRCFGPPH*WDTLLYTINHRRPNFFDVG*V
EAHKHGGNVKANENPFKTKISPSVMITHIFLSKEVIPNSVHAVGADGVCVIDVQFPTKFI
NKGFHKLTAGLTHYRLAWYHFTCRAVYFSVMEK*AYESFNEIRVW*NPVHECPKSWE*RV
WLHNATE*SCETIEEGNKDSGSL*IGGRI*KPQPK*QIIHGK*NIIQVKDTSYTGRGFET
ATEVATQEK*GRTGNG*W*FNNSLSNQKNGPMISIRSRFPGDIYFFRLQSLILNLIDQRG
GNTKHHEAQENSILQTVDIMLCPPK*KSNE*SSASIQSIFSENIGHVSLGTNVLSLCD*L
YLFHIRRRTPYGRSEINTRFPGFFF**KQIISNPHFFWRGLPEFCPVN*IRLLMVRYWLI
NFA*GWLLCIIHWNICTSATNNVNNEISRIIHFSVKC*ASIVSYKIVTGIR**TKIDTLT
TSF**IDVIKIADDTFARLMNST*DSLTLHRKLFQKLHDG*SCFGV*P*SRFI*E*QQRR
LSDQFNTNR**FSLSWR*ISNQFFRRQS**VANNS*IVSIPITS*DAGNFQRLSHS*EL*
MNILLLNEPYTSSECINIR*GLSID**FTGNNPAFGPLRQDIQQSCLTSTRFTH*GS*SG
TYISRSVVDQFFVSNGIIDIFPGDDVLLRFHSYGFLSMIVNSFIWMFNIVISIVLMRD*W
NRRG*SGKIGYRGLGSTYAIVVGNSAFIILFLAIQKGTVSFEIVIPAQ*IFSSKQRRDIF
RC**RAK*EETQKPNDNTEISPHVMVSVFQSTF*IITASDVIVT*GSALPGTSFMTE*NI
VIIFTSGNNTFMTV*FQVKQFVTQNGFHGKHSRIQICNPYEPWMHIFHINNIGRVHGNG*
Q*DTGQ*VCH**SWSDQSS*CK**HHAKIIDGKEKQKDEKPSCIVL*MGQKVKYDCKNNH
QYKFRAAIEKICC*SFHPIIIKMELDMFTNDGLPLKGSRHVGERKKCKE*DGKES*RSSR
KRTNCCQGNVIKKGPNNQRLHHNRNKLRNQVVSVTNDSFESSYSARFQLRL*RNTKNGGD
IIRINIFSGAFLHCF*SDGLPVFIVWRLNP*CMQICFIIDV*SLIFFRNNRWSVKTNNGI
RRFLELKI*D*C*IFNNTIVRVFFYL*GVMKMG*TLLHGSVKHLEGIT*HKNLVKLADNF
VACLRNFNKIHRSCSFCHLLGNGKKF*GGGRVQTLRRVVP*VNRPIGNKRFYNGDTFPFT
SRNTTNVVITHIRLLYVRQSELF**LVSHFNTLLLGNVKLTTQRKINGLLHRQIREVNIL
FVIINDLMGAFGSKLFVLIVFESNRPFRRVFQMLVTME*TFEER*CWVSQY*DDFTFIST
KSDITNF*MAYVFEFRCGLFIVLNSTEGFFQLNGSPIKGD*SVRNWIKIFGKRHPRGVAS
LILLYRV*L*IFLLQYASSFYQPVYELMRKGFKCVIILLIAKRAESFTMLYVVLYR*EQD
LRKILRTVVSILPMEESLFPNQEIRRQEKFEAKQKPQHNGVKVEGTGPKR*SGSCRKQKW
PSMWRFSAVNSVRSA*TKTDGEGCGGISLA*RMPGTVLDGAFP*RLGET*VGETEQENSR
DKVHVPR*AVLRTANISKMHKGASKWKYNDRRISVCKLECVLHHFHDWAFFLAQNVAFST
FFLYAERESSDRW*NLEPN*LIISFERDIGFCPTSPIRDIGLIRGVLRLAGKKISFVSEV
TQKL*LKAEVGNVCRLQMER*ERVPYRFCTRFLDMRALRRPIVPVYHDFCRLFFRRP*NG
LQISV*EGSIRTYEYIYTYILWWRV*AFRLLFLSLLQIFLLVV*FFLFSVPQIQLFNRPH
TTMSFTKIAALLAVAAASTQLVSAEVGQYEIVEFDAILADVKANLEQYMSLAMNNPDFTL
PSGVLDVYQHMTTATDDSYTSYFTEMDFAQITTAMVQVPWYSSRLEPEIIAALQSAGISI
TSLGQTVSESGSESATASSDASSASESSSAASSSASESSSAASSSASESSSAASSSASES
SSAASSSASEAAKSSSSAKSSGSSAASSAASSASSKASSAASSSAKASSSAEKSTNSSSS
ATSKNAGAAMDMGFFSAGVGAAIAGAAAMLL*LSLINDKL*NVICKKTNIHFLNISILF*
YTVS*IIQT*FAFSSHFFLYSCNVHLAVH*KKECSSKSMKSTDGCAM*QPSRKKRYRKGK
RNIIVITSTG*SNTTSFIQVILKFLNRMGEALRRSTRIAISKRMLEEEESKLAPISTPEV
PKKKIKTGPKHNANQAVVQEANRSSDVNELEIGDPIPDLSLLNEDNDSISLKKITENNRV
VVFFVYPRASTPGCTRQACGFRDNYQELKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLS
DPKREFIGLLGAKKTPLSGSIRSHFIFVDGKLKFKRVKISPEVSVNDAKKEVLEVAEKFK
EE*SLITPFLFL*RSTYR*NIPNPSLYICR*TKIF*LSHTYKISSLQKVINIYIQMGKYL
TIRLDQYQISWPGLH*ERALFLWTKCCLGKF*SETLLENLLRRLSQHRQ*SLSNWSSQM*
SCNYESFQN*IHTLGKTQLSIWCEESLIDAYTL*SQTL*NFVILAKWHGLVKIVGLICGS
AKSCLVKLGITWPEG*Y*SCSELSSINAFIHGCRKTESVGFE*DSRITFGIVYLLSRFVP
RIYSF*FIIYGQLLLSSFIFTRYRFTNCSHQLW*KNLRDGELNPDLARDKRPF*PLNYHG
FVSMKISFICIVYVFLKYNENLVEKC**LAV*NVSFVEISTNYHPSTSTHTTIEKFVSFV
KLLDTVAVEGYSNRHTKLAEVYLGNISTKGKRYFLIIIL*FLFLFICFIILYITNTCI*A
FIKSDGYISIFLSSFYSIYGNMLVV*ILVDIRK*IFILKWICLI**ILLADFSTTFHVRF
SIICKLYIFASAIP**RLMRKLQARHDMDHNPVRT*RTEKP*AV*LIQNSCSQFGPSSNL
CL*SMERAVIFMLV*FLPVSSLPSKNSSRSAKGKQKKYQREETA*KPLFN*RNPLTSAKN
LSFILFLCLT*QIYFLG*CQFYLARESSSI*GGNEVLVYLMILTINTSRDGW*RTQLML*
FWTTLFLEKLQALYAVLGQERFDH*HNRITVITCFVIIHGL*VMT*NNRSEKMKSKAIIF
RGTKAQGFEGVVK**IIDNLWTEHRRI*RQYKAINSLRRAPDGRILSMLFLANSITFIRK
RKPPKSYAKRFFVLDYRRKLVTFLIKNKR*LARKGHVRYQ*SPI*DQISAFKES*DLSNP
DGRKEVNKRIT*PLR*FYT*HDLSKERPTPLKGFCSDFVKYPDHRR*LFLLSPNDVLCHN
KHFFFLSSLQLCFENTTSKALTPTPRLNHHIISNAQQNIRNSSTIERQKFTGTNHHCLQA
STHLEGYVN*INKTRNFFYIWNFLCILVIPPLQITKPG*KTKIMTLMIP*LTYSKRSNHP
SDFCPRLETGML*PLLSLQLTTCRNEDTKEKSLLDHFFFR*RSYLAYCTQVIIATSECQK
LTK*NS*LCLSSRIGKRKNRLRSLSRRNFGDFRRMIPAVFGNILFQVKAFYGH*K*CRSL
RLQMKWPTQTNQAQHQLQNRQSKILKKKNIE*TFRYLKALKLKVAEALAILFLS*ILARQ
HRAKLQNHIFQFSKRSFPELQSK*T*PAT*LTFFLFFFFFFFFCYLLSACIKARLAY*HF
ITFPLFLKLT*AYINVRTTLCRSR*SC**ARDCP*EKC*SQEAALN*TIELVSIYAV*IC
PRVFQQGWKTRWYGLERCHRDS*DKENHCEKGRRQG*IYRKDMAVL*NVTI*NDDLPGTD
LGDARYGPWAGKNRHQAQWRTQIPHLRIYFP*MDEDFPWLHIPGYPRSNRV*YFG*ERFD
SLHG*NRVCCYFH**SIIG*NDSAFAIC*RYQISYP*RTYRPQ*QKTKRQTLQGC*GCH*
*DQRS*ARHKNL*F*RSCQDR*KK*R*GQTSST*AKRFGLYHVHLGLDQCTKRCSIDSL*
YCFGYRWCRSQRLWMDRLYRPCFVVLAIGSYF*TGL*IRSLLLERYSWVR*C*DFD*YFD
S*L*G*PG*V*AYYYDRCGCRLGNCEKSYFGKDQRFNSRTPKDFLVCL*YERKECTMHRV
FKSYGLQESQTSHRWSS*VYYERWVCDQY*CSEILFYRPVSYDYRLRPY*NSCECLCFGA
*SFRIWYSW*SCWIGHCQIGGC*GPRLLCKKQSR*IASKGCAGLF*IL*ESNRNGGLFHL
RWMVSYW*YC*MDSQGTT*NY**KKEFG*NPKW*IYCIRKVRICLQVKLLCEKYLCLCR*
K*G*TGGYCGTQPRTPI*ICCQIAYYEKG*RHRKLYP*QSITKCCFQRDDRNSQISRFGW
Y*TIMWYCFL**RMDT*KWLCHICSKIKEKRNLSRC*IRSRKGLQRKFLERSLLPSPSIY
ARCLVLP*STD**ILKLCA**MVLFYRCGKSIIDILHNIQTCFISVIQITIV*LKNIKNF
VI*NHILLLSLPHERYTNYSLFYDFKSHTESRLEKYDYCRSDHYC*MQIAVLCSSLVLLN
WECIA*NINLNKVLFVSAWLS**QIVSTLM*EIKAIVNLSKDNHSSSSTINIIRITLMVY
FSFFES*TLKKNKNARHTYIF*KHIFYD*L*QKLALGTLRLFPTKRYQHLLV*SNLLNQG
FSGVPCDGHQMPSVLQVHIYLYITILLTCIILYRDRG*IQLISHTGLCSFPSSQSYLDFF
F*LHCRPLRQKKYNDKVMASHRPNEILLADGMESSKIPKAENNTDF*Y*NEIG**QNRDG
KRESGVSRWT*CYFWKTKST*N*DGQRRSCHSGRFD*PHCIYYDQ*P**R*YLHRR*FYK
TRYHHINQRHRLGARRRKRLHIGRR*HHLFYFNITWWLKIAANNF*EAATYIYIKCCTA*
MNHKLDNVGNMQIV*KVIVITGLVFFST*RRL*LLYPTTQKTSTIPVSRRC*RCL*DLPF
SQEKDGKWPVFIFHYNHLNVLKFRVVCRMHITNRNQLIINLYVCFI*RATGYYLTDKCKR
DGILNSLIVVIPSCILV*LNVHIIKVLV**DV*SLQKVI*IILQHINILSDHSDLQYIDI
RTRIPVWRHQRRVHADALLLKHTEIRL*LCLNICL*NHQFRQFEAVYLTNS*C*ARIYLN
IGQQFT*FFFLHCSSFLF*FLLLFTLVITFLSLNAEHFFSLYYPIFQPL*SKPYRTQSTA
HARDSKFRELMNSQ**DPY**RS*IPTFM*ASPKGPLNDSHNMVQ*HQFLGVTHRPSA*S
NSEKNLYYRLPTVIVVRSTLKAAVFSTMTQTDNPVPNCGLLPEQQYCSADHEEPLLLHEE
QLIFPDHSSQLSSADIIEPIKMNSSTESIIGTTLRKKWVPLSSTQITALSGAFAGFLSGV
AVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGLVPIVLGYFPTW
MIYFSVYEFSKKFFHGIFPQFDFVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSNLGEH
PTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLFHVAIHFPIYEDLKVRFHCYSRENNT
NSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGL
KGFYSGFTTNLVRTIPASAITLVSFEYFRNRLENISTMVI*SLKIHTRHTLSVL*ICLR*
YFRYYSL*IYQIR*ASLFLILKGFASNSPPNALRTHYIHPHDSIDKIYLYIFIVLTIFYI
GRFLGTILAYPYQNSLFFKYYF*SGNRCEQMNGFNLVR*RRKA*TSEDHSTKKAPVLFLV
LILISLFIFLKKFYPGKKNTIYKN*L*GSSHENESEKARSYLLLMHHLSAEIHYSRR*TT
RGLSRALKSNKLQRRAI*GAAYY*LL*SILSALQTFSTCLDGNMGGV*RGEQNTEHNIFT
G*LHRERRFVWR*KY*ILP*N*TL*PLRIHQIVH*NTEDQRIINCICTQGVYGPK*PRY*
SGFC*K*EPVSRRL*FSRADRW*GD*ATFGFLLANKRYEK*R*FTRIQKL*QMP*IPKDL
EDHFKTVSRG*YQHGPR*LRI*SNNL*RTGLWRLGENNQPQSR*RTQGSISPTQ*NLK*F
VRLSQWLLSEVRWLCRFCQEDFYKQ*ISQYNRRGARKKSKQRH*FSARKGTSN***YPFS
FFI*PRNCCY*RF*HFGVFNRAFVKNSKHIFAPN*QESNKFVT*SFWKNV*KDQLRRQPN
SKGF*QRILYYEYGYATPNFFHV*RW*SHILCFPRILHNRNEKY*CHYGLGKKVF*SLSY
RS*LF*FEKINFLPNQELQ*FSNSVNK*H*PQTYQRKQQAY*KLAPRKLGV*TYSDGK*L
RRN**EKGKESRRDQENKGKKGSG*QNC**NA*RDSPYGSKKIVIRIFRYFKGEEFF*KI
WYYWRI*NW*CDYH**IK*LLLQ*R*FWQLLDF*QPSIAERSIRVLKYSIKSSIQL*VEG
EIDKFSIP*CPQFPRHNPRERHARLLNCYCFVYRNTQRSIYLQKIQSKETL*GEKERCRY
PRKYGEKKKSRLNA*VVIKIKEC*YLMMLS*LSFISRINIYNHLTNVALILSLRFNVQYA
NIYVIHTQKNSTPTIKNIINHVFILIPDLLAISIMFPKVLLSFTEVLWKVSPSWSIV*LL
PLISSPIFNDNDLSAFIL*PIAPICSSL*DSRDAKVLWE*SNLSVLPSADDTLSSRLFDP
SAGPNNCVLPVSR**AFPPANLYTHAIVSKRSSLVVNNSQYRGVMVDV*QKALL*L*NSL
IISHTLNSSV*PSVVRLFNHIF*HIHSLK*TTVCFLPFLGKRRELKKLHF*QLLDTFAI*
N*WKKEP*TFLRSLQQR*SSIRQLACINFI*DSATL*KITNTFPDMSPLQIFCTPHR*E*
NISLNSNLECTEITGNTITKR*LRDLWFLSQSKHHGFIRYYLEESH*TAHRASNSKMERN
RKASLVMNVLHHQNENYTHASRSTQN*YDYYN*AWRNRR*AFLRPLWQE*NISY*SFPEK
VVSVKVR*RHRLR*LFAVWASKLEF*ILI*QGHPYRGCLA*RTNLYIKVLKVGNL*KWRQ
TLLALLV*YHWGFY*VIEGTA*YGGVLRRLL**NNSSLTSPGVNWITY*SIPLRERRMNI
YRLQRS*DIPNQMVVL**LPHRVLQQLMSKKKSISARRSI*RSSV*LKTCQGLYARIVLS
VQISFPVGVVKDYRSNFLSHTLVTFL*IQNL*K*LRIKFQVKKRL*KCTENHLFVPFLKK
**RN*GNKTLQPLLWINTSNPR*NLQNKILSYACTYIYIYVCVCVYIHLYFDPWA*K*IS
IPISIPISKGG*KLTGNCSMFFKW*YKFKRPGKY*QRNNI*SHNFEKEQLNQLL*RNRRT
LHSSSII*LVIHPKMSVLQAQRIF*MF*TY*KEEKRKSRKSNLSWMKWKRKWTLC*FS*K
IYTGTTMIWQKVPAKNREYAHSRIGKER*INIFIYNLFTNDHLLTFL*KVAHLRSQRMDW
DLF*D*SCKRPGLRQELL*LASHFQSTIFLNPN*VVVTFYLFWARELVSENA*GQLSNHC
PQNFR*QMHHHSKLQFSHHHPIPLAFP*SSRRFAYPK*SFFVHPLQSL*P*IWHIRADDR
KIVYLHSIYILTVLVLLPYLKSYQSMLVFSFFRSCRSF*FLGRIYR*VGNQSPFHGNMEK
THLRSFVD*VDPFQIGWHIL*KQFFV*HLRLTSIFCN*NRPSK*LHRDPLFVIL*KIVCF
SQSSYNHYAFVQHFLSLPLNEILVRKIL*LSI*N*PRQLLY*KPFLQTRFF*HPPQYALP
WNIPFHS*IIIVKYHPTVYSINGYIFFCVRAHLIVLISSSPKIVGHMDR*QAYDLG*VLP
LLLIR*HKDQPFHPPWTLILEISNLLYHLLEFYHLY*MYLQKLRCLSQTYILTLIALNTE
RCRYGAGRII*LGNQITSNKPLYIYQNSSCA*YTFDQASNSFLTIAYHVRPRMGKSIQIH
QFHLWLIQVPPCSLTFQLC*VFQLNQMRLFLIPPFVLQSRCP*RYHRQTLQTRKYPVLIN
KVICGETLSERLSCILYLLFLFPLIQHNPCTSVLTFLVIRF*VL*Y*RYSQHHTLRLNYQ
NACQKLPELQ*NLLLP*FFFHTTVDFLQIPKKEECFRSLEYKKK*TFLWLLQFLSQQIAT
LSHLH*YPPILAYPACSQSKFWK*WL*RLYLGRLLLMLSCNNPELQMLRTLRWQKVVSPH
LKSCFSS*LPHLLS*HSK*MINLDYLRYILSYVINHGFSRY*RCRNL*NSRMFHH*TVFS
GGRKDAHESIYHSFALISRRGGSRKHHFLSCKSQHPILYKCSPKA*LDDLSVSIEETQHS
EHQI*RQHIYHH*DKRALIIH*ICNF*LRDSYYHLKDLCQGRT*LLR*EFYLIDAAENWH
LVCCANAGRINSSCWKILQSTVIFYR*RVSL**NVLRIHTINTTLSIFADLILE*NRKAI
*FV*IFVPTFRFTNV*QRDSFSN*AMLNKKENRKP*RR*NDVKNRR*KKRDINRLY*NSI
PA*PSKLRI*KRYRLF*IPKTPIPFK*NNNTWTT*MWTLNLLTILYGHIDNKQKYKKKKT
TGKICHKLYTTT*KRPLAYLWQIN*WTKILKNCAIHAALVIWTMLID*FPRE*M*IVLTS
LTIRHFFWLAFAGMKQS*NFFYREEPSVIETDMKELDVFMEH*PILSEIPF*VMIYPRL*
MSSNPLLLISHRCIMTKASLKEISHSEFRMENCSQRISSYYVQGAKF*QKKW*MSGQSMK
LFLLKCAQIYLTYF*NFFT*FRSCTKLNRDNMKNL*SYLVNLILSYCPNF*TKQGIPPIL
RKSRG*CQITNISLPRLQEVNF*YL*TIVSLDLLLILLIVNDEFFP**TVQLIRMFNLW*
KTEMEPFEYTLVTWLF*AAQNISR*CSQTTSRRKLHISKPSTLQESIIVSFHS*HYPIVS
LRLPKLFSATYMQIIQTFLGCMPSMFCYLPIYF*KTA*KLSLLQL*HNQKSLFSNTMFLT
YSIYHGK*EWNA*NNLQLNL*LYICKSYIKIQRLKGQLC*VHNEFLSARKLILLN*WMTL
GTICSENILLNRMMWSCSKTKTI*NT*NK*GIWSTEKIWVC*IIS*LIWNLMYNSAFNNL
MYFYASLRTDEYCQ*LLRTLKKYNDNYNKKYDTFSVKNIYTYDSRENFYIFN*IFIIL*I
IIILIFKIKNKLLMVLFSEMFFIIITSE*LFSRIRDTG**KQVLSKKKN*YILDTLHTEA
SFSCSQVHNIPYKVINIF*RKIKKKNP*IKE*KYCNKR*HFFF*L*LWHFIFAFAFTLFL
KVWIDKRDNTSCPSTYSKQQLT*LLLSIHMKALCLFRIFFLGRTFNVVRRHDNRFLGSRS
NIFCRVFGTVEVFFLEGSILVIVRTPIIIVLIISEILIWRLIWRVRWVIREGIGIGVGH*
GIIPLPLLEILVLRVVMPIKSWNVSSFSGDSNFFAFKFSSI*LQGFFSVCRTFKFNIAVA
FWCSRIPIIKKCYSFYLATVFEMIFYLLWGDIRSDVTDKDRTRVSFKLMSVFFLLA*LLR
HLWSALDR*FTHKFIQLELLLVVLFIVRNFSL*GCLSIHFLFLGHNSNCK**HYVTADIC
LC**AWLESES*DYLLNQN*I*NLLHFKVTFRSVGNCCGFFSPNE*LIIFFISSKKQAVY
YGDCHKLKRYA*CFMTERFCIGRRGRLQIVLVVGSIFIFCCFKNSAVSLMNEKF*RK*VD
TKNIMSLKYLCDI*KNL*ILKYYSSVIFV*TPTYKSLLSKIRI*AQYVI*FCVR*GKRLG
*IMVDTVVIDLTFIVNFYKFFFVS*HASRQTFSIVHINCPLLIIITLVVK*RNDF*NFVT
MRNFYPFGVLYKIGLHIEGNTFWDIAVSEKIPIVQTQYHVILVNSTALFFFKVVLISSDV
FHIFLDFSWKTTIIHK*SHIRAFKIMKWLECGKTFASANNGSFQIFLASILPFRNENIII
ITDFFIFSF**GGSFLG*IILQIIQSFKNLPLLTWVFITRY*LFPATFIHQELIN*SACT
NNTGLNIIRHKELLRFFIFLNSLLLCYGFFWLHLFAHHTLSRITNNFVNIFHFINYFVFI
INRDQCLVTFRNNVFRDYPI*FFIVNALLGYKRLQG*IVFHSTLEFV*FITAKQ*YYLTI
SFSACSTHTLNIFDWTTCSIITDY*INFSDIQTFFSN*CTNENIIFTLFEIMDNLFLHFL
VHSANLSLFRAPRSSGTSFKFIIRRSLSSFSFQKFLLLLPMQSLYLLPSLWRMFSCVFDL
IKTFFCTSLSNKNMRPDLIVSYRVYELHNFKCAFS*FCKNNNPRVGTPFLKKVH*FISNT
L*LPMTDKLWIT*IIFALIFDVFQNRMVIKLSCNFISRFFKIIFRSEFCTFILEVIEKCP
YSINF*SL*HLTHIVQ*L*NKEVPPLNSFRYSRVSNNFLALLHGFEGVYL*RVTFLIYTE
FNCLLKHWFDGHT*LFDYVFNFQQKGHFNFFLFSFLHIFHDIHAFFSPNFNLGNI*VINH
FLDTFQVRGWCSGQC**SV**IEPIYEFYHICIRRGASSSVSFIDDKTYNILRIQYTPLQ
VILHYLRCGKENSLIGPNFFSIFPAFIE*YSSLIRRYSCYT*ACLNLLGYQRSCWSSKDY
FGFFGPTKII*HYCTGNERFTHTRWDGA*RILKQ*FVNNCILIIPYLVICRVHVERQSIV
IKLMMSGSKTDISLNFFVHSFLPR*NVIMKVFLNWYSTSRYSFLHRFIDSLFIQFIQLVI
FEITKVIICTSHQREKRTLK*NRTGMC*IKLK*ATIS*ITIS*LRDRA*GTSIDLFVMPG
YIHT*PRKSRYPVYVFL*AQ*ARKVDGEEDSCLIWNNLAN*VQLSPLEFEFCVSTFSFFN
LSFLPHAQ*KQSCFTRREAKEKEKY*VYFNLSFLI*KVSCFVGDLTGNLF*PIIQCHRKL
RQKYLRGPQGGRHLSCFRYPALNQEILKLIASHQHQQERPMYQHVDPYLKQRR*LRLRVV
WIKRVCPRYHCRGQLDAPLLKN*IM**ITPVRS*RRLKV*FQSTIYTMFPGKKVQLLWKR
ERWPPFIKTGKEVHQITKLLQIPPHSKKMSTRVLRAMSLLFHLLI*LTSLIMK*QSIVTP
KTLLKSKRYMLP*IMRQGIEAILKKSSFLEI*KYR*MLVRT*KKAASMLCLHLESQNQTT
KLKSSLNILNLV*KSYRSIKNNRKKKFSKIQPMKKVLPL*MRNKKARTTWK*ILSRKDLL
ILKQL*QQLAQTFLHKLQVKRKMTFQ*FQGVGLRRILKHTYKKRSCLTHKRSEYQKSVIR
P*LVPKRKVKSQKFPLKDQRDVPHLRFPKNLLQELRPFKKCYKNNSNKICIIMVILQLLP
LQQILLKNTQILLLLAIPRRQILRAN*MDCLRYLVW*TLDSFHLPWRRSCPPRILNLS*D
PRTNHRQKRDLWAELEEVEDLVGVNYLLK*LA*RRLKKMTTLIK*KYLTIGMFPLPSLRK
KS**ILLLVSKQKGPWMKSQRAFPRNNENNLQIRWRLLFVLLSWTKRKSYLLMLSRILFL
SCHRRTP*VIEKP*VRNLCPHRRPSPTEIKTIRQKYRNSRWRTKWRLIWKENSQVATKTL
ILPYIQKKRLFTPFRIL*IICMNKLYSMYQERNM*MTSKLEVLLIIMA*KLDFILYIYIY
ISSTFFFFTRTP*ILCYFEAERTEQIGRFTRGITELC*IIKCFLRPEGALYKRYGC*Y*V
LRFVRCVYHCIFH*NKKGL*KEIYSRAS**ESQ*PHGYRKVSSNIRSLSSFR*R*SSRKV
**VWKKRSYSSGRL*RCS*TVLCHLWWRCVCLIYWRTDAIKEPTEN*GAKC*RRS*KGEG
ECGNNGRITCRR*DEWHH*RC*CSIGQY*RKR*QK*GEDNFW*FNCTRWKQEK*AGRSRS
*EEEDKIRAV*GRTRGRKAKKSRPIKQNID*KIIDINRKCL**CM*RFL*KKVRRGSQSF
KDGIIWSGHITHNRRRLLRKS*NFSCIPEPVRNGWYISFYEG*RGSIYGYTKNCFGSHRR
SEYYEGA*KNERS*HE**AFV*QRRK*AN*ANH*GTGAARAAIDGQSIVGCLAWF*I*NN
IHFTWRL*KSTRR*LGK*ENAYQKS*SNETIG*SL*ENFQNQSRTRRGTDL*RTCSRSYK
KEETYMKLAIISCILKIQKFTFFYYLYSI*YNVYKITLILIILFLKERQ*NNKEVIELSD
NDNLCDKEVVMAGELCHT*MISSFTFLGLGIF*D*YR*KKIGRTLITHTTQKVQRAILDQ
EHR*YKQNNNEQNSANQR*RTTKWNS*PASIMA**I*G*CLYIYRKSQPRINRR*HIDSL
F*IWSPCRCNS*QG*KHRRIARFCIFEI*GSTVNDSSSR*FKWI*NWR*SPQN*SYFL*A
KKEFTKIL*SCKGRIGSRYSFEEQC*ETHFG*KGPTKLNNFFFHRISYIHIA*KKIINII
FVILHPFRN*YTYVSIESKLNLHGRGGGGGIPAGGIDGIPAVETGCAPSSSSSVPTDSGI
DKTSSSESDPYAPVPFSAPL*LST*AIIGSEVEAC*VGKGGGGGKTPPAKAGVEEPDFCT
AVAIAGAEGIGGS*KPSTAGKGGANGTGGS*VTEGGIGAIGIGLLFSLEVFA*GTGTAGG
TGVTDGKGAAVTGGARA*SG*PIFASSTLLSTATRLLLSSSSDHPSSSSSSNPLWILLCI
SAARASKVDVELADASLKYGLWPIVVEGRPVLFLPAAGVTAACTERGALVEFCEKAADGA
TGAA*GTFTWPPKLSFPFVSSSSLSF*ASSICLRKAASLFSLSAFFLSFNRFSSSCKRFS
SSSSSSSSDSCFALYTF*TG*VG*TG*VG*TG*VG*TG*VG*TG*VG*TGCVD*TG*VG*
ATSTYFSSWNGVALGSTKLEEPAICCGCSREFSLLIDLEL*VTFRLFLSNLANFSFILFF
ACSFR*AALSSAVLN*E*EGDEERSSTGVGVEEGTKGDDSVTDLFEFDFRSSKNSRTPSS
NPMPNSHLSNS*LDIIFDPVIVDFKDAEISDIDDLMSLMISWFLPFSCWILLISALCCSS
SMESESSDSVDFPVRADILALNKALLLAFFLSFSVISPFGPDPIIEEGFFFLYN*IFALV
ISLSIVEISLNRFGSLAMMASKRLVKSDGIELS*QFSGLLIFLISFSSEAIFFRFISLEN
PAYFGFAVFFSTVLSTEMSSV*RVLLE*LTDLADGEEKEDCSSFFAE*TFLRFL*FGKTS
SSLFL*LKASILPNEGFSFVVVGSVFNWFFKLSKSFVLEGIKLEGRTLGIGFPFNLP*TK
CIPSANSCLFNWPVLFISQRFQICSKSARFKPDFLKISTAVGESNKPLF*VSKVSKIL*N
KDFSSVEILS*LELSIKLLLKLDLV*ISLLPNPVFWAVNGMVALKLDGGRKPVGWGCNPV
N*DCNPC*LKDKLGILAGPLCWGITEPYPPVY*DCKAPPVN*GPKLTPNEVCGIIPVVCG
IIPVVCGIIPVV*GCKALPVMLGCIEAGAPPVIWGFNPGVPVFIDMLKVVGAINPVD*GF
NAEATPPPVI*DCNGIPKLV*GIYPVG*GCKFCTPAVMNSSKGVFGASFAEESWFAMLKL
MASIKLETSFFVLESNS*GIVSPCKTSLIKCIANANSGNSNSPAFDVSQSVQILAS*EGG
KPDLIKIFLQLAPETVFEPLVTIDLNRVSNFA*SWAVINDNLMAGILISLFRPLLANELT
KPVAVGFNGSKGAWFCG*R*NPVCCGFKGCKDCAC*GGGTC*G*D***PVPWA*RGCWV*
LEEIKLGVDT*YPVP*DCKGCTECTFAVLAAW**PVPWGCMDCS*GC*AGLGGGMVPVVF
IIGILEFGTYPVCCGFACCCCCWGCWPKLPLPYTLPLFPLLL*PVWGCCGILEKELPKL*
GIPPIPVA*GWLNAICCCG*GWPWGWFED*PCCCCG*NPFGCCCCCCCCCW*PMPCCWYG
LYIFSCTD*QFRVADRFFLFLLLDVCFANRSIWLSNAFFLPIPTFAPNKKKISSTCHVIK
PIYNNKRLINRVYIATMRLRDQSVIVSTYL*GLTDLDVIFFFFF*RTRLSNKHC*LMNF*
YLPN*SIKSVLGKHSLNISTVGKQVLQ*KTILNPKLSN**YIRSK*KKYRL*SDIV*RLS
HHAFTVETGVRLPVSEYVYFIFFISARILPSFKVSISLVNLNNGININSIFRNNSTDSYF
LNLSSLFLFIYFFFFRT*IV*I**EQIICLPKYTFLQTVSFAIKMATRSNCVVSIWIRQL
KSLQSHSYPPTLP*KMTRFSRMLIKSVSSITP*FLMISNSISSD*NHWVTIPFVYPSPGN
LLNMLVQDSTILTIWIISSRY*PGLTAYNKVCTFIWTLTKTSGLGLAVDLEHRYGPYTVQ
GFNLQTSWPPMLQSYIIIILTPKRAGKLAKMKSPTLRWFGLQTTSNWRVKQCLRYSLVGN
NMLLSAQLMEKTYRITCKEGLMMQS*HCAQELKKRLLSCLRATALLD*SL*TSQTVVTLV
KQISM*FRKREI*NWAKRQRHFKALCWVKVLSAQ*INIKGHFLDFLRENRAQSIPKAKKL
G*VQRKEMR*MRSIIGKGTLNGNQTLAFGNSMVFGRFRMVNALFYSNQITLANLMQRYL*
TIILLTITLEFITSLGNSIKNCLL*SNRR**SHHPIYKILKYWTIGRFVHVIFMMV*H*C
IRHGINELA*TPMD**TKNTQILPLL*CLAKTIYGNALGSNYQKCKRTLNPCLEKKYLYS
SPKLVFHLTWTTRKHILQMTILHRPLHWMLLDLH*KEVIFRTPYGVIAVLIHIYGVTIGT
MKIFRFGPRMTNHSITIPEQKLLLLSHLQPLLWLRYPLLHLNRVLHNHQVS*NQIII*IW
IVPRAL*RATCQGSELLML**DHSPYKFTEDLSLLSLTYVINPTF*N*LVKRHLNR*LSL
HIFLYHGTILHQAGCQFVHHQVIIPITLTTRFLNGFTSLAISSLKFAQNRSQGPTPLEVT
LRMTYQRNALSAKQKLNQKL**SYIYIYTLFIVTKRFHHQKSKEAGSSSSSRSLFTEPSS
FFKRELTYAWN*LIKGCKAVNETSLFFSISV*RSISLGAFSGAKDSSIGTQTFPVAG*IQ
KGAFNK*IVCFVTSTSSFG*RVINTRSSLHSRNLIM*ESCLGPLKSDVAI*SISFHFSLL
DLLGLSSQYFFNESINCLSYNAGNKVWIACWSSSQGFCSSSIMLTKKGFNCSKERAR*G*
*GLFKANRLSVFLSLITLT*SKTFLRCTSVKARARLSLTQQ*APRLPENTQMKSL*PKSS
LRAVFVIFIAKDINFQHLEQTWAPEQHVLKAS*SSISISNTNSFSKAFNSLFNRVSRSLG
GLLYMAPISNLSGLAFSICALKSCTELKELYLL*APDLNAIANSLLIISLEGLGE*FSQL
KMCLNG*SDL**YSMSEELGPLVFTELVMMFIKQFFELLKLIFASIMARFSLQLQSIFD*
FFIFLAL*NFSTERKQ*VKVAKGTDRATVSKLTHHSHVGYSNG*TSKEKAED*SRYSSHC
G*TSNGS*KYAVREPA**KN*YATTASKPFFALCYVWRGTEG*HEFQETAGPSLYHHENH
RPGQSGPDFIKRRAILW*AFES*VQQE*N*NTMTGLTLYS*QHVYTEKSCHRGTSKSRAQ
NQTKMFISKQPGVIDGRQRTNNIKACINME*I*NLQKSVAERVSRKDILQNGRLFLTSIA
*IIQRANHRVPHCQKTFITFWK**FSI*DSLLYDELQCSSAFICGFV*NDIYF**KQKFT
NDKQIKINIKRTAN**KHKVPGRVVKPGLFYCTTHKFFFI*VEDESGTHTNGLRYAADAA
SKNTQTSIPIADGNYPNIGIRLQGYSTKQRAHPER*GGDRIF*E*TIRVEFEPRFEIQTT
QE*TYPGVPYSGRKAG*PARYKKGQESGEFQFFCANC*RQS*WRCDCKCDCKCDCKCDCE
C*CKCNARSIYALLLLLPSDECTNSCNDTISWITNAFDYAQLLITALLFATHCCRRSRYD
YSPKYIFITTIAASSAIVSVRIIPSTTTSATTLHSTNKGKEKINRKSER*KIVYVSISS*
WGKHYYISAQGYS*RGFLHRGWKCVFW*KFTNTTAFQLVFNEISA*IGVEG*KPRGRRGT
*TSDQKIQARINKGRN*LCGSQTSGYGDNKRVCR*S*KRSYCDRLGR*GKI*G*R*GEDS
G*Y*KLR*HGTATTVSGKRRRRRRRR*GGLLGNTEV*T*I**KEKSPTERTKKTIT**QK
RGKHKES*HFNEQGERDQK*SERMGSHFRHFETRS*MARIDFILITTTGTVVGYRRARPC
DCRC*DKVRNKSR*AKVPVAYIKLALTSLKRNNKFKSE*IEHRNNEKDLKRNGR*PLTSD
*SSTAVEGIKFIFQ*KTGFMK*KKKSKKNRILLHM*HYTVIHLYIHIYTY*CI*KSKRTI
LSLVKGRISSSATTIVIVFVCCHGIVVVNNTFLK**C**RCC*RATHI*RFEQLEWAFQ*
PI*MFIVYL*SCHMTFPDGAIIC**NYPVTGNMFNKRTPYVRQLFNAFIVVVIITS*FKS
GQFDN*FRANV*EF**CVQIFQTWWNVIQYEIHQTV*ELQNLRFHSHESIVI*FITLIRP
IVRYALVNGF*FLFQHVQTLLYTEV*SDDSRMYALLYFWMFCHQIHQQLL*LVLVH*FHA
SLQGQRLPSDERSWLRPPLGDAPIFHHILVTR*FFLFLLLVGIPPFLFHSSSWNHYIACA
L*TDCTLCYFTAGFKTPFKPHHNAILSCVCCFCQVPSNTLSENTWLSIFLSKKFPLAALS
PARRFFFWQNFHYE*LKRYIRWALDEAF*RPKQHQIATH*A*WNLKKSL*LPKKLSRRLC
PLWRSNKTFPLILKERMTTMMK**MMMRKLWRSTCPTTRLPISISTQTPCLPLAIILTCR
*YVPVGVITWHIFGHHIHSHPSLLAL*PVMANL*FHVLSLLKGASWSLPICRGRFLYTWV
KKVALSGSWHRKCKKSKRLFG*KLIPL*QGRLRLVQLMDLFGATRLMSRMVLWNS*CLVL
YTSKIALWVNSLTPTRVKIRWN*SLVLWIALLWHGIASLANNYLRSHRQKSRD*KLHGFP
YH*LRKL*PRVTRVSWHVGPTMVFWQ*LIVTMAVRFYIYLQ*LN*SQNKTN*MPPLNPFL
GHPNSPLWPLALSAVKYSYMIQVHGE*DTSLFSKILLQNLCLIMMTYSHRVSMVRFTSLM
QELAKRSLFVWAIIWGFLILYYCILWQIPAPSRREK**LQVMKVYLWCSRYQTDR*SRIH
K*QKNKFNNIK*KYFYIQKKKLYIFDKGKCKKKKHIILKELRSLSSLTILLLHVERYIVF
LSR*VES*KSIMGQNLTVPVSSLGILLLVPVPLICSMYLLAAALPKRRINFLKNNPQALH
RQAAPLGPSLHCNEVLISPHCPHVLVMPVLGRAG*ESAFLGRPCCASDPLFNSN*TGTFL
KAVPFEITIGNLVDIATL*CYVSS*EQKVPAF*AVKE*NVYVVSRTYM*KTSLALSKFMM
KLDGPFHGTKILTHGCARRR*PHQGKKGPMPRNNKTDPFFFFFEIKLKEKCKHFSGLKRK
ENVKNLTPKVPKIQVSLKGVPFSTRGIGGRKLG*LTT*FHIDNVIAIEEIAIIREGTKPD
LLVFN*CIMGTIESILVVEKKKKTNFKPGNINFSYGFSPGKEREGILQ*RRLR*QANTER
ERSRASEGNVAFGR*QWTTKVSDSEFAEIRLLLPVLEVYQRWIIILDPPGVDNFIAL*FH
SGIDTQVPEEELFRGGPRQ*SGR**KSCHQRVRNTYCKNDNKQSHTILPRPNTSRNSVLY
SIPH*ARRIERHMFQTVRICDNAFDKGIYLSGTHSVS*QATSGTTRYFITFLPDCNNKRL
TELESSERETYCQGVECRRRGRTQHSQT*YLAHGCNRTGTHSTQES*QVDSSTGRRG*RY
RDHSSTEYRRINSRKEKKKNYQNEKNGKKR*TENKTIRGSSTVLPTSPTEKRQAKRWARK
HTEER*NLRSTKMVLC*YRHQGRLRTRTISID*TTSTKYPLTKQEQDRKQEQTHIRLWHA
IISNQWT*LVRKPRHHCFLR*REQFVKNAIGCYGPQKNWKSHPTERFR*CVGAVPLNVLI
LAPILITGPTRSGRVIY*ILRVIGRVLDQCFEQDKNAEFPDFL*EPTPHPLAPIHGVRAC
ILRENYDIKHREKNETPV*RR*CRIPSCQHSG*TPQGGVVVGNEWHEVFARRRTTS*CDC
YGNFDS**TRTRCRARTVFARKFYRWSAALVARST**CG*RFGGFSQVHDTIARWRRRHP
CSVISRRRLKERRRRR**RRRRQFHVARPIQGSRYVIVIIVQPARSKSAAP*FCERNICN
LTPRKIWPRRHNWKP*RSGRTRKTQFSCQSLEYFLSKEQYAQRQTYAFSMSR*PPRFREI
YRHICSRAVFTPPTTTGRRSVRSSYYKLSYYRMVLSQRDRVCGI*TVLDQCGVGRKDLAF
VSRAML*IINIHIYIFICR*MCVYIC*VKKRKNRKIEVGEEKQDIRPARFAGYLPMFRLL
MSFNNFKDLISLMSLSFAFQNSFSLFNCSIRSRSLLICVFKFCSLFMFSKFFCFLRMRNR
CDASVFFLLRSCLILSSSLEVLTGASSSFTTTAVVAATFPFLGSRSFLNCETSWPLFIML
MSSSALPLLTSSNDSKREPSSESLDIRFCRCSERLFTFIPFLLAMSMFVDFFSHPCFALI
LTNKTICLRNYHWL*IVKFKLPRVLSHWLPGLDSRQ*PTTMAFPLPAQNCGVRK*KKVKK
AKPKTKKKK*VTCTQYPFYCILVYLLGRAGPTTVASFRSFFSRMHGTDE*TFIPRKRTKR
CSNGMVFLHGSDVAIISITESEVNHITTSSHNINSVTSILSQSWLYL**NLRSLRKATSL
FCPRSTCPKIGNCLQGCPIEQLSGGKEFIDFTKITKLKKMMRSYRRKNGRIETPKGPTEN
AKTTSCKCWRKP*SH*VRSLKTTKRN*TASKMNFKRKNRKIMPLNRNWRPLL*NKPLCLL
RTLSCRI*SRISNQ*RRYLLSTIPLSSATSTRQNCLALSNAAFVTTTLLAFVKNWKQITV
KVTTVWPQNRRICRCHMQSAIIKITPMGSVVIVLISTNHVSTSGPSSTEERELLNTYKYV
IEQLNFCNVKRTHMKGVTLLFSLQVYYCGYV*RISSWTLAAECKSVLDTPPLVFSPPYFE
TLVSDELS*SGGHYLKVPLTMPIHSCNFFFFFFDKYYWVMGSIITRHIIFDAEEWQPVYY
VNVMVEPLL*RKIDRT*EKLDANHLNLNANMRTDY*HDTII*IFPFESRVKF*YWRMRS*
CAKQ*R*WDPRKFHF*IAFLF*VEHEFLRI*L*LDVTQKKLWRKQISFHTGLLYGCTNTT
VVTN*KTRIW*AVWNR*MNHKAQQPSSN**QYDFSPK*I*RKAGYSWRVQSSVSNLDELK
LRPEQSL*QTSIHTLGAIF*CDQTANRIKQTQEANYKLLRFLFSELVKVGSEREAVTIAL
RYAKDITRC*S*TVKLYKWRTL*VFCR*KGECFRRASEISNDRSVATTKSYRRFSGLPSY
V*R*RSLEGRAHFFYCCLFSR*LAFSIMFCGYYSPPGRFVEGLE*DLSITLRRFLMLHVT
SI*HISPSGSIQTLCARTKSFLFQ*ERNFLY*MWQRTAEGY*LLDTFFVHYVDLTLKRRP
RRNFNSWHLRINKVI*CDGNASK*MENFEG*RL*INLSLTLLHEVFPTKKKKKKKKKRRA
VVFGISRK**ILSRGF*VIL*LLEVIITFNGGRPSEKKRKEKKIFSI*NSLLFTLHWQF*
RRDSSEKSYST*SCVFHYR*S*STGVRFSILGQYPPSVFQTKYKRPP*FARILVSTSLLL
CSCKQFLR*ASHMSVL*IPEIESHCGLYPHLIYAVRKVETLS*PCKSSMSFQETSSILGV
LY*VANV*EWSISIGNILSRNYAIKIDMVCYFHPSDFSNHSVIRDMYHQSPTAIPSLTSS
KKDPALIVIRLGEVGKSGPVIRHNDPFRTSGTFLFFPLLFFFSNVLTNFRL*PYFLLGRV
LIAIATIKIKH**KIN*SL*HRDQRYCSVRRTVREWHDN*SFFRLLHVICITKEGKMFRI
ISPLRYF*CEI*PHTVKINC*ELCDLLR*KGGPLFSSISIYYLNMLT*AKYTGVVSARGE
LPLSYRILPHPFFCSFSEKRGFFS*IQSEEH*NFGPKLVISSVRKRKTPFRTEALVNQNR
QRCFFYSGIF*AKTIGPEERINRGNLHRPQEFLTRLHVKI*LF*LFFKVGPPKS*VSVLC
LGNKEEKRHLKSLN*RCRSISRILNERQSGLMTLADLSLNNP*YLGTLRLAWGDANNISI
TPVNSHRKKEIFFVQRAKVPVKILLFIKAWSKIISCAKAISGLLIF*EKCKVVTSLSVSR
KNIFTQAVRGMIFGGYHFPRLQTKERAGAWQKEKKKKREGKVARCQYYRYLFLNKLSDGQ
NRARRKMVK*SKKR*KIIFEELKNM*MNMYSTGSFLPYKIMAAKTEWWKKVKRVSK*YLN
LRMKTS**RNEHVGIVSLEYNWKSE*QPHKVSKNLDISSTLVSTRDRRNRVCSDCRTRSR
L*WTS*RWRCDNGSHARSRSCCS*LGCSLD*NRVGCCGHSFVILGTI*TWNQSGYVSGWD
GLGCVTSCCFASGVSTNR*LSGNNCGWNSRRDRGGSRRCSVFACACRTYDSLSRAYRCSF
TGSVCSSRTFSSGYCSWYGISGRSYWCTWSQSGYIGGWYRLCCVTSCRLTSGVSTRRGFS
GNNGGCDSCCNKGGSFSSVFASTS*TRNSGCDSLWRASRGSFTGRVCTCRANRSSNSGWG
EIGNRSD*WSWSNCG*VSGWNVFGDKCSCNFTTWFCTSRILSSNDGG*DNCSYRCGR*SG
C*FRGGFAWTG*TWNSSCNGLWRASRGSFTGRVCSCRANCSSNSGC**CSDRSRSCSWNS
SCNGLWRASRGSFTGRVCSCRANRSGNSGC*WCSDRSRSFSWNNGSFGCRRNRGFCLTAR
VFG**WSDSSASRKAFSSRAEWN*RWSGGSDVARGRWGWYWCYRAFSGGAGYWSRRAFSS
RA*WGWYWNRRAFSARAEWG*RWSGGSDVARGRWGWYWCYRAFSSRA*WGWYWSRRAFGS
RAGWSWHWSRRAFSSRAGWSWYWSRRAFSGRAGYWSRRAFSSRAGWSWYWSRRAFSSRAG
WSWYWSRRAFSSRAGWSWYWSRRAFSGRAGYWSRRAFSGRAGYWSRRAFSSRAGWSWYWS
RRAFSSRAGWGWYWSRRAFSSRAGWSWYWSRRAFSGRAGYWSRRAFSSRA*WGWSWSRRA
FSSRA*WSWYWSRRAFSSRA*WSWHWSRRAFSGGAGYWSRRAFSSRAGWSWYWSRRAFSG
RAGYWSRRAFSGGA*WGWSWSRRAFSSRAGWSWYWSRRAFSGRAGYWSRRAFSSRAGWSW
YWSRRAFSGRAGYWSRRAFSSRAGWSWYWSRRAFSGRAGYWSRRAFSGRAGYWSRRAFSG
RAGYWSRRAFSGRAGYWSRRAFSSRAGWSWYWSRRAFSGRAGYWSRRAFSGRAGYWSRRA
FSSRA*WGWYWSRRAFSGRAGYWSRRAFSSRAGWSWYWSRRTFSSRA*WGWYWSSSLLSA
CLRCGSFLLCTWSGVVMRRCRLFLCA*GSGWGCRLFLSA*GSGWCSRSGG***CR*LGSA
RCSGR*LGSARCSGR*LGSARCSGR*LGSARCSGR*LRTATIIVTIYVPIEAWEIRLRVA
LIVIVVTTSRQIKRCSSPLPGACILSGTTLQILELNLEVRHPHLTAVDILCGINFKSGCE
ISWVVNQIGIFVVTV*LDGTFWTSDTNDFQRP*ILQVNIFFTFDMNSDLVCVVLNPRNGS
HIQSILHDILLVHVPIEV*VGTAINDRITASSFGGSSWN*CSWKTQSRVK*KRKDQISE*
KWSLHSVRIWIFEAYKSIF*LEPQHDEG**LMNRVLFIRLF*EARDPFYQLGTLQQFVLV
SL*VIRS*TRRERSNVNA*TYLLR*IKLP*FFI*FEHGHSSDKTSLTVNSK*KELNFSVK
ERSILR*CLESQLVTL*HFCKGYLIRRERT*KDDPHFSRNNRTLIVALNCSAVKKTYHNV
ILFLSRHF*GWAMSSK*ILVNKRIPPNPLN*KSIPSSALPIVNHTTDRQ*KFCP*RYRRM
SCARIVAPNYGIPRYAMSQYDR*KDNMND*SV*EYRQK*KSLCNA*QKKANFSFKKECHS
FTAKLISAYNHLLNARTDCLEQSAVL*SHCRNKEKEKGSPFLAPKKRMTKKRKKVNSYQ*
SLILQ*SLAPEKD*RQKGPTR*ENNGRNSLGDIFLLRKQKKKTLI*TFQAHPKRIMLM*C
HIPRN*KAKKKKPFFSCRESLICLPAFLLESGKDH*ELQL*EHTLGLA*AHNPVFLKFCG
TKLHT*NIKQISPVDPFIHNTPSCTPWN*V*VDKATNEFWEMHTKRTEKVAGFMWWKYRL
AHSHSC*GPFSRTAFEI*NNVRLRQQLR*GKKRW*KTFEKNKYCRCMSSMHASDRFGVVR
TITN*TFPIFCLYNIH*SSFALGVLQKCWANLEMG*YASVPTCKGAKMLDFSVLEF*LSV
HLRCMARLSMRIGKYSALTDGGLFLP*NHT*KLYVVGTPKRRYEMRDTLGDKKD**FL*N
L***FEKLSILNLTWHTDEKVLKAL*KRLRNILFSTSFILSIICLYLSLALRCSTVSKTS
DVWIKRTWKTSAATTIFKIVSFIIR*MDFSATCKRRNCV*VVNELFIFICVPKW*N*RPK
VRYTE*SKF*YSLQFDQCYLALFIPISRKFVK*IPR*SPFYLLPKRLSF**LAFSSFLVA
IRHS*SAVRGRGELTERDSLYFCQPVCSKIR*LNVLLAAVPLSQNPAERCDTI*SYHIII
AAPTF*LLAAKLLFRFSWRYDSLQQ*IIRISNKRVIGMWR*ETKTEQKHPR*VIVFLNWE
PEEL*SSSASFRSVFENLSCERKVESYK*CLIFLHDLPRPRCHL*RI**DN*RRCLPIDS
AKPFLKIIHILVKTQISVILFLSRH*AVISSKKNDLCHCKYLQFQLFTIITLESFE*MSF
DTFPRLKVRILLAFCILIIPNFDPFQQRKREK*KSAGK*KIMKTR*TAKFRCETSSNGSI
GWY*ISVVTLKMSPKNITRSVIPAIDLYCRKANFKTLKSLSMILGSKKEWYDTKKAPLRT
FLVSRCGIFEQLRGRLVEDGKVNLFSVFLTNDSFSFCKMTVDDKFNTSLVDWQKIPFDST
FATDRRQNISLLPVDTLFATEKIISILGVSPNMTNLVSIERERSDLVDFNCKLQSNILEH
LLYAKCQGVYVTSTNEKARLLAAVCNPEFIDTFWCELTPIRVSLKENPSISVPREYQMYD
PVVRATIKEVVTKRLLRSAFDNDIDPLMCLHLDKGWKLKFPILSSTTGLNFSLKDCLSLD
TGKDASDMTEVFLATMESSKVLRTYSNLVDIVMKDNGRLDSGVLKQFNDYVKQEKLNLQH
FQAGSSKFLKGAKI*SSYIACK*KVRKKKLLLTLFSVRAVLSVAVGFFQILCDTPAQQCH
SLSAARLPRPRSCWYLLFQRALLLLLLLPYVYFFPLAKAISKK*SPRK*MVQKQYTTEIY
RKVNPKGVSTR*I*DLNCRNY*TFAFCLHLLTCSGKA*PLLLIALLRSWWCFQAPWNQLS
KGVISFSYGIEILSTK*VMSWCMRSKGNKSPLCIEF*GNITITRTSNSS*PKVTITPAMI
SHYMLIRKFT*TSQRRL*GPSRATFHN*GTLRFGLARTNMPSLHC*VCWG*VLCWGASSS
PSFFGTMFTYFVFVLMVFNLFNYITITIRSTLKTKYCLRTRFENY*KRSSHSDVGNSTEM
ICVIFYKVIPSLINSIS*KGICVGN*DR*V*LLE*KMV*AA*AYRIVQSVYR*SRSSPRF
ELIILI*YPSRWVLYET*QSYMVIENNR**ESFSNNSVDLKNSWPV*TSGRTTGSHTIKW
TLTNHQLIMPHRLRRA*RQPLKIRPRIIMSIATTAIITVTMIY*ILMITILPFCNIWQTT
ILIY*GRKEDHNNNSISSSNNSNNSSNNSSNNRAWIPFCTIIKVYSPRVIMQ*PLMTMLV
TAQIIMAVIATIITTIMTYLVPVI*WDLAINVD*RKQSATIFPT*ATVSNVKRQELNAPS
VLLQII*KERPLGQTITCQPLQTPNE*KILKTIRIAYPVACSIDINSSSNSNSSNSVYNT
PDPLFSSVRPQFSI*T*PSM*D*IMLTKYSYQKLYH*ERCLLPHSLFFRTILTRPFIVSK
NTKLIWSKIWYIRTVTF**RFSSN*FILFFQFYTNVYFWKSILDLIENSLRLYWHPFTHW
HYNIGIFILHFWGSLNPM*LLN*TISHWKHFMLELEGQN*ALYKQAF*FCNAVVNVITTG
SSAPA*WPLQRNWGSGLNVMIGNFPNGKKI*ERD*RGQFG*WINGVH*TKVDNPI*F*VG
TG*SSY*TLMIFL*IRPLF*IPCKMTSRGLHPRHQMM*KTIR*HLVTCPYLT*TPL*KIS
RMERLCFNKWFP*V*FLGKSWTHFTLRDP*Q*TKALNRY*NWQSRCN*N*ENGTIPYPRI
CQ*VMPRHKN*TQIQL*L*LILPRKLRYIGKLSVP*ILKLQRNWFKYAGLLQEPGL*QQL
NL*EI*KTNILMLFGITAQLEI*C*LEHLLPCCM*LQLRRKRL*FSEIMLEIIPGY*R*V
PNTLINYRML*IICIYYLHKFLVF*PMNRWS*ALTLTSIPLTHKGQVYNRKSQYNLTWDH
LP*PSKDLL*TSGRICPRKSCNN*TPFPTVRPVQQRQ*TPLPDKHN*NRREVQP*IVLII
IATTRLYHLRQISLLKKLHNLHQMLRPLI*ADTPPLIHLHQESIPAQMSTLIHK*MLLP*
PQLTKPDKSQVTLQMKKQQEEKEPPTRNHQRNSRTIIQTRTRKQAQLVTKL*K*MMIKM*
QLTQGKPLCNINNST*VKMEYGNNYIEISSAGPRLLSGECKIIYSLALYLHVVYPDA*SL
L*KFWDFIMFFGDFIQITWLVHHHMDITT*VNLFIFFFRLF*IF*NIQISDNPFFVLNAS
IWSFFDYFFFCLVYYTLPDLFQ*LFLRNHNISLIFLHPSCVLADDS*TQIHKFQFIICVE
VYLSIIIMNPPYQLFQFIKF*LIFPFHINNVPFLGYYCV*YRPKYHYQK*RFDHCFIKS*
LSLNARIC*CNSSSGYLYGSKAP*K*TIS*HLSCHKHFSLHLLRMTCLSLLLLFPCSLYH
IRCKLEDA*NSSTVLRHIRIPTTINSGEEKTKQWQER*GIYHYSMI*ERIKIRQEPSMRD
IT*EISEVRRTSM*MA*MIMKMIRLTDL*EGRNPEL*NTFHHCQRIMCSMNFLTILRQPV
SY*TAN*TNF*CCQNNTKVDYPKYAS*DGIDSNQ*ALIKLCTN*KC*GLEHELKTRKGTM
RKTSGSTILEKRIQETMAL*DA*YCLIFYRKMKNMILVRVLQDCIACQMTVWPYLRITVL
IIRKMRKYQRRMKYHTIMMQSSIML*MRMIMRREKCRGKVWKV*KFRERELCRMTY**DP
LHCHAPYNSLWKRLII*IETHMILTVITTEKIQR*NWT*IRILKMTWEESMIIIANTAKS
RLLMVGLHLI*RVIGGIGLGRG*LV*MN*WRDEPGSNEVKIRKMLSSAPKFIYLLRCIHT
QVHQKCLVVVIFADYI*VIYLLSRIQN*PCWAKQWIVREIDPLY*FAGG*RG*PTYHNCT
*ILSSCNRQLYLNSLDMKTSLLTLACLVVQVASILKVR*KNESNLLVTLEYQ*YDGSWRP
S**SVPLMIPYLVGHAR*KM*ITPIWFCTSYISLR*PCSSQLQLIYPSLATTPNL*TFQN
WRPIRCPMDLT**IASASTAYRLGCRNRQNLHPFSQRDVIVP*NSRLAQHSVSSS*QRA*
PLIVTIHNDTLGRLL*RLQISRVLLDNEQKQHHVVVSS*NLLIWANTQLHWGTSIDQ*IG
SFHRSIAAHQSHHHHRWVCFLACNLSLLDTLE*PGI**QKEYE*C*ILHPMVCGQ*LDGF
RQDICLLISW*LPRLLSLHFQPSSL*FLAAFTAFSALYLY*MHSMS*GIIFFFS*ISFF*
R*ENFKIAAVETQMDIL*IIKSCVISN*EWLIYVCV*ITFYKFVSFISIEFL**KFATLV
*RLESSKV*PNGVFETPLAFVYTTWPLNMVFKTVPLTVIPL*AVNLFLK*TLELLILCLL
AVSNTTKSASYPGAIVPFW*DSPT*WDVFLQHHVTISTKEQPWVNINGKPSPTEAIPPQE
SKKSPFCKFFNSGVHGEWSLTTEPITPSRKASHRPWRLDSERMGGQHLK*VAPSGICSAA
IHK*WKQVSVVTGSPDARAFLIKGIAFIDAR*TICTGGTGPFLALKHSRIKLMASISKES
GLEDKNEEYSRWLCSGCCWSSCALGNSA*NIIMVSSSAKTFKASSIYSLPIGGNSSTPES
SKNPLNPRTPALTSGIKSGKLCGTSPPQNPTSHHIWPSAASNLIRKFSTFVVGGIAFSGI
STTVVTPPLIAA*VPVSNPSQLVLPGSFK*T*ESTSPGRIVHGDTFSSVCISYLVISVFS
ITTEPSKTSRIVPDSVEYTIVAGLFAPLIMTWSEVMALIGIFVLRSISLFFCLYVFAKYT
LF*PN*R*LKEKGVPSITRYQ*KLITFALPHHCPLR*DMPPLYR*LSTAILNHFS**SSI
SPPSTHLRLFDDPQ*GTIESKHAVPFFPAILGSNVARGYLLSVLLSYQ*KISARENAPAF
FPAILTRCRIQNSASNLVAIRNVYV*LKIQDVFLFREMRRNNRMD*PLCCHVDKVPLKIV
SND*HREVEYQRNKFVIEKLDLLVLSIEG*ENMGKKKKV*IISLMSSLNIYVTLVSLFDL
LYSSTSCDIKHQQRREWLTTL*VLFSVILRGKVSNPPHLLCHIQTMKMIL*MWKMGSSTR
TRISTLMCMWTTPQ*RRAKSCPCPKQSPSGVKYTTISLC*TRQL*MFR*KSRSCITET*N
RLKKKEGVGPGSITYISGWQTVSILTHGK*LVQVYN*V*IGGNVGLQFGSATLLQVSS*Y
*TRDLVPHITYLSLLLLGPHLVYSFLCGRL*IVS*WL*YGMPCKPG*VQRPWH*C*NLFL
ARIWKIESQTILVLQIALLLNSCVSLYFGWSVYHLS*WLLIKSGIYSQ*KQL*SPSQPLD
F*SGL*RNRTVKLSWGR*MIIHLMVPNFHGYSLDP*WPVLLTLPL*LSTPLTSVDLPKIL
KRLCGHNWLPSHCSSP*HV*SVSLLLRPVITYMGLTIGHHWMYLVNFWRPLTPEVLGLVC
S*FLLYLP*LNWVQTFLPTLWHVVLI*RLCFQDILILEEVLYSVWQWLYVSVHGT*WPVQ
VSSPALWVLMQFSFPVLLVSFARIIS**EEDM*N*HIYSWHRRVPFTCLETNLVPIGGPL
LRIFAVSLQIYQVL*VMLELQKLRFQRVQ*GYTI*VIR*VSLLVR*YTSYYVTFFLSLVL
P*PIF*QRKDGSKDGLMLRTSSKIGRMSYVGMTSAMTQSVSMMAPRKR*FTK*KSQFILL
PVVIRRIDNFFKTP*YSFCVFLCTFLNQIYQLHTCIPV*IMY**LAKPSSTYQTCACLSL
SELRIIPTSYL*LELAIR*KHRNHNEIQLEEKSKL*THFLRSNAIKEWKCILL*YGEIMK
PIKQLIVSNRSLL*KNEVF*FGR*GRI*VNNHFKKQSSRCYRI*VRWSSGFFFR*MVCFC
*KFNSANCSYKGSYQICSFRRMVRRLGNTKT**DGIRLGYHQDGSRCCPYYWW*N*HCVF
QW*SCTICINRGAL*RGRRR*YSGR*LALG*DC*EI*VWSFAKASFR*RQRPY*RKVYSH
QAEDVPRWRNRQI*IIRKSCSSRTQNEGSYN*LGLCLQWCCRFKVF*PTLRFS**FATAR
SRS*YVGRLGNQKIETTRSY*LGGNSTGQGVFFH*EDYC*YGTLQGELPSVHYRGRLLEG
VRIK*EHW*RNMGRASW*VKDGA*QRTCV*NT*EYKSLPCQINDYSRWRSEKNKSLGVLI
NT*LLYILNQCTLGTLKVKV*M*LKVFVLIIECFHFAIPTLLYLLLLLHDKTLKFTLYKK
QSYFYLFL*VDKSYHSD*NL*TDLNRVQKQRAIPLECFRQFILQTRESCTT*YYNV*IKL
FNIFAIYNFCYLLEIFWTM*VEDL*ISRYRTFP*IFVNCIPCQEFRFHRVIQYWNPFFI*
SNNRELLSNQIAIINTTI**PNNRNICFFFSSSILYLCYQRMI*KTGN*YPVEFLKVIYR
LLVIN*EGKTGLHTFNTCFLPINLWWRRVWPCEITDFT*FH*KSLFNGFPQGHRH*LRTI
RIHNKYSCFHRSIICLASFSLFF*FS*GKN**FSFLTYSRFKGLNMIWHGEKI*VQFVIP
YQALSAQI*LDYALKQRLKFFEYSSGYVRIHSIIYLSQLVWHLA**FHHTIKWSRSR*RF
YQ*LQAKNTWLPRQTCSFHPADLLKPILQSLHLIS*RSILELLCHRYHLRQHHV*PTGTI
DNVILPQ*RHLPSND*LGHNQIPLTKPPYIVGQYPSLL*FPQ**LEHLESSYSINQMM*H
VHPGQNIFDLLYPCY*KLHYKSVPMLGVLPMTHHAHSSFL*FCHYELCSLQLH*PLDHLL
WGFGQPYHPSHGPLYGDMY*SIFSHKHP*KVKS*SLDPYLAKRVQASFSVF*WSKICSPN
DHSSNRLNVLLFDR*SPPFGRPLAKFQSEQWP*WYRGAFQ*NLVQHRICHSIVLPPYGAP
SLVSKNKVLYQF*LTL*RYGKNINQNRRWKH*SVHHLCKGASPPCASHEV*QLKWAVLKC
HPSTCTPFLVS*NRFDF*WHHKD*LVRKSCSPKLEMKSPRNQSYMSLLQHSKR*LTYFSM
VAQ*SRWIC*SNQGLG*HLAM*DRS*FVRFPARNQIGIHQSLTLIVNCFCWLKAVSVLN*
KFYAAKQ*TLRHLLLKYQLQ*FWKVQIEESCRCLRIEQCCPSLSSPLFSALYRAYDTYSK
*YQLHRK*RIKTTCVNVPILYLLLHQLTKLSNLCDTFTMYLIQDKPKLMKFNLCDKKSKR
NFPKSAVFYRTATFSGDFMSIIVNL*NY*YMNIYIFTSPTVAELDDNTNVAIAVVFFHTV
LLGPVRVQTFVD*D*KIQMFFLAKYYHGRMPGT*AIGNGLITQTCKSPQRRQVWLISNFF
SDYYQVCYFR*RSPHRHKRLRTTRMLFEDFDRMRNRLIGALSEYSIQVRLWKATE*VPIG
NFTGRFILYLAYLKQFDRCSLVCTFFKVLHP*NLFIWRNYRPILLEGLFRQCLRHHGHHI
FASKIFCPTR*ASRAIG*QLLTYICECT*IDRICFLSVLPRLSFPIYLPIHLILSGTLSQ
G*CYKKARTYFQNSTFENNPNNKSKGILMLP*KCRISFYIVDHDKKLNIFKWVSSKPENT
AAESLLKGQRRLINSRSWGR*D*ILLPPLIVHLKALIEGHFGEQNISLCSRTVSS*RKHL
EATLIYLNCTRIA*WNHSSWTISS*TGLPCTRMIAWRILILMRVLISKILSRQMRVIRPT
CCLSKVSVTILMSTKTCPLHWRRKWKVTEP*RRKKRTSMKIRFLMKKI*ATLLMTRLYLE
ERRRFNLFT*IL*ITLK*TQRSYLWM*RSQVCHKYLEWKIN*N*K*KLRLKHH*TKACFT
CLAIPFQEKSFI*KKISRIFQKTSRKIFCTSMRLFYVRSATERQMFVPSVLSENKEEPLE
GNQVLQTIYSGVIILIEG*SCSITNRFSP**KLSIMLRSLN*LPG*FVIAGTIRQIMALS
YYSL*QIGKIDCWVSLRQHLL*SRIENQQIWIPPSLITLLPRPEGS*RKKNLPQNIIQRI
TTN*AKTKICHFNILINTTHMIMTVK*IIFH*KTKTYHSHIPSLNRQICFRTITYH*TFL
CPISIFHHQHL*AKKAQNHLTIIIAIMTIPSVLSL*QILNNRVN*TNGKEHAIIWKMTLV
NPYSSIPFQIQSVQQIR*IQLYIQCKISQ*KTTTIICHQLIALYLHKAQSMVVSKLHYWV
VTSKMVFL*SSALILPFLRNAGVRPRSSLISLPLPTRVKFSSLLLIRIMKIITMTFPKKL
RSMTIKRPYLPMLMILIGN*LNWLCKLWD*K*MVS*KMQEISRRGLLAMILLIAVQMATA
VQKAQVPLQTNTV*I*TQVFFTPMKS*YKKL*NH*T*IPIFPYVIH*GELYYILPV*KIT
QALCIH*LKRVLVLTILIPLG*LHYILLA*VVTLKLLRCF*IVK*IIH*GHTTD*LQEKY
S*QTTFIQRK*TKNKITETTISLFIMTLISAKYCHCLKNSKTVRSLPIV*KQTVIILLAG
NIHNPVSIQAC*TMNL*MRTYSKAKA**IPLLWRFSIQPCNYLRIQVTLSTTKVISKKTG
MKICSSLTK*KNQVLHAGRNKANSLILDLAPTNPKRIMVVHLSGIEFYIELMMTYQNMRI
CSRCLGVKMIN*KPQIKTVLWSSQHLILKTLKIRRKRIMRKRKNF*KNSLTDSSKTNKTS
EMIKC*YFSGYP*HYYF*HGSSCTNLATKIVPSII*AN*SQST*ELH*QSSCWEMKG*KL
HSGQNYQTCKQQEC*TI*LSVSLLFYVYIYIYVCIMKRQYT*KKRKSFKKSQKKIKLVNV
SVTIMYIL*M*TTILKIF*HERNVYRTISWL*PRQEQFFFEVGALKMVRDHERKILKLLL
AAKKASDQ*R*QII*ARQW*VPER*VC*TQ*PQCILGWGCEGW*CLLIRPPRSLVFC*DY
SVSPC**KEQLASIDIYN**KYQLVEFRQRDHHGKFL*YPILIC*HLEYQLCATDRWHRN
HIFLAHQ*LTRLAFWLRWLRLLYNLW*HL*PMPFHWGKATLQASLHRQNAFA*MPSLLHQ
GLHLRTQRKIQRQQLFYLGHFPKIPNHIEYRVP**IS*GHFATQLGLCSSEQTGCVRGLE
GKYRFQAFPSNL**FCRVERFSMNLQAL*WHLLDDIR*Y*K*IVDCPLHIF*SP*LSVF*
PW*VLRQHVPLGV*FQLLDVM*RQPFLRLCEK*SVFVVILWYAS*NTSFRQGRWAFYIFH
RGFSRMTL*LFVAEIAGEFWRLRAEFQIPLEKKNNNAKCINV*ESFLTHRLSM*QFICTC
YPQGIKSAKAGSL*LKYCPLTPSGIP*RANLA*TVAGTELSSNWLFSFKPLNIFNCSALM
EEGPTFSLMLTCISVSTIPGATAMAFTCLSSLARVMAKWFRAAFEEP*APQLLKYMLQAS
ELTNTTLPLVFFNSGNAMPTKETMLKKLMSYSFFQALTSISLTFCTGSRTPALATKESIL
PWPLTAALTNCFNTESSVISPTT*KNLSPYFSFNFFKGASDLATP*TTVSLSKLKRTSTM
DLPIPLETPVTKITLPMFF*PVTRCS*TLFFRYNILPLHLIFFVYVYICKS*CSYCLLFI
SLKTPRNSFGDTFNPVLGTEMAAQNCRSSQTQ*KFSS*KL*LYPFT*YSLVLALHRPQSL
IVVAEILTVQRVGNTFQDELR*YRRRHLWVQQ*RSLVQLSKPLESLGCHALRTQCFPNIF
LHLRVNDARCNTHGTHFITGLFTGNVHGKVV*CGFRAAVRRPSVIWFHTGSRADEDNVAY
KWRALQEG*TQCHQRDNAEKVHIEQPFPLLDVVFGVGLGDGLHRF*HPRICDNTVQFSML
LPDFLHQRFHSRPVRDVEDTIDKFVCTVFSLQRLQTSFRSCYAVDDAFIVLFDNSFHQLQ
ANPTGGTCNQNNLAHIPSLTDYKLFLLLLFATALISCIPSSFSALSFLATLRKRSKSEKK
REKTMRNSMLP*YRKSNSNKNSIRAFHVSLFQAVIS*SIQVYHVRIL*ASTC*QERPTIP
LRPIKGKSGAYR*CCLQMWIHSSIQRTRGLVQTL*GRRIYHHRVPMQPVWPPRTWL**RN
CPVLPTELWRDFPHYEKN*R*WWQ*GPCLQVFEEPKIRYVGLERYQMEF*KILSR*KG*S
VRKILFTNQTFFVVRNHRRTFERGGIGRSSSFEVR*SLVFFYIS**YILASQTCQLLCVA
TDYIRIHTYVLKCVNELRGC*CRTNATKRFRNCYLKHAPFP*KQHTTPLRLWSLTIWKWQ
DNPLVRQTFFQTPSAKGKTSRYRHRSTSHQPGSRYFWKFHPPQSRTGS*LHH*SMPD*SC
LPLFLPSTK*GRAYQNPSPLKE*TQSLKVVARNLLHKTDNS*SGLQYQHLRSLKRVNDQN
AARHIGR*NRTRQVSSSYQFLCLELLTMEIFLMGEFSLILVEHGS*HLFYKGQFHIQGSN
GLITTKV*TLWNGPTNGL**LATT*CFLDLPFPSHFRLL*KISTIVLYIRILP*YFNVIH
FP*IFTILERAGTR*KSLVNGRSMKSAIVIVTRRGLSLAIARHPLCC*RRL*LPVVVFLL
G*PWHTDHP*GPLWCELEVLNFVNTRRAGLSLVKILI*AMY*L*AQ*VFFGHPVSVICPP
PRELTLLSKVFFKKVRSNPETERHAFPPARCMLLSKILSMQCQVTV*NR*RTAPCP*TAF
YRRYLAKEERS*FNTNCS*TITILRILEAAAE*IDGNLTRE*VRLH**YI*KVKAGLFSL
PSPAQCEPRKK*NDTRKKKS*AGSNFICSGW*AITFLAVVITMVVTSLKTASSTISGRRW
T*TISAILYLPNPRLSFPP*TVAAMIQINNVASVNLSLYMVIILAITYVSSTSKQSKFSI
F*LY*PRL*N*LSHSFLDGSI*HLSV*KYY*LALL*SI*EGTHG*NHSAYLLILLRNN*S
DAV*SAVRALIFSKYIG*EKRSLSRVIVHSTD*KHNCPCTSEMSPVLNPYVVVLY*ISED
AKALFNYLVH*T*ECGETEGQGKN*RHMLV*CQ*Q*KNI*TRKTGE*EVLLEGMGNHNKV
QYSYITLLLFLSPFFIINP*ISAPTKSDDRLSLSISFSTQYIIIYQ*HELQSVDRCRSSF
*QDKR*KYYNRKMALVLIKVEVDVLVLDMLYF*SIRTIRTSS*PAE*SLIIRF*KEKYIE
NYVLNKILNFSSFDCTNLREQFING*KEKEMVCAFD*LLLQNSCPWFERSTGMRTELERG
KKRSYLPTCQISIQR*RHFPFSWRTYFTRLERMYEKETKI*SKKVP*KT*YMSIFGSIFC
ANGTLLRENKEMFVLTSIKNNINVLNRLETAEENTWGYKLFWDDCVRHRVF*KK*GKSIW
KNGNSICKRFPVK*RKRENFSTTIYEGTPNFLFLRAAMTSRMDPITRNIV*KNFLPFFFS
LVFRHILKFT*FLLEKV*KAIFCLNSLEHSRHQEP*IKIIDFLTAKSGSYDGLRDVRSLC
VELTKIDVTFV*VRGVRCITS*KSIITAYDMFQ*SKERRKRTR*NVWPGLQ*AN*VEHVC
PVLPFRHAYITLHVEGFLCIFSRVSEDLGHESFLLLPHLES*VRVSISLWQS**IHWKQS
VFLKRRNYRVLVLPKNTPGSLTIHRKHSEKC*NRLAKNIDNMSQ*KLKTDRRSLV*HMYD
SNFSS*RTTIDIS*IEYGERNTREPHFGCQRKG*WQP*SLCRPYTVRARIDDLQRPPKHH
NRLNEGRYSDAASESLNL*VCSHFLGKKSGVFERKFCCSFLEMNRLTKFIPAVVILPKIS
LHIFTQYLQQNLKDNLISG*LCLFCFYFIL*CCECFMPLNTVLCICQTFLIKPSTDNNNV
GEAF*QN*TGCNED*ELF*FCFDVRPDLLTSSFWLRLLFTFQG*CSIIESIEEEKASIIP
RVLSIKRILKKISTVTIFLFWRVKMK***MQILHSSSKYHIFKTFHLFLKPL*LSMSYPV
PAPITIP*IVRDNGKLLKITK*LESSASN*L*SRLPLFKLMLLYSNSGSELNTVKPCVRR
RMSRKKKLLVLKEIGLLELLLPRSNLTCLSFMSTGGFFINCFSHISSGHTENLLVLTDDT
SCLKFIYPSYHW*SELFFDVKDQ*ILDKRIVRVIFFI*NAPF*INSNI*FTVPGLATTLL
PKQEIAK*RIISAAVTTNLQYHVFVRVIILSVRNTYWRKKHSPAREICNILKQTYIVALF
LTVY**SNCASL*IAGTSIIYIFSRNFEWRISYILLTLILDSYTNL*RYTVQLSIMNHRL
YYKSSFNKRNVNSSYN*LLAEKIHLKDVGAGNQTDVI*KKKTYN*LR*IRKCGCFFAS*C
GLDRTIPQATFALSMTYYVGYMWRVIR*IFLAALKNSQGWAAKWKVSKEKMVR*GSRDGE
DETFTAF*HCVILLVSLFDNIRHCVGPGEKVCTYKVVTIFIAVNSLRHMYNHYAVGFLFL
YEAVIYNIIKFHRLLHSI*GFTYTVPHSNTLRNYVSLLYL*KKIRYEGQ**KGERRTVFV
TCILFFSGAFARAATT*ERTSIIALGCGGKQ*FVL*KFRIRGPADINKISCSDGTTGLIY
PCTKVSGSRGGTWDSIGDNLNIFFLIIKASLSNRNFVVF*IVDYICVDKESISQHISGLG
LLNI*NATILS*CYEIGYVCRYIKSSKVDGQ*SIVHF*TIKDVALVVRAVLSVKTFADCF
CNFGG*IGESCARIQHHWKLNIRNSFIARFTIQNCHTLCSNNHPRI*AKGIECLQHRQGV
KLSCVLTFVHCTKQDAPEVCIRSIQK*RIRYFINLSLIF*FHWKVIIYERCSVQCQCVFD
TICKFCNGKRYA*NATWIAYCII*YTKSEII*SNIFERDNIRTISPCIIRTISVCVIEKR
RIILKSR*VACIECTPIRAESVISF**DGSRRKPIERCCELVIIS*SVVRSVRHRFAIGN
VSIIHNHI*RASI*L*VQRLWRRSDFHLDNIHSYSIYHCGVKNLISFEDGRNILCAYIYN
ISQLLNRKLNIGTCGRP*NGQ*THQ**QQREDGNQLHIDSFALSSNILIFERDKI*QLIN
Q*KKRTRKNDEKPYSKIITPYILSTLKAVPKLKSSKSTACMRFTQQV*SVLTPRISRDIL
L**ATG*QIFGPLTPYTNYHHMFLFCSENLGVVRNNLRKAQAKLGLHWVINNARNK*EAF
YSCFCFFLFMFKPAKLCYSVECLEPL*FLKITLHFVMQSSSSRTFQQTFNSDGLPQ*TKR
HMTLVWYVKNNIEDSRSGFIVERT*IVDVVNFHQLKPHLFCQVGDNVICRGIEIY*SLT*
GQSGIRLHWFAPYLSKKKTYYFFS*VWIG*CFLKL*GKRGRGKVDNNLKETCFHIHKGAG
YFMSSAHISTKISTF*G*Y*VFRYQNERNQFGET*AEYFRVLSGDERFLTAKSFSIYGLV
TIFFFYHNQFFEYQLLSIPSASQRLQLRNCTKAFAESLHICRP*QYTTPNTRLMLYEFKR
*KYFLHGSRLEQTEYGLRQ*ASVRGSKSKIRIFFLTEKGNVTGTEKGFIRHLGTL*LAFP
HSAHTNTHECHKTILHIRSL*KMYDSFRNKVISIEIMRLCER*DMEDM*GAK*APVNESF
K***LMKAWV*IELLQLYVFENMFLFLSFLLSLYQH*KTKQI*WSN*LQSLLVSPPSLLV
LPLPQPLPLYLHLTKELTWSNWVFTSPISELIWPNTTCFKQLIQVRPTQLKLLKLFSTMV
TSPPC*LVFQLNKSPELSLVFHGTLPD*DQLSPVLYLRTVFTLLFQNRDMPLRMRFHRH*
K*RKNEIKNAFNINTADYI*TYINIINSFAFTNYRLGVNIIGNA*LLFYLSHN*GFFYVS
CTE*ASFTTGFVDQNPFKLFTCYSSRVALVLTREY*IL*NQNGYLNIFNDGKIKRHIRKM
C*YGKEDTEKKRKI*FKIVKITHFRYGFSEGW*RTVARCSML*IIVL*HS*HYNLCTFI*
QI**SMRKIK*YILRLRLKLLYGRKVEYS*GQNDTINDMM*ALVR*ELRFLV*IKTESPK
YYRYRRNISMSFKLKGDQRKCVKS*SL*MRFFFVEGEVGKFT*LQKNPSLQYGNQKMLYI
HMSCMKERASFQFDKLSLIAAIPLFCLPFSKFVLSNHSSKVLRMRNHSLSIIENH*VSRV
RPLYTTTCRNVPSYLKPKRIAALLDGPFKLSHFHSYLLY*RSSNTYFINRN*ASVAIIVF
CNSGEKTTYPTSSEPLASSILIKHNVPTARSVSLLIIAKGTVSLVSLSSLMNSRYSSKLV
NGPAGKYVHNFWPASL*ALKSSEPCLSLSRGSSLQVLPFNTTFSGKALVVQPSTSAPTSC
PNIFKFAIIVSTEGHYFQVQRRENSCKASSHAIFISLLIVYQPLINLLSTFEEWLKKKTT
FHYEPINRANITCTKNYELFDFHTGDDPRRITVQEICFIVSPVNSFL*TLQI*VQSLHNF
LIYTYAL**SQF*EGDKFSEWRISACAIETNLT*MCL*SAITLSMQQKM*FAKFASFFSK
NISKTNCQEMMKTNHSIQVK*ELVYI*KI*GNVLHFNCLTLK*CWLMRSLQEIISVLLFQ
YFRSALC*IGKLKSNKYIHILRRFVPLRNINYNYLLVYILMAPNIYFLEVLLNKQ*S*KN
NYGACPVVINTQ*LYII*ELCSCAFSSNILYSEPCRAVCIKLLDENLNPPFRLKKTCSLF
H*RLVTTDCASLTYGHSSTFNEANHIVFFKDKRR*KKQLKNHSQSSPS*KNSSLFQTFFS
NKYLFIFFAISSHPFAPLSCSFIIVDKNCILCSILTDKTIIPIFWKSLVMIKNITTGNKK
RDIRSTFPDV*TIKK**RKTCKHRSLKILLRIQVSLNR*ASLGSLASSRPTGLHDFSVLN
NFHCFSTSVK*TPNASSM*ETESLNDLTLAASSFFKEKGSRRVVLNASWQPMALKKKYLV
FQALFSYKYEFRFAATISQL*VSKLGAFLVISLQN*VSCFDKERLREGSRITRRNIGPKT
RTRSETINW*TQLLESFHQMLSGSHNSIQMRNAKDL*IS*QNQVNSFRKTSWGKTVFWDS
SCLKDNTSTLFSSLTSFSFIW**DGSSRFFYSK**LLPFRFYVAEKKAAEARAFVQSHDR
KRATMLGYFRQRNSAIRKGHPFHFRFSI*VTR*S**YFYKTLMRVL*ERVITLAYVLRCD
RQCHCSHSSCRLK*NTYLSVDCL*ENCVNI**KIDVAVTNIYTGKSLAYEYLT*RFIEPI
YFPILITFRYHFNAFSLCLLSL*NGSKQKLRGMVVLRSCMTSG*LPLLPLVLRFCI*ILQ
TKG*SANDRPYSINCSFNHASV*DSMTIVWEDRAK*KYLYDYRVQLYYNILNRA*WYDDI
KELLH**RHGSAHTSSQSVYFVKLKGKIFLCLGDFSGNFSVILT*VYKN*VVSIWRKSGI
MYALRAVIQYLEPLNEI*ILKCG*S*ALWVNGTGYRPLRQVPCTMM*VHLY*FSERWAME
WSGM*E*GKFESGIYCSIRVRMPYQYTIKGEYGMWWWD*SGRVSMCVLFTIIC*RFNMVG
RTTV**VADGGW*GNGRVSGSGVGYG*LEGNGYGGRWVGGST*RDGLWFGVVWLNGTG*Q
VGRKGNGG*VERQDG*G*SRVVLG*CGVWVWVWMWCGCGVGVDVGVVCV