Protein Translation for a region of Chromosome III



Send questions or suggestions to SGD

BLAST search


Protein translation of the coding sequence.

Other Formats Available: GCG | FASTA

PTHHTHTTPTHHTHHTHTPTPHHTHTTPTHPHPHTTPTHTTPTHTHTHTPHPHTHHTHTH
HTTPTPHPHPHTTPTPTPHTHTPHPHTPHPHTPTPHPHTTPTHPHPHTPHPHHTHTHTPT
P*HYPNTTLF*P*FYLSPNLLSITLPLHSLPCLIQPYHSQPPSISLLTTTNPPSTITVTL
QLPVSNSTTAYPTIDHVLLTVLLFTHHIETSTNDRK*YTYTYPTTLIPLPHAILTFTCIL
IGHTHTDATVYTISNLPYFHIPLHHPSLTISTKCTRIIMHGTCLSGLYPVPFTHNAHHYP
HFNIYISFGDTKYCITALNTYVIPLLHHILTTQFIHTYVNITTKSPLKSPKHKNILLFNN
NT*THSIAYLYHHDVINVKVP*YCKLLERMPFHVECGNPIA*YE*CFSIVSELFQ*CFRQ
GEHIVANL*SGST*ETTVSMYESSNYVIITFT*HIGRSNKLTTL*PIS*IVIHYVNRL*A
LRAMLLRT*SIYLAPTIINSGCTVSRPLLNMLTNI*TNSFIPEISNQ*KGITISARMMKA
LSKPYLTVSW*SSTRKLSWVKLHVK*TGYVMIRLEGSLLMIFSRTSKKTIMKSLLDPGLL
L*RTYQIYPPSL*MKLLPF*KLYSRCLKTIAKNRTKKKDATPISRCY**PSYPS*KNHST
RNSVTLRLFSYHKSLDSVN*MRHRIHHLRSQMHWLHKTEETIKRKEIRDVYNLRS*SSHK
QLFSA*TKNTRSTNL*IIS**QNE*IFIC*CRDS*L*NARPNSRTDNTEVLALYVIFDCS
SYQILRMDF*HRMYFPHVPRPFHFFIIY*IL*ERLCQRSWRFHTHHGLRNCKHWHCSIT*
RILRS*FTS*PDIRLKTMH*IKLFCYVHKRGCHCAIT**CGFYSWVFTIKDSGKYKARLV
AQGHTQKAGIDYQETFAPVIRYDSVRLFLALASCLKLIVYQMDVDTAFLNSTMDEPIYVK
QPPGFVNERNPDYVWELYGGMYGLKQAPLLWNEHINNTLKKIGFCRHEGEHGLYFRSTSD
GPIYIAVYVDDLLVAAPSPKIYDRVKQELTKLYSMKDLGKVDKFLGLNIHQSSNGDITLS
LQDYIAKAASESEINTFKLTQTPLCNSKPLFETTSPHLKDITPYQSIVGQLLFCANTGRP
DISYPVSLLSRFLREPRAIHLESARRVLRYLYTTRSMCLKYRSGSQLALTVYCDASHGAI
HDLPHSTGGYVTLLAGAPVTWSSKKLKGVIPVPSTEAEYITASETVMEI*WIQNLFEHLG
QPLISSTSYVDNKPAIKLSKHPVFHTRAKHIALRYHKLRNAVAAGIITIEHVITKKQVAD
IFTKILPAESFKTHRAVMIREPETTK*PYSCVFSYGGMLNVVT**HDMSNALVLFQSCFS
NVLDKENI***TCNQVVLKKLYFLCTKH*LCNSYIYITCRKVQ*TYYIMTYKLDRNSLRQ
HIPR*KKYLDSSAETGNNERFHTRLFLRCYMSLRPRLAPSRMQYRNIGIYTQRSSNFTCL
ILILYRNVRHLRYTKAYKIDLNSLY*HINRQHNIASLSYLSFPGRDGIICVYQRGLFQFS
F*YFFNILILNTFFSPRFMFPIALHITLYL*MNMHCSSDTMV*EALVKGIDNRKNHPQRS
RILEHIVSLRPYRFAKITETCVNIEFQTQFSIINC*KRLL*GCQLLFCFAGLIPLCALVI
ELALLISLQ*CSSNKTHWLRFRFFSKSLSKILCL*YTGARG**EDTTF*GLSLSSESQQH
TLTVHDSGMCYEFNFRCSAAIGAATGVWKNSTAFNGDVTARVRHYLY*LHNHTLLVRSHS
RHLSSSIGYDI*YPQNTWLYHVK*AVYRRSVYFSLYRILLFQQK*FHQN*ITLQHW*RIS
KG**HQYIAE*LSLWQLT*RIYS*FNKIFKSIFFGHAEHAQCSTCFGNHSQV*WDELYQ*
CVNSDTMFG**IYCWIIGFTRRLLPTPRKL*SQYRHKELLYLCPCDLYLFCGTKIACCTH
TTEHINL*RQQYKIPGDISLFFA*NDLQWHTLRKVL*HDALTRSYMILLFFLSFFLFRYN
IINAFIQSAFPASFIG**LLPHFQYQ*R*LFY*R*VFTDAESLPTLSLYRR*VFTDACEN
KKYDTAICVASSDVGLSSMFILSCYVIFIGSNKSVEITCFCLFCDFAFIFFCPFFTSLGI
NILISCYFDYV*KVP*FERKYFPHLARQPNHLQ*ILRVSPCLLVPGLS*TL*TQRTVPYM
PSQPSLLFVEHICKIQPQHLFRVSPKDNH**MYKVMHMLFLPMYRFQGSCRVG*AWFVSI
WHQKRRHR*QRLALKRYTGCRLLQPSYYA*SWLAV*RSLNCCIGDHSNP**QMQR*HLHE
TQILLCICKKGPCTPSMQHNLRLQKVSVSLSLPPTNCRMEMQ*QQQSQEGLLSEQPKWTI
LSSIPAKQDTDSHTK*KR*KN*KK*HQGVPKFHDHLVI*TVEEEIWQIWPPNIKK*KINS
HLKLKWQLFLNCATSVMSH*PTSKGQGYTLATQLLIICQQYRVSRIETPNSQIIRPFFPF
*PVL*EISTQQSLKICTSYKE*EI*LARQRVGK*KPTLQYSRTSFSEDLLL**YYLKSMV
L*YMANMRRTGKTFSTSRRRNQKVLMSGADLFRRIHSYRKPILLHTL*DGSPVIE*WFPL
YKK*LQLKKALVFRSGQRVWSRQLGIRHLQQH**LGQLKVRSVLNMSSSHSPYRSI*VCS
LN*FQTHIQTRYLSVEFYISRNQTVQT*FRFL*A*KRSMS*STCHRLSDVLAQ*SHRTA*
FHFFYYLRHQQH*NSSDNLFT*LFLFFFFLFPVHKTILLFLFM*IVFKILRSLHLLEMEL
L*YIPCSHIYFY*HLSSLFFV*LFFWKY*NYMLVIIEYQKKKKKKLL*HPFNVVSIHLVT
LTLTLTCRRTINLVSENPRRTSYTEDFCTTRILYRRNYLFSN**VKLVFMSVETRKKMRC
LSTGYAHKCKIIKKLST*IRWCRTSKVPS*TNRKGY*YTISFL*RVFEQISQRLKTTPFF
LYIVGES*HASKSSATFPLQQVQIGTYLTDSAAPHMQRVHDTRRQDMQKIIVSSHLYEKR
IFFFFWFKYIYIHIYRYRYTHV*MYSSYAYT*N*SDQIIPGIELNR*KFKNMEETKYSSQ
QEIEEACGSDASLNARGSNDSPMGLSLYLCLAS*TLVLFITALDILIVGTIIDVVAEQFG
NYSKTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSLIAALASSMNMLI
VGRVVASVGGSGLQTLCFVIGCTMVGERSRPLVISILSCAFAVAAIVGPIIGGAFTTHVT
WRWCFYINLPIGGLAIIMFLLTYKAENKGILQQIKDAIGTISSFTFSKFRHQVNFKRLMN
GIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYSWNSGQVIAYLVLGVLLFIFSLVYDFFL
FDKFNPEPDNISYRPLLLRRLVAKPAIIIINMVTFLLCTGYNGQMIYSVQFFQLIFASSA
WKAGLHLIPIVITNVIAAIASGVITKKLGLVKPLLIFGGVLGVIGAGLMTLMTNTSTKST
QIGVLLLPGFSLGFALQASLMSAQLQITKDRPEAAMDFIEVTAFNTFMKSLGTTLGGVLS
TTVFSASFHNKVSRAHLEPYEGKTVDDMILYRLQNYDGSHSTIGNILSDSIKNVFWMDLG
FYALGFLFCSFSSNKKLIIPKKDETPEDNLEDK*RSYFLIFILFFSPFIQTSTQSESNRC
IAMECNFLSILYVLKTY*YMDQHSIL*MGF*FFYVFLKH*SFRHGLIWNSNY**KNN*LI
NVLSIWPLLSISGAKSNQIQPTFFQIDSNTFHNKIFISSAHRMKCKQRFQKNRHSNLY*T
RDGVIFVFVFINCGIG**QLLEESIVSCPVSEVK**VCGVKGGWLLPFVRVVRQHLIQIE
LYSEDLL*NIIHTKK*IVLSHYEL**CCDPLYIYVAMKKVMGDILIQFLSCMLD*VYEGS
PDGQKPPGGVNN**YGIHVCISAEPIPVTE*TFSCSFYVLTSFDEGAFSRDTGSCFQQLP
YGRSHAVEDFFWDDIVIIGQCVTYELL*KDVCDVGDMYFVNSS*DNLALDSEACGYK*VV
LFKKVGEDIIYQYKHLSSV*GEG*LFMYFCEIYIYIYSTQIYTYLFFGLILSSLPEAHRS
RGPLILERLLLFFLFFFYSKPSF*FECEINWYSSLDSLGPWYLDMGSRCSLQTNFLVFGH
FLL*TGVLCKV*YFCLSYLELPH*IPTHPPIYFSV*VDNYFYRFLCCAFL*VIQ*W***V
EMLFATTSSPHH*SYGFCWP*IRILIYPLIQLLLLLLHSLVT*VNYSK*KRAFYLCLVCW
I*THL*FVDLKGL*WVFYSFFLAYLPFFLAHF*ADFNLSFIYIFKFQHFMFQNINDVWVL
FGMQFIASQCRKVHHMKQLKLLTTSFNLHFL*NVSTIYNNLIDDIHNMFTSKPAFKIKNK
ASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRFLNKIQIHRIASGS
QNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIW
DYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL*SVVVAEVVYLSSTECCQ
YSYPI*NSPSSCSCSQCLFIHSYGYTLIYLPLLFMSMYLYKI*YYSDSSKQSKKSFTALF
CVPFSF*YDCIVYILYLPNLNFSQTLMFTFVFKDVYTKPWENACSLCHPKATS*KRYCSF
SSPHSWIKY*LYINMVQRS*VWSNVVLAKKNTIPFINVY*IS*KKNPKLL*NYSRIVLSG
RY*ANYFLNCYAKFL*CQLSN*LSWYIKIRILKNLIFHDLFIEITMLIVLCWVFDFYVNL
LQHESPTFAMISSFSPDYFHLLVSGVLGEKIKTKI*ICNDFYIFAGGAGNGKRKYYDIKA
GHTMYVLFNFLST*EKFMNTVPYII**MK*ALHLRNSCIYIIKRELSFDLFHSICLLCTD
EKHFTKLRSL*VYCDHYAKILGSSFVSNST**FPFFLHFYTKELRYLYKRGALL*YMIKI
QAETF*VRGIK*LLMKELQMSAKYKYLRCYQLGRLLRNTFL*IYRNT*DCISIDKVQPIF
YVMLCYVCYDYSCFSSLSKD*LTLELVNLT*EA*LYY**NDIWCVLLQTALSVRGRNYKL
KSSSLCFMLEYQVNLNRLVLHWYFFHG*F*ANFCSMSPFIQILCIAGLEICQRFGYVDAY
FEKSYTNTSGKNQY*QNSDI*VKCM*YMYENYQGQIDASTKKLLDFQALFKFTIFFSGNM
KLSATSITGVSFFLMLSNASSKSFIVLEEPPQAIIITMSSAANFEPSAFSRILVL*PKCN
AAPHAGSITILN*CVYLRQVSITSLSSITTDLVLYLRAYSKV*LEITAVPREVAILVIFL
N*TGWPIFKEVLKT*HPFVSTPTIGILSAKPYLSKP*IIPLYKPPPPTLHTMPLTLFTEI
CCDFKSCTISSIIDECPSQISGLSKG*T*MGSMT*ESILFMTFVFKKVSASFQ*APLTIT
WAPVFLILSTILFFVAVGTTTVHGRDSL*HAVAAAKPALPPELAKT*GDLLPSF*IRMAL
FMMRLPIPLLLKEPLG*RHSYFKKNCAEAFPGKN*RNNGVLL*TIDISLVNFPVSCLSST
*KRENCINIFLLFGDIYIPVFLLILSLLSYLIANNLIKLWHYLMTLSGITFPLGLNRSRP
CGIMSPRRGLISFRSR*LVLAKREKEK**EHFAIDQNVNSAVKNGTIR*IRNSSHKETRT
HRLMATQALEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQESLDKLSQQYNQYMS
QLNSLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPN
DSPQSQSTRSSLGSFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINEVDCPSKTNSLPC
SPKKQPARNRTLRAAKSHDTGLNKSKKPSSSDTYESFFKNRQRLSLTFFDEMDDEDFDSD
QDTIILPNISTPPHVGVTAKGAEFEPLRRYNSHESILSNKPAPSKSLNLGSFSASFFRPS
NPTFGTSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSFIARSDTHTVKENNTNLKH
ASFMDKFNSSLSTISESFQSKRGRKNKGMNEERISNHNVAQEQKNNMDISVSIEELQDAL
NTELLF*LMPPLPNLLFFCSKCLFFFFLFRISSSFFVSFCIIIKLLYNICLIKSYHNMTM
AWPRLGCHLF*CDYFKTASGVQSTSSEKIKNH*LSKLSCPLSKSLFDFVFVFIFIFLL*W
SWW*RWLPSVFLFGAINFLVFPIYVIEAFELPTVL*DFRILTVLLPSLNLSFMSVLDAKD
LIIDGCLKTPTSDVSPFSTSSSSSGRFSKSIIVFTVFEVVESV*EFVNDFIELFCFRVYK
SSIASSLPCCILDSSLSVSKSS*LLLFRKDKLFCTKSSDMITFLFF*STGFCSLFPVLSP
TLMLLS*VSRSVAVLVMSRLYSSSAPKGFLYSIISSTILSKNALDFGFLTSFASSPISNL
LFLINSLLLRRYCCSTSSSSSSLSSSSKLFFALLLRNPPFLMS*RILFIILISISLFSAA
SISLIS*GLKLFLE*SSIIFSRSES*SSDPSPSAPPIPCHSSSDSSASISKKFVTPLFFN
SFILASCSFSFCFSCNFSLSIS*RRIASSASSLTYTSSLTSFSIVFLSAITSSMFCVSRT
LVS*NLSVSSPILSP*WPRLMAILFGRLSSAFSLGLASTSVSESDSLMICFTWWDFFCFR
IISSSSFSLSDSLRLSFSLPDDS*SAISLPLNANPEDSDPESEPESWAFN*KSFSSSFSL
LFSFCLILLFLRISCSSKFSTISFSLAISSSFRPFVSITSF**SRICFLLAFLKVFNSTL
*STFGSLLLFGL*DNF*FCLESLAFRFNIVAFDN*EIGKTLSSLDNLMLSISSSPYSSLS
LSRSSVMHFEESISRFKLLA*ELNSGTLFSFILVSSVRFNSTLLFSCSSSSFCTGFGCAF
SSFISSSSFEDESSKSARKDSLEKNFLVGIGFCGFLYSTFLAFSLLESSEANSLCISRIF
NVCGTSS*SVCATVSIWVFCS*CVACGIPIACVLSSSCAVCGGTSIWVSGPRF*MD*NKG
LVPISSVGIIGIFGDRALE*LLEVVIIWDCGSIDFIG*VCEVAPLLSIRCVAPGRPVVRG
VFSA*EVSLTRPSSLINWVGFPSLTEWIGTLNTLSCWMLTGILCVCVNEEETFFSL*LLS
LTSDFSSSSPPS*RLEIN*VGNEFSLLSFPLL*FCSGAFLPSNLFLTRFNVALANKNPFP
VNSGGLSMSLGPFPLVLSFSSSMGTATFL*VVVLFFAVNEDKACKASSITKIFGDKFKSE
*RTSLVVCLFLVFFQHNVFEMLLKQTRFTHSISS*RVEEG*GKFQVLMYISLHMRASRVG
VLVRISFTLQTYLSKRNVCVFLYIYRHI*RIP*RCKLILVWLVCFFFRSYEIFCSLFLPF
DFSFHLLFLLLI*FLHLLFSLA*EILTTFNFQINLSRQLGRRKWSIDLLFDVSDLLGFLS
GHIPLLKHGQES*PIFIG*LWPFCQFSFYH*FLDMIDRVNIFHTIFYYSTDLLQALEGTH
GTYCVTLY*NVTFS*KFQSL*SITVRAYKTLSSLDKPFFVSNEITNFNNVACHVIL*DLN
GLRERNGSRQ*FDQISGFQNDSGIVCFSSCFYCHRTFD*I*NTRYVVFV*SPCYIIPNRL
QVTFSVFRKQSHKTGLFSKRLTGCVILFLKLLYLPFINIIRIPRFISVMCRHHRLPIWIF
V*PFCLLSTLQ*LTSSSLFFENFHISSLKELEI*GKKNFRFQMCKPAIIRYNNSRAFSKE
KMGKCSMKKKGVGKNVGVGKKVQKKRSISTAERKRTKLQVEKLNKSSETMIPTLLREAST
QEPAKLKAETTLKAEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL*GIVVK
VT*IYTYRAEWYCIFLLFFFLNIYKASSLKTKPSRI*GQRWI*RWRRPRRSLFQHQIQCL
AIQEMHGA*RIILR*THPRQNPWQS*PACWTGQYPT*CRGSWTRSCHSC*NPWRECFSLV
VVFVLVRTWYILSFSVFIPSRSKVNLPIDSSLIYGIIVV*SPLKGKNGLGPPGAK**LLI
GQNSKTA*IDSISYCIYLIFGLIIISQMLQYTCHLAMYEVDYLICSYYTITVVSRCTSVT
AVKSGFFATFFIRK*ELGK*EGMVGFEFKNRGNTWRCDCCCARIGLRHL*SHHYCIPAPY
IQWLTLLVSLLLPRPRLIGRSLPAILVGKPTKSSTTATISMIL*VR*RALP*VILWSLS*
SLKMNWAQ*LTN*LSYSMCRLIKKLGTHL*TPQ*NWMS*TSIYLCVTTSFCNSPASGRMF
NRRQILWKEKLSNTLRSLTRTTFILVWNLTRETD*KSKRSKRRSPLTLLIFRRIWENKRN
TSLSPKNNWKVCRILF*RSSRQ*NLTKIAMKPCIKSPSNIRTFFP**NWHPQLRLESRPF
WPTKIRSLKMKLYCWIH*SCVTNWPRYWAMTRMRTTTCMIKWLKIALR**TF*MI*RTS*
FRWAERNYRSCKI*KPKMLRNLTRVQIQTTTFGTTVTTITNIC*KTSMWT*KRFLNIFH*
RLRLLVCWKYTKHCLI*SLSRRKILKTNLFGMTTSNKSPFGIWMIQSLQTLLVGFISIYI
LVMVNMATLPILVYRHHS*LMTPQDRIRLLRWFAISPNLRRINLLY*SITK**PFSMNWA
MVSMTWWDKTRNRGLMAPDLFHGILWRHLPKC*NFGLGIRMN*STSHHITKRAKKFQNL*
SIH*SKLNT*MVLYSL*DNYILGYLI*KYILVKTCKTCQFAIPGTN*DRIFL*FLMVVRY
PRVMIHLAI*CQTLTLPVITVIYGRKSLQLICITPNSLRIR*MPRMGYNTVILCWLVVAF
MILMII*KNFWVGNLLRMLS*RSWAYRTKFVQA*NYTIILQSVIMLDNLLNNLVPG*IKT
IK*LKSWSKAAVICLICSLYFFLKFINLSFTRPFPSPSNR*SILNFTLHNFINFHTHFIT
EMHE*HSQTFRNSPLTYNLSLTTPRFSNTAKKSSSELTPLHIFSHISFALISAVFFFETI
QLSFLLPLLLFISSLLLTSESNIEIISREFFDYNYPFYLTRSNKSKGAKCLSHTLAFGCD
IRSLISS*CLKSKNSFWDISCDQMLCKRVKQRLQ*DSQK*KKKKKKKEGS*YRAQTILVL
LDIFSVSLLYICSLVFVAL*SCFTLRHFRVSSCDITCFNFSSATFC*IL*HRRK*NSHYK
TKEK*EYY*DGIPRSNLRPE*KQTHQQQSLARAKPGNNRNEI*TRIIQTL*RLPYKRLLE
*LHSWEVATATACY*Y*E*G*WLSKTSEIISGES*TNKSICHYAIWV*NRNRFHCSNVES
LDTERKFDFRRGDDWLLNRKSVYLPNFNPIAIG*IDLQTRFPVHLGQFSKNQ*TY*TFE*
*NMG*KV*KK*RIGFCSY*QEITVLSRFRSGR*NVDGKNAMALLDVYHRYSKEVYRWTSY
SL*RRH*LEYRNEGHH*WCCTIPFVSYCRKLLYRD*TITYYSCKDWLRDTRQSKTWLGYS
EPRCYVG*LLTQEI*RRDS*FRFEYPIKK*D*AVKTKKSSTKSTIKHQHINPCLAQLNIL
VNKYINNNFAFYFTGNSSQNQIAQGLIQYNYANSKSK*TKRYS*VKGK*TLFYLIFLCFF
HFSFLSFRVLACSLFQPCNYLNRKFTRCSRIKSWKCRTKRKKIGTENLFVYLFVCLFVCL
F*FEVEVLIRNNYFAQGFG*FFVFQLDF*KYFIIVFCLFICLFIC*FVYLFVGLFI*VCK
CLINKTIFASH*KLCKFV*EFTKQ*KLRTL*W*TNYYFAAGNSLKLRNKACIFH*EKEGK
WDYSIRETGLKFVGNNNPYFHCSSTFVNKMDIVVLR*MLYSKELNYPIPNSRDGFQRFVL
SSDIIFTKTLICLIGLL*MHNNFSPMIPNFKRSNCYI*LFRLYYLLLIDCALLHNYNKYV
KADAMNFVSEFLISF*F*LQTT*I*F*ISKSLLINCSNCLVFLI*ITSA*VLLTHTVPIF
DSFVQTVFRHVN*YQKDFKIRCFKTNCILYVTSGV*FVVLMR*YCLLYCQ*QPAPGVLSR
DDRKFIISVNTINFVNK*LLQ*KSQSRRNTEHRMKLD*MIFNKGKARKIF*TFLGQRGSC
NYCIGKFTRFSTNKEKGAFKDLQAHL*IIFVLYDYQMC*CLQDGAFFSLDCHVSAPLCGF
LFFFQSYL*NEYFN**IAIYWIQKLAFNRKLQHVFNRKLQHVAMIRQKIFVFIVKSRRNS
ICPAIRRKEDY*RVLKNF*NQK*SKALLFLAL*RSSGQLELPKSVCLAR*DKSQKSSKQV
GGIIWIKVYILRIYSHVNLTLLSLNIFHLTLLFFCLILISSSILKPQKRVTQLVSFCLKN
FLRCPL*KIGNNSIVVSLSLDSFNTHSASVCS*I*LNRGDWQKWVRHKRRIVRDV*IDTI
I*QRRKVIVLVHPLRLFRLMKSMATS*KNRRLLLICVLLLVHGVKLHPNSVLSTP*LLVL
ILFQ*SRCPML*LFKVILQQKIVDQN*GVI*RLGKLIQCCMMVLLMLVWVGFRMLSPNLN
*PYKL*SWPSKIWW*TVLLLLKFSDPRIIIN*FGFSNNCLRKLKPQNHPHQEMFLQKFL*
CVKVSRHQRGWTQDYWIQKKFLKNCQMGNRIWSPRFIIPKKKLEKDKVMRKVIIYCIMKP
QFWILSGRKTQ*ACLEK*ISLQLMRMTMNGRS*RN*NKPQTSSVPVLKI*KSWVKRILK*
S*DGERLQGKSWASKLRTTLKQKLK*YR*QKRSKLKKICKVYRRSSV*MSSAKEEGRTK*
SKRNYRECK*T**PPLILVLKPQVWVKNRCLI*KLQKRLVS*TTWRRVRKE*FLQTMN*P
KIMIFTLMKTS*SKIRILPLMRTI*KAS*MPCIVIIKLEGRKGMPSLELSKHVVAIMRKN
GPVLMREV*KRKKRKVKIISKTMTMKVSKETPMMMKPSPI*LAN*RDKKVITN*VVRHV*
FSMIRYLITLNLICQ*IPSMMA**VPSLLVIFLN*IRKENMKKCTRNKMKQILRMRVQVM
TPISKLWPTIMHQKNSILIMIQRKKKIKQRKKSIPETLILLLLKP*LWHIS*HWVRKTSM
ILLMKVSIDTPSVTPKICQIGF*KMKRNIQR*ISRLLRRQRWQLKKK*RQ*TPVLLRRLL
KLRQERGCVP*LG*KRSRRRRA*LTMIQTRQRRTRLKKFLD*CVRLPKNQRPSQRLLWLL
PQVGTKVWQVDQRALRVSIRWLMVS*RMNKEP*DVSQRSITRKSSNKEHYFSIPLYNIEN
KGKESNRYIMYT*N*SNYHQKTYRKPIVLNSENTSAQ*NNFYSRFTDLFFLLLPNTLEKM
YMMEMSKHSNVPFLILE*SFVSGLGIGTRRVVEFKWRNVVSSVKRDSYPRPFL*NGLRET
LLSPVSQANITSGSNETSNLSPLLLEGSIYLVCNVTSFIVPAFNSKILSEPHALSRREYS
GNSKSSSPKSSKGEDWNLSINNSNGNCRCIRYMHLGRSSKSVRSIMIFGCKPIGSFRYSD
VVVVE*LYAIWPCLYNKDVF*HLSILPSSILQLQRIPPISTSLSSLASTKNTPTSSFSSF
TLAIVNSSPCFNRRYSTIWICVGSTDISYVKSSGFHDRFKSTSGGKYCSMSNFSL*NEL*
TGLVINLSGTSEEFE*TEKPALSSFSITLKLLAKSALGLQVILVKDLSKLPVLSNSHLCC
KTTPEPPRTVK*VSFWRI*LPISSGAL*STVTLCLVTITQLETHTSCVYSPPDLIMISVS
II*SFLSGGSSKKGTFFRKKKIIIFYYMCNTSSNHKQELRRQSSAVSVSSNTLARQSFSY
PLLRVLFLRGRLCSKIGSSFRVLH*EHTVNPQRPLKLTCICLLKDTFQLFTFIFISKRAF
*TLGNYFILLLRIGKCPIRILNMCKYQSQIL*ILCLHHPKEVTAIADR*QYQEILIF*NS
LQQL*IYHLHRRLKIVLQLPQLLYQVHYRQYATIDFLAKPMKTLER*ICLNQDFIRYHQR
TICKHQVHDFSLVKSQVFHRQLKASQMPLLTLTMR*RQGLGHLNHIEDLNPLLLIWRLW*
IRAIVQPVLTL*LKKKRTP*LNQNRKMNIMSKSFQQHYYPHCGLPFVYLNRPLM*MIQLS
MGHRPITTMGCKTPMHGIPTHSIR*RSKAKSKDIIIIRSSYL*P*AVTRNLQKNKGRLLQ
*QSIRQ*HLLPWPIPLLN*HLLPQHQYPFMTAMRTLT*KVIIFH*KITLDMPRMVILKSA
AIHSLIVCWIAIKDRILVENREEEDRAVLSPTCNTAT*LII*KVDETVTR*TQSSTTRVN
IMKCHMMI**KMKTLMHSPCPFQSTVSTMKIVSEGLLRERTMHPFNTLWSNPVRLMARKK
*IGLKVMTVMNIPSLKGRSEPIRN*VRTFSWVNQVIWLICPLLSTRREKPQMKLVT*SLV
YPRMMTH*KRSMRATAQQQAMKAGVLAMMR*ESRRRTVKLGGKENPN*DSLDIFFQGSNT
TILIISNKKVNRNLNGIDCM*F***SVE**I*NFKVIRNKN*IDIYI*KLLLSFKYIYIH
TCIRVYLYL*RTQ*LYSFGF*PEVFGKPHSNKISLINSGFSVILEKTSSFLVKIIPQ*PV
ELKPIFISSEKAFERGTTQIHSLVNIRL*DFFSSGFSFNQSWKKVKALCNMEM*HIANRS
SSTVSSDSGIGKTK*ANETLASCKGSVLKVGRKCSLPLHSLSWKVTNFSGICRICKCLWS
NEEPLAGPEL*KTMCLLSDSSLSKAHSNL*AVNKSVGVKASV*CWYSLVTNKVCSGITGN
LFNSNLYALLSAPPNSGITVNSSSGLPSGSSPSGVWPRSGFSIRLGM*LIKYGMLVFGSF
VFVVSVWINFKLPLSKALLYLSLIKDAMSAGILIFILIFTFLFVLKSI*TGFQDQSIVF*
GKL*IGNNSNVSSFILTLYCISFA**KKN*KREK*ENLLERSETGHLAHKYRIGK*KAIY
ECSACNWCLYPRIASCCRLWEYRVSWGDF*AIRDARRRNNYFRQTTYDSISGRSYKMTC*
QTVLIIRLLTGR*CK*LW*YHSGM*LFTLYRLKKISISEPSLELKWIEATARPASLNAQL
FKRNSSNMSSFMYCPV*FIIFYLLCSS*S*DFFL**ILVFIS*N*RENKQYITKHIKTNT
IKKRIKYSLK*LTRGLKTEFDEYSQDKNHMYVSDISIYNQTLSRICL*TFC*RPHQSATN
*DQLILLLEKIFFNVLQRDLDPVSSSSSSSKVKEKSESPCLFRRRGSRVVAFLSLGH*TS
FSNILVM*EATGSSQVGASTW*YLDQALH*VPPG*TPLQYCLWTFAQTISFEYQSWTTLY
GLIIGATIILDWETVWLIFFNQFFLSSNDLINLKSKLSSLASVS*STIEYCDVQLYGTEM
GNLSGVSSLLSFSSLQMQSEAGAHSVRQSPLFTTWYCSQS*YVSSGLKILALLLTLPIAT
PRETSWKITELFTIAGAMDLTNDT**KSLVENTVSTPSWDSTPGRRSRASRSTVDAAEVK
ATKREDAVTRYLLNIGSK*LQIFLS*TLELQ*LGSYWDRTLLRKVYI*KQLFKSECKTKK
SSFIGEKYQKKENHTHSGIPALLAKSIDEQDKQGQLMHMFCVAFLRSANASVINIPLVFF
SSFM*Q*LVDFPNIRLKAKG*QGIYLIPSLCLAHCYAADLINKCGSCL*DLHCLFPKGRW
DKTHFP*GET*DTL*GR*GKLVD*RRKSVMR*KKKISIYIRKYITSI*VEKNLYVMSFLP
LFFISFSPLNR*RLKQLKLPFQTLYFR*IMQIKNIVAVLATVTAINAQVGIEPNATTPNA
TQPNATQPNTTLPTASVTTTVSIGEAVVNTMAAGAFGAAIAAGVAFLF*EHFYFLYFFLS
F*FHNRCSKLGSFLTFVPLSFFFVLYV*FYFNHNLFFRYLIITNI*Y*MYIRCVYALL*Y
SLTVLLYPFFLSLLYRRCVTNSKKKKKKKI*KRKILEKLYPFVTYNRETCSVGKISHLKY
NKENQKPFFHYLIDL*TVLLGKVVYSRLYLHHYL*HMHWVPLLIRQGDHIM*SLFITVIS
NFKEEQMNRFLK*MSRV*TQTHRYQSCVKKICTSLNRLMIFFIYKTNVNSSWGH*KSQTM
ILTFWI*TA*GPLVVT*LFRIHLN*SESKPGT*IKSKGSSNYRD*PLWFLLKFQL*NFVS
HWSGKLFPS*TTSPWILRILRL*RILSYRILH*QTSRISTRFRKLILSISIITDF*KLFI
RTLKPLGDNSVYMRTLRS*NLKCHT*EKWKT*RLGTHHWSTFHN*QK*KAL*SSSKITFT
N*T*TICRRLVEH*ELSTM*I**KLIWRT*QTFKVA**SPITNPSRILLSCQT*SRLEVL
FSLKVRSKISCSIA*NW*KVALLLRVHQTCWIAINGQTHQMEDQSSGVGNSLVFLVRRKI
R*MLNRMVQS*KKGTKI*RKKVKTPRKE*FQNTRTQQIQACNWTPFFLVHALLLCYCFKI
TSLV*QKVFFVPNIIFIYIHISP*KAFEFLSFSFNQILSYY*SNNRICTMATRLSNSPLA
HSSVCS*SRMMKHFLMLDNHFA*HES*RPILLVLPVRIFPQGCHWRILVAIQH*DGNRLS
PSNIIEIPT*SSPLHH*FLKDDNIFHQRS*QLYQNQLSSLYLHCIL*QIAHVIFCPCR*I
SRKQSTRQILQIGGASPEGSQRISTSFPDELEKMPA*ATYLHYSPLTVIKHANGCPSI*S
F**SAIVVENGPDVVD*MKNQGQITSDILDAGVL*EPEIVNCFFETARTSSSY*SASART
AINRH*LSVHFPKK*EII*PRV*RLPGKKKKKKKKAKIRSLEMCI*YI*CVCKYLFN*PL
GFQLLV*NRRTDKIRDHQQDEYSNKQFTLFESRTH*IKLARRCDPCTKYIKA*ITYNACG
FQIGWDGDQLRIGSWQ*ISEMSDNEIIINWDNWRVWGSHKLFFLILGHFFCWFTSCIQ*K
LWYVGDLSIF*FHNDCLCGNIIRCLGNGHCFDNLGKNELFSLKLRFVNVSSQWIIRKIVA
*VRQTLIWG**LI*FHHY*LLFWNRFRTEIGINDPIFTENNIHWKPKIRRILVLLGNEDF
SCNGIN*VKSDCMMFFISDQISR*VGVQIFIKNRFVT*CNTKSV*VCCFPLAICHHFLFR
IYGFFPSLFYRIVFDYVAINAIRVMLCDEYVGTRMVVGNYWYIRILAGIQFEQ*MILILK
LNQILVIMFIQPNNGINSFPFR*GGS*FDNRLIFSNFNCQIMPIMRKNNKFVMVFIRPEH
FDALINF*IEFPDKLALIDHIKAADKAIMRQNN*DFGESELQI*YRGILSV*S*EFSEDT
SW*ELVFFQ*VDKAIPISCQSKPVSIPKRI*IKFRFHIFVQLHIPRIEDVQYSIVYHVSQ
PFISLPNGDQFCAIGRESHILGIINVQH*RQGIFTMKIFHFIEPLR*LQFPFCQF*LLIE
NM*FIVLNRYLIV*I*GLR*NGRRRGIIYAFL**KPIV*IIFLPMVA*RVHTNHCVMVIT
IQLNLINGKG*NVSEKNLSGRNVKRRN*AGSFGRVR*DENPVAVSRIRDDFLPRT*VSQL
PISDKCII*KNGLDTTRV*EE*NEDVHQVCTRYLHCYGGRGG*KC*YECRY*LLMECIYI
YVIIYLHI*YEIPAIFSLVAV*KITVYEEGFNIRTVQLSNPQRPNVSFH**EPWG*ALVT
AGPC*WVSWYGRAW*LV*I*CLAKFLRPKSSMDHKAILLYRDQYLAGLSCHGAK*HLGRV
WCWISSLLVRKWNLPKMLRNAVFFPHFVDGVFWTRKDLQGQ*KKTADCGIWN**VQWNFL
*CFFYFEKTRTCPSEIPCD*GTR*KTWACIPRVRTI**WDSAPQLAL*RERRFV*PQGYL
SREEYRS*HP*LLFWWGLCPRDNI*QYC*KTSCHVRISFRRTRGRI*ESSGE*APTVTEK
VAKSQTTPIRAF*R*RIEIGEV*WEEGRAQCHHGWWRSGSKLESQQYPF*F*SCH*QSFH
WVVRQRINPSECQWQCGAVAVVCRAFSVSKGQRNPLQIG**LECIVPVGYQERVRADPTV
LSLNLALCRIS*YHYHLCRGHLVCEYGRWNCYYLMEE*IQPSFITVIGKGEGMEEDEISS
FLSSKASVHI*VKDDAMHLLLLRGQFSLSLRRSCSVTNIANNYCV*ILTFIFL*FF*KNF
LENFLYISI**KTKVIRITIHREWHLLRQPIQRQHRLPQQLFPGLLRTRPYRRRRSDRFP
**SRIKSPRILNLGTQQIRTSYHLGIRRLLGNLQLRRL*HRFQCGLV*QSKRRMWRWRRY
QLVLGKLGPISYSDHTMGHSTKQERPSLGR*RFRHGSYRPIGRQRNLGSRRSLGTSRLGR
HHLSRSP*PKIQ*P*TPTRSCRSIRQTPLQRVEANRTSSLQSCRGWQIEGIVPSCSSCRR
VCRIFWHRC*QSSLDLCSFWPTR*REACILPILPRHCRISNPKANRFRRIGRKRNRRFHQ
SRARLPLATIFQKHQRQRYRLSYRCILQARPWRRASK*KA*NHRLRFQRRQSRSR*SVCW
PWSKRWR*SRRQSYRIGR*LE*QKSR*QGKLVDQQQRRQPVGFA*S*IGQWPRQF*VPRN
RSSC*HRCF*KSSSLGTLECCVPYTDPGFQYSRSGPR*CFSQLKSRRL*RIQEPCSYSGH
TMEQKTPQAPSRATECTH*RSRWPT*RQRSLQGPQPLVGRKQRRRAAGRTMTGRHQQKTS
*RDRCMFFFM*SLAALKLPIRHAACNKKMHA*QNIYIYIYIYVCPYGFFVLLWL*QHNKM
LHGGKLEKETSERKGKKRRRPTG*HIITCSPG*FSGHVFRKVCRSEKIKKNKKREITITT
KMEKKKILDAALAPRIISGVPTDGQPLSGGPLSWAWCHTTLKRWALMKTRPYKYPLSTEP
PTPPSVPNSASVNHNTTTNTTLSYTRCHSTTYTKPLRERSSRPWTRSATISRLPPRSWTN
*LLTSSNKWKKV*LHQRKATHWPRTKVFL*FRRSSPGHPTGRSAVFY*PPTWVVPISVYV
LLTCMEIILSPWSK*SPRFPMIC*TMRTSHLTTCLGF*HVVHWPL*RSITRTSWPRVKTP
SP*NWGSLSHTL*TRPL*TPGH*SVGPRVSASRTPSERMSCNCTRSN*ALRVCL*SRLLH
*PTTPSERTYRIATRPITRTQ*RPEKSRSRSSDVFSVPVPMGAIWRRSTRSRSCHRSCVT
S**RRVRHT*SSMSNGGPSIMSSSTCLLLSMTS*LTRNCQRTRDFTCLKNVSQGCSWVRC
CVTF*WTCTRKACFCNSTGPRNNFLAT*LHLSSCHPKCCRILKLTTRQVYVKQSCHYYRV
SDCPPLQQSVFKFKNWCARFLGDLRI*PPCRLPRY*SRQML*TRDIMVKSRSVVMVPLWN
TTPVSDLC*DTP*PCHPWVPRVRGRCT*RLPRMVPEWVPPCVRL*HDLFTFFWFVYVSHR
TYHLLSFIYIYIYVYFQCIYIHSYTIPYKNVCMYV*FSHINEQYHRKRAFGF*GKMKNNK
CLARSSFIIFGSQI*KTLPRGRTTSTNKMSHTNKIAYVLNNDTEETASPSSVGCFDKKQL
TKLLIHTLKELGYDSAANQLLLESGGYQNESNHIQTFFKLIKTGQFHLINWQIVCSLPLA
HSSPLRSEWLQRLLIPTPTPATTSLFDHMLLQLQYLQQLMSSVNSSTCSDAEIATLRNYV
EIMILVNRQIFLEFFHPVTNSASHKGPHTALPVLYLRKILKNFIEIWDSLLVSNDQFLNE
ENIFNPETTLRELSTYLTNPKLTAQLNLERDHLIDAISKYIDPNELVPKGRLLHLLKQAI
KYQQSQDIFNIIDPDDDASFSSPPHRINLLQDNFSHDLTVTFQEWKTIQDTTDEIWFLTF
SPNGKYLASATSESSRGYFITVYDVEQDFKIYKTCVSLSQSVLYLMFSPDSRYLVACPFS
EDVTIYDMNATSLPDASATDSFLLYPSTRLSPMDSFKLDTTTYPDDTESSASSSSRPANA
NSNQSRVWCCDAFHTAERAGWMVVGSPDREAIVHSLTTKESLFSLKGRTCIALGHDENIS
GRKSIDPAKVLYKPTSSNGNWQYVEDDETFPRVHDVKISYDDKYVLLMTHQGVIDVYDFS
GFPSKEELSKQTVDPKNFLIPRIARLDVGKNMTCISLPLNTTHQGFHRQQISESQHLVLV
SLQDNELQMWDYKENILIQKYFGQKQQHFIIRSCFAYGNKLVMSGSEDGKIYIWDRIRGN
LVSVLSGHSTVMSNSTKPMGKNCNVVASNPADKEMFASGGDDGKIKIWKISRN*YSTLYI
YVSKVLCNKKKKRTNPTFFHFQVKLD*VLQPLFYLS*HPNSLAQAMIASKAKRRNKTNSE
YYAFYR*AVQQGRVPGWTTPYL*Y*TY*KTWILFLEVQSN*KLILKPRTGHLVIIHTKWP
IRTFQTYALNRTH*RKIQEYHKMV*NLPK**CTSKFD*KSTETLWQEIVES*RHPALHLQ
RSKHLS*LN*GYSCAVLPWRTKPL*NL*L*WNH***TTQ*EKSSHLSIVWHV*TIRKAKP
NHMKGNSSSLVDPRRLAHRDTDCGRMLM*NRQLLSVLSHRQSTRSWAVATQTTKSQRKEQ
PLEHPAYCPF*MRLRT*IQSEQ*GHLNNLKMHLYR**Q*LTSLPYQVHKLLDFDISKNP*
QKWAEENSQQH**RQNNHWPLYKAQPENKSGYHSILKSQQSTMRPQYQTKPEFCL*I*RS
PRDLLSLKRK*LL*FGIKR*GKRHIMQNLKYLRRSDC*TNQEHTYLNHYPFLTGRVWSDR
ELLHHLYSQIAAVVREYTLKPQKRQMVR*KMSKRTIP*YCFGLFLFDSSLPIHSYHL*FH
SSYLM*RICYEQTIAYKGKNRGNIGTV*NLSFCLHYASFNS*GIFV*ENTVLRN*F*QFP
KIVERRYQCRTIQQLII*DTLHYT*QKLKHGLR*Q*KGI*QHKREKKNYT*NFLHMNCLE
*NRHFSYLLPNY*ISKKLNKKSRWFKNCAGRRKNIISHDGSHLDREKTK*EEASIFIS*K
KKKTKKKKHKYLYLIAYDDNVQ*IQNMKIVQSFYFYFLFRIKLMEQMKKMDKKTKKKKKT
KKKQLCWRMINF*FF*LLGFSIFYGFLCKMQ*TNPFFILQV*EAFIRKTRIHRQQPAQSL
LWFLVLEKRVQWMIPLLVEEQVVGIS*IGPMHRRPVLFQY*FQFQKFLVTSLTSSWNERS
TYPMEMVLWLHR*RYHLPWRPKYLLQH*R*RLR*RQFLSMRLKSG*CHLRRTC*QLCKT*
RLKTMEQNHPWRVWTLSNCRRSSFLR*NSIQFV*QCC*WPLTLVGLDKTVAVI*P*VVED
VVGCDGSGCGI*SGCCCYYERCVLGKV*TVVGSLGSEAYRRYYCCGTFSFEDHCCYGDDC
GDDYGGEVVVAVV*IDHFLER*RLLNLPHLLPIQSHLSSFVVAS*HYVGDASFSC*HYST
MSTMLQFCCFCSCCCCHYLHHSWNRIFWCQRR*WRP*WEPTW*QSMISEWVFCSSSFLWH
PSLLLR**KQGSQ*EQVSMGKMWAMVPASS*LACSWSSLVLALLGLGQ*QCLRRRFQQTS
WAEK*KEDETR*QVQSNPDVLLPI*DPKRSS*NRKRC*EMFTLVLFFLCS*PTRSEKNFS
LRGYIRAPFLKNLR*ASLKIRIIR*CFEVQQDNI*EGKKERRQ*ELGSCSRVQIHMQVQK
MVRDNSNNGSDKSVHWERRNNNGAGPRYRSRSGNTGALATKLSNGTLSVRGLVKDRTGSG
KIAGCVEAFLDARTQLNTPWDRAKCNWLDQIDYYVQLRKTAFSKELDQLRKPMIDAYVAE
MRQKFDASYGQSRAQLEAKLAQVDSEWHMVHGDVHAKLEKLVEERRFLKRLSDTIVPPRS
KRSQRLSPLTKEDRANCICPQPKGMSDTAWFEAIQKKMLGMNGTIKLLETEQKLLADEKN
SVRKTFWPMVEAHSRSNEFAYLEKCIRLMASQRAICFCLDIEAFETNQNVITEIGISIYD
PRENMVPSMVPITKNYHLIIEESLELRNQKWVCDYKDCYLLGESYVLSLKECVHFIQSLI
NYYLVPVTEEDKTWSRAFVGHHVSGDLKWLETIGVKFPGRGYEGHLDHTLLLAETPGDLD
VFILDTEQFYRKSYGEKGSSLGKILRLFEIPHAFLHNAGNDAYYTLHLFMKFCDVNFRKI
SGMDDVLKVMGQVKVWGERDVREPKVVPMSYAISIEEAVKNRTYRKGVKSSRKERVCQTE
FGGLTYFGTAKDAFTSTLPTH*IYSSIFFL*IQTHACIHIHIHIYKLIINLCAWKKLCLP
LICKNRF*QFLQFTSLPQFLQVVVASNMFTINIDVWHGSLAINLI*RSLNVCAFLHVIQL
QNQNFGPGNL*LFKKRV*GCMAVWTVRFGCDEDLVFCNKVLDVLDSFLRYHFFSF*GFVY
LYNYANARISTARSSLFYAKVPFYII*TFHLFYIFTPFKTKFPHHVNQEAQGG**GSSR*
RKQASQSGNAVAAARYL*TAHLCMKFMFYR*WSHTSR**L*NCFDLDV*SDQGNS*TLYM
LFINVVSFLRMKTTRL*QCERVIKHWRQAKQEHGVSFGSSAYSYHRDDLSNCLFKGLYAR
SGVSSLDSAYQSRSQRL*LYREPRRSCAST*KENKVWEPAAAVQDSGPLGSVHLTRREVY
SHVQ**QAAAKAERDGYEL*KQRVR*KV*A*DY*EVRGVCYLVAKLYYAEQP*ECEGVFR
SLSIGSNSQTEVLEEQPFPP*RRRLWRTV*LHG**RRRHFVPVQLAD*CR*IV*DSTDQH
EQRGTQDSAHNQRCSRVCCVVTELADRAAQGQVLHRR*RGHVQVHPGKGDQKESS*ISAI
GHGG*VSG*LNSCQ**TGGCVDCIRRPKRSGR*QR*K*SRLVR*RYL**KRAG*QQVY**
RVLRGRELVFLSAVHDLKPFR*S*QNLKKYVRMHTHIYIYIYIVHLILLEV*RRTVHTVS
GVLGQV*QLFPAFTFKHMSQVSTTPCTTYLHPRRH*RIVTMICDGSRGYLFVECGPSTTS
VELGLARIQRSVAVGTMVDTGLVGV*IRTGVGPFSGLISQHHQLQWCQGIVPLHVIRFVT
HFLALIPVLRQYNVSSPWKSPAYSYNVQPAPLIHFLILLPFSLYLNYHRRHISQ*AKLKN
TIANYNKEARSKDSKRQRSY*QR*QIRWRTVNRPSMRDQTMLRRIWT*MAQY**IMKTFP
SGRLMM**LGVYPRWRWKKPIHYVRDCEKMIL*EIFCRNCACKIARTCVTVI*IRP*NSR
Y*SIR*ETASWSGRTTRLKRT**RY*KTCTLLHLRNCKNFNRSTQG*GWMSWT**RPAQA
LLRLTHMECPLRYLLQTTQLYPVVTVCLFHKQTISTQFITDNHRQGENPR*RYLGNPVFP
TQNLCTRIAKTKYPKYLQTNLTHLPFQQRTHRGHHLTRR*NSCVHLKKTPANGS*KTQ*K
DIT*QIRIGDNMSWSFAMGIKRGC*N*TKSL*SYSRT*SNRVCTPPLC*EEEVISKK*Q*
*TEVTMSPPVEDSNVQLSCTSSY*TYTNRITCMLAEYI*KKKIIDAFKLILLYYIMLYYI
ISFIDILRYVEYDDEDGGLSVWIEFSLSFHYLDSFLIFLKFT*QLIDLLFFTFSDLKSIE
IFLCLFIYI*NWLGLIFMFG*WIFV*YFLSYGIQ*LGVLSYN*CESILIHYRTLNILLCL
SFTLFKNCHMCMNIFFQIINIQWFVEVNKSCE*WSRICPFK*FIWMFGMQIRVFFQSIPA
VIYTCSINKF**RRVSWCVSLLVDVSGGHQIGGQCR*IYFM*SKFIVI**FLYMRYCIVF
PTELPDKFLHVLYVR**WKVDQKQTVRLVGI*TLVSFSKHEMQRSFLAFG*CLVIR*FER
HHYKPVLHGANVFNTHPVTLYLRLLSVT*FVRPKCLLLYHPLNVLFFFLLIS*VTKK*KI
FQFNLRRSK**Q*GYSFINRYLIPTLATTSLLIQNYNFYVTIHYIVYLYSFKTVFCLIYI
CIYTYYFR*CSVSKLEIIYWKSFGINPSLLILIFTAFL*PSRPSFLATHITALPMFSKPS
GVMFWAVINFWKVAVLAPLYCLA*P*VGNVWLVPLE*SPHDSGV*APTNTDPALSTNLT*
SLALAICRIKCSGAYWLDISRASS*PSQRTIVL*AIHLRTISTRGSCKA*LWTAS*IS*I
FFSLKLTPTRITWESIPCSACDSKSLATKSTSASSSAITKTSLGPAGISMEHRA*VSF*T
YILAAVTN*LPGPKILSTLGIVSVP*AIAATAWAPPARTILEAPTFSAT*TTSGETLPSD
FLGGDANTISLHWATCAGTPSINAVLGKMAVPPGIYKPTFSIGRGNLEHKTPGWVSTSRV
SVGN*AAWNLRTFSIERSKASFISSVKPSKYSSGNGALRTGLDNFTPSNFSVYSKRAELP
LSLTFSMIGLTKCIISEVFWIGLLKAFCTPTLSEAFTTSK*IGPVSFSSSAFGCPTNFGL
ASPFRLVTFRCFIFRLFSTSFNETSLATNLASAK*NKSAASQESSFLPFASVSSSASSLI
LASNNAESLNSLLV*DSSGASCSLCFSKDSSPTKPCLNSPKQDMVSKWQNPTFSCSTINF
KASESQSVEICKSFWPLPEVSPLIQISFLERE**TPRPKSMAFAIDFFEEYTNPRQRSYW
STTRVVYKPSGRSVRTSPSTSLVNISLLNFFMDTILSCENFCFTMN*LEKTPFSSTTTRS
FGTFNCSTKCSAVLASWLAMNREETPLFKKAMISSSLNLPLGKDKATNGTSSSLENWRIS
SLLRLEPSKST*PTSETYSFLLFHEARSSINGRIGKTIIQKKNFVNYCITITQRSCAMIF
LCMYNTHRR*I*RSISIIYTVYYCS*SYPFLTFYIE*LIKKRESLCMGLAIN*LIYRSHY
*SQFDCLEELLVVRIVMGAFCCIMTHRIAMLTPLLSSCRGIDWCRGVENWQRFHGCLCLS
LFQLFDFFISLFKFFR*GCHLFR*GILWFCQK*FLAQILVFFTERIVMHFQLFAFFSPLC
LV*LKLVFYVA*LFQLFFQEFDIFVGTSGLIMRKISLFVFFDLFV*LAYDSK*LFILSVK
KLLLFGLLSAFELQLLLEMVYLFLSFLYCGFIPIKSRLHFFEDHSLVIE*PFVV*LFPL*
LFDGQLGFS*FNCNFAAIEVIHVAIVRFPIAGGVVISLSV**QDRVDLHSVFSVIVTKFL
LLMVIRCLLVHRLLITAVPTGDPETSHGCGGFRIIHGRELVSEPHNRSVFGY**RFHCRS
SRGLRYRCLLDQ*CDFLQLNK*STLRILRLKILLPHE*SIVLTNVGK*VYTSKHSSFRVH
WTHVFQLSAPQIWDLYETSYLSLISIHGISNAYTASHSSTPFTLSFDACLVQTFLVSWPI
ALLKNLTVRNSLKDTQASYTIKKGESSLKERTYSDTNV*QRSEMDTDKLISEAESHFSQG
NHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIAGYVMDNRSGGSDASQDRAAGGGSSFMN
TLMADSKGSSQTQLGKLALLATVMTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASG
LAALASQFFKSGNNSQGQGQGQGQGQGQGQGQGQGSFTALASLASSFMNSNNNNQQGQNQ
SSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSYQNGNQNSQGYNNQQYQGGNGGYQ
QQQGQSGGAFSSLASMAQSYLGGGQTQSNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQ
QQGHSSSFSALASMASSYLGNNSNSNSSYGGQQQANEYGRPQQNGQQQSNEYGRPQYGGN
QNSNGQHESFNFSGNFSQQNNNGNQNRY*TMIQFAFYPLFTYLFIYITLFFFINWAARQF
CCQ*CLNPSFASIFTMWTLSKQSCISAGCPF*RIEWHNCTVTFRAVSFWCDDETNMKRL*
FETNNVILGIGFI*MTM*EWLCKVCVALKIFGYDILYLFSFKSRI*AIKFLKIKMVATIM
QTTTTVLTTVAAMSTTLASNYISSQASSSTSVTTVTTIATSIRSTPSNLLFSNVAAQPKS
SSASTIGLSIGLPIGIFCFGLLILLCYFYLKRNSVSISNPPMSATIPREEEYCRRTNWFS
RLFWQSKCEDQNSYSNRDIEKYNDTQWTSGDNMSSKIQYKISKPIIPQHILTPKKTVKNP
YAWSGKNISLDPKVNEMEEEKVVDAFLYTKPPNIVHIESSMPSYNDLPSQKTVSSKKTAL
KTSEKWSYESPLSRWFLRGSTYFKDYGLSKTSLKTPTGAPQLKQMKMLSRISKGYFNESD
IMPDERSPILEYNNTPLDANDSVNNLGNTTPDSQITSYRNNNIDLITARPHSVIYGTTAQ
QTLETNFNDHHDCNKSTEKHELIIPTPSKPLKKRKKRRQSKMYQHLQHLSRSKPLPLTPN
SKYNGEASVQLGKTYTVIQDYEPRLTDEIRISLGEKVKILATHTDGWCLVEKCNTQKGSI
HVSVDDKRYLNEDRGIVPGDCLQEYD**K*Y*RSHLIYTYNSVLIYCSLIEDFNIVFDVG
LFTWRCGWGTED*LSLYGPRLRDFAWQSSFYVTIVVL*VTTQAHCLQGNPRVDLSGTRGM
VRETRECSCVRWEVSL*LFSYLVVGEEDYRTKGLIPC*SRPLLTGRAFYSLSHFVPNFFV
SFTSQDNSAIWLGVESGGCFFNDGLDDGLDVVDSNFTR*LRFQSVNSTTSS*SFQISCNS
RHDIGLFFCIYVDIGYFSLRKKYKLCSQFLQYGVLIYCSLDKVQMPRP*PEKLEAPQDLF
LYVIFT*NATVRFFSNNH**KRYTGLLYDNKVELYY*AKTFLHQ*CCSLLMLGEGAGLVN
SVSSVSELFLRLSPCNVR*ECKHLVCNAIVR*R**VTNPSLTSS*GRKVLSPTFFKFSNC
IYIYLVLLEFTYPS*KCNFCRKTLPKKNNNEFMKHTNERAHR*GIITS*DKLRSPHMRIS
CSVINVDYVIDKSLFFWQGSWNTKDQLRLYSPRNRNILRQSRFDVVIIVLQISPQSQ*FE
GSPRLNLHSTGRMSGACWESGCQGWKISLQFFSWSFISEEND*TVSLISARLWSLLGFSS
WHCARNSIPYPFVCITNDNDSAIHL*VKSCWRILENNVYSSLYIIQTDTLW*FGLQIVDG
TTVCNSV*VVSSWGHFFGLEVWCS*F*WCI*L*KTKNDQPLYLSSITTWVETNTK***PT
QVLKCVISANDTVFFFPLPFIVAVRKSAEQS*QIEKLFGRALTNID**SSNTRRHCYFRS
KNIAEQVG*TECFSHSNANYTLTKLKILNVDF*KRQEDRS*CTTKTVAPLLRQNCICG*N
QTSSVALRTKGNHFSLTSYYFTYIFLSTSITQSLVLFIFFLRS*RTRIKMKIVYHYTYAI
TTKQKYKNE*I*KK*MLFFLTPEGNDPFPIRSVPQTFPIFFVFLLD*FFIKDLSMRI*VD
LVCPDEQFPILVPDLVADIKCNQDWHSQVVFEKGLCIQLTFTNGGDSDPKLGNKN*NHHN
ASVGRSPNTSLRFETQFSKRSPLDFHGSSKSKMG*TNGSPCEKLRQTRNGQ*PSENLFFL
GRCSTEGNNGKQCRNTHGNQWSTGSVDVGENLRSVTLLG*S*K*TSTGVEGGVSHGQHGK
*NNGVNEVWDDTDTVGCNSNDIWRGFSTTTGRTQ*LIGIVWHQETQ*NNGSQE*E*DSVD
HLFGRTWNGLSWIRLFCSGDGNKL*TTKGKSSSH*CCSNTFKSVNGMFTIESARIVPVFT
TNKTIITSATNIDDNTKNEEPSHHQNFATVEEELSFCITTSTENINSNHQNIENNDEHIR
VHRCRPIFDSHGCGHQFQRTHTQPLQTINPSDCKPKTIIHKETGVCIVATSQVTIH*RHF
TTCLNNTVQDRTHNSVTNK*SSWTRMNQRGTVTDQ*PSTDTRTQRNHQNMSRLNGFLQRV
RLMTCISAYVVRTFIFF*FLSLSRRR*DSRRKIVHLCCFYFILWTLIRSFKGVEKPTHGR
SVMLFVT*MRL*GWTVIGACFEIFNFIILPRGMYFCGAIFQVFQFV*RLRRRHCAKLSLS
ILACFFYKDYIINLFYIVVGRPSKTKHLYMYVKQMSITRKITKRN*SRRI*VLLADEGKI
AQDTRIADLSYAS*PSYQD*FAVQ*KR*PLPSWKKWLEGTKKRASQRNLRTVDY*GAAIR
WTWGS*KLAGYCNLLIYDSMRPLFSAMVPLGVPSTAKLQLFAADQCRLDGTLKRH*RTAR
FFFSSIMPVKEKKKPKKNAVGGTDARFLQSPFLAAEEMRK*GVSRRVKPPRYKRENAHLR
KKILFERVLGKVIKRLIDIIIALQNGKQMTLKMGENKNYIGNVEFLIFFLFLSLPQLFSW
NIGL*DNFFMFSVMFAMVG*GKGALSAMTIYANMFSLKGKHLVLFFACCARKRVTQS**K
GSLENYMKTKKEDVNLDTTA*NSIIECAINVYRLDNSADVNYQNYCSMTVANTETHSAAK
PSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYN
IEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCF
RQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYA
APEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTE
ISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADS
NNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDSVRGSNK
KNRNKIKKTKKNKRSSTLSSSSSLLLNNRSIQSTPRRRTSKRHSREFSSSRKRSSFLLSS
NPTDSSPIPLRSSKRITHINVASANTQATPSGVPNPHKRNSKKRSSKRLSYMPNTKRSSL
TSKSLSNFTNLIDDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELAKREKAELQRKVQE
AKRQSVNAQKINEDEFGSEVSDGMKELKKINDKVSSPLINYEFSQQELLQDIDTLLTNRY
QLSSYTRPISRLDPGLTPVTETLPNNLKEKTALLQDTEKKIIETIRRSKFLGSLLNVRGG
LSPGKSELAPIEESPIVSTTPLIYNDRMEPRRISDVEVPHFTRKSKHFTTANNRRSVLSL
YAKDSIKDLNEFLIKEDPDLPPQGSTDNESRSEDPEIAESITDSRNIQYDEDDSKDGDNV
NNDNILSDFPQGVGISQEYDMKDKNPNQSPISKSAEPTLVVKLPSLSSFQGKNASGLGLY
QREPSKVTLPSLTSNNSSVGENIEDGAEKGTESEKIAASLSDDDLKEDNDKKDNDTVNAP
TTVKKPPNSVLLKKFSKGKILELEIHAKIPEKRLYEGLHKLLEGWKQYGLKNLVFNITNM
IITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKFNKKTGSTKTLTKLATEIQIILQKEG
VLDK*KKGRDNRSPNGQYDVTPLYN**MYICNYFLKKIKW*FIKYLDRSTISDIVEKIFN
CNSRKKKLRYGESNPGLHGESVM**PLHYIG*QIIKII**KDELMVYKNIIKTQLNCSNK
ICNLN*LF*KNT*IVGMEP*NISSLVLLE*KSTIIY*LVFTLLVYYHIRC*KMTQMMRNS
HLN*WKLKRKD**CNRINEYKHIKRNEE*S*Y*YVEI*IPF*GFLYPRGELLVYSVYLIL
*PLSTMESQQLSQHSPISQVLFMLLEKWVNFEIVVGIPLLIKANNIRYTEYARGSPRAYR
NPQNGISIST**PQFPFVDSHILDRNS*HSADNTHIALPFIKLEFTPRNFLASLFPTEMK
RNSLAAIVLALTFWTL*KNAKNA*RFPSMLENHKNPMWYSIMRLTANI*LVKVIRDFLES
LRSEMERI*GHKYLSSTQKNSKIKQGT*N*YF*MVLTDAEELRSPVITSDMSFFDLESNH
SSDSVHLLCEKYTHKLPIESESQTTFRLAPTKQRLYRQSTLYVPLSLKQRVFLFTERVKS
IWAGLPRCKPNKYFKVAFALAVLTPLAIWIFYIDFRVH*SHRLFYWQMNHGH*LFFRLLL
YIIVGIKINYHLLTSIYVTSILSYTVLEDDANDEK*SSKLVEAETQGLIM**DQ*ILTYK
MMIIIFIELCRIADSLLWCWNKNQLSSTN*YLRY*YIIIYGVRR*RK**EIVI*ISGS*N
ARIDNVIGSMNINI*NDDNNIYRIV*NCRFPFMDS*ILEENF*YIYIPNIIAL*KMESQQ
LHQNPRSFHMDS*ILEENL*YSLYT*YYSF*RQWNSNNYQIVRQFLKKIHV*SSLLQPS*
PLIMNVLK*ICWNKNQLSSTN*YLRY*YIIIYGVRR*RK**EIVI*ISGS*NARIDNVIG
SMNINI*NDDNNIYRIV*NCRFPFMDS*ILEENF*YIYIPNIIAL*KMESQQLHQNPRSL
HGSAYASVTSKEVPSNQDPLAVSASNLPEFDRDSTKVNSQQETTPGTSAVPENHHHVSPQ
PASVPPPQNGQYQQHGMMTPNKAMASNWAHYQQPSMMTCSHYQTSPAYYQPDPHYPLPQY
IPPLSTSSPDPIDSQNQHSEVPQAETKVRNNVLPPHTLTSEENFSTWVKFYIRFLKNSNL
GDIIPNDQGEIKRQMTYEEHAYIYNTFQAFAPFHLLPTWVKQILEINYADILTVLCKSVS
KMQTNNQELKDWIALANLEYDGSTSADTFEITVSTIIQRLKENNINVSDRLACQLILKGL
SGDFKYLRNQYRTKTNMKLSQLFAEIQLIYDENKIMNLNKPSQYKQHSEYKNVSRTSPNT
TNTKVTTRNYQRTNSSKPRAAKAHNIATSSKFSRVNNDHINESTVSSQYLSDDNELSLRP
ATERI*ANTHNRLE*RTT*SPSY*FRSFANACQISPLFTPCNTQF*NKHSRCSKTRHSYK
CHW*SSLQLSERHQNINKSTTHTKHSL*SIKFE*AG*SKYYCLLYQKHFRKIGWYSPSSH
SQTWRLLLVI*KIPNSFAHFKANNKQRQQKQKRK*ISISVNTSNAWTC*LPKYSEVS*EE
CSYIFEGIGY*MV*R*HISMS*LSNRQKHET*TCQRITTKVPRII*AFSVLAYRYIWSCT
SLTEKCTFLLYIVYR*ENQIPMGVPITRPS*RIYPQCFYIDISIY*EPIQCSRSSYPDGS
WLRVH*QNSS*VLYEQRYYCMLYNHGRF*STRCR*TIKSYFIKRLSHTASLQWSTKSSMV
LSSRIFYYNQKFISLTKKR*IRKTTCRFSWTGHYYYTTFRSTGYS*QP*SRLENTSSWHS
RLRLTSVTKLLWLYYLSSIIKKDSRYYQLRYITRQAIQIGPIQL*YTHL***SQSFNSP*
PIFY*TK*NGAVI*SKYRI*S*LSIGD*NKL*SSSERLLVPINKPFTIRQGTSPKSTCTK
RS*CRHI*IQYSSISCTISYTPYH**REYRNGWYR*IRYYFT*TLVYLHCTKPKATW*SQ
*YD*FDLTG*S*LWT*KHQNYTFGWYGGTIYSTK**YKYQIQDYK*YALNR*PFVQQ*IH
YSHHLHRNKGCM**YTLH*YGSARISIF*PCDS*YNA*QILKKCYG*FYS*RPPTS*LNP
SISYGHF*CFKRYSTHTLSSD*FQFGWYG*F*CSDYYQK*EKIIRR**N*N*GIPRHME*
*EYEKSGTTKIEETHKFNCSNKRSEIDQTSSNDLKI**SNYL**RQQRKRQIC*SLS*RN
*PTIENEHLGYKQIL**K*HRS*KSNKLNVYI*QET*WYTQS*ICCKRRHSTPRYI*F*Y
AIQYRTSLCTDDVTVNRIRQRLLYHTAGHILCLLIC*YQRRIIHKTSTTFRFE**ITTFE
KITLWFETKWCKLV*NH*IIFNKLLRHARSSRMVMRI*E*SSNNLLIR**YDIIQQRLKC
K*ENHNNTQETIRYKDNKSG*K**RNSVRHTWIRDQISKKQVHEIRYGKILDRKITQTKR
TFEPKRKET*SSRSTRSLYRPG*TRNR*R*IQREST*NAKVDWSSFICWI*I*I*LTILH
QHTCSTYTIPL*ASFRHDI*VNTIHVGH*R*TINMAQKQTYQAR**TSRNKRCFIW*PTI
LQVTNW*HFPTQRKSDWRKVDKGFVNMHFNYRSRNTRSQ*SYSAIE*PQSPCART*QETN
Y*RLTY***INDQYN*VYK*REI*KQIFWHKGNET*R*SIR**FIRILHRDQEEHC*CDD
KTSSDKNI*TIN*QMDSLDLLHYGWYVGIKINYHLLTSIYVTSILSYTVLEDDANDEK*S
SKLVEAETQGLIM**DQ*ILTYKMMIIIFIELCRIADSLLWIPKSSRRTSSISTYLILLP
Y*KWNPNNYIKIHILFKINCPVLPCSCVFKNVIFIG*LYSISQQVIGCLAERSKAPDSRN
ILTAVNCGNTQVS*DARVRIS*QPLFFSST*REHTGALSHRIKFDDWKFFVNFRGRLTHI
PFSTEKLGEKGKVRAPEPAFHIE*RSVHD*MLASQYLKLTILFKDLLFFPIGG*QSSYFL
TFLTFYISAIYIYIFQGYTILMSAPKKIVVLPGDHVGQEITAEAIKVLKAISDVRSNVKF
DFENHLIGGAAIDATGVPLPDEALEASKKADAVLLGAVGGPKWGTGSVRPEQGLLKIRKE
LQLYANLRPCNFASDSLLDLSPIKPQFAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDS
EQYTVPEVQRITRMAAFMALQHEPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKV
QHQLIDSAAMILVKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNT
AFGLYEPCHGSAPDLPKNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAGIRT
GDLGGSNSTTEVGDAVAEEVKKILA*KDSLFL*YLYINFINEIHNRNDTKLQNGICS*GR
RNYIRNLHTFIKKEKKEDVKEYR*AN*Y*WLNVIRKKNCTLTLILTRRRAPHKKLGVTEN
HETMIPNLYIGGFSLKKKKYNK*KTLNDLTI*WSLSQYLLEPFPIMVKVPSRILLCQKRP
*RRSRPPLQY*IYQYQI*WKNGLMHHPYPAHVKHKKVLGKQMYRLNPRIMRYPLVPSIKI
LLPRRRKKR*HTLDNDDLEIRSTWYVQRIIDL*LIYRIVF*CELGRCQILSSSISQLHQI
PLPMGGPKYQISILSLGHHRIVKVLI*LLVSFLHRWHLFPLDRKSCEKKLIVNQCSFH*H
QCESYHRLVRRQYESRSYSFYKLHQFL**VE*HRFHY*QPSQRRDRYLV*WHLPIPSNR*
DLDRPHLGK*LQIPPSSWPVRLPRHTCVPF*W**CVS*SSYKILGHP*EPYY*IRSLPK*
ILFPWGRH*SSLLREL*HFPQQYLFPNRKSECWNEDYHKVPYKTSTSYPKP*GLLV*WLA
CQDIWDEYQNLCFLDKHGSLQCYQKLLQHLGWYRMHSHGH*PVPLQQPEYRYAFPERSCR
LTSRLLQEGNRISCLPNKPYMWPLERCKLEIILLSIL*QLISTSSSCSSSFVYAIYFNEN
DVSEIENITH**TLSVFTLSELLR*SSYIPGRWPYYLSATVSKIGRSLSTIAGNRVHNSI
VIYINI*SYYDRYLLLFTSSTITLVVPLYIRIAHRRQFCVLPARDHGLFAQSFTAGILHD
ETVYFHTS*I*FFN*RLDILQVPL*L*PKQDFKPFFGVHW*CAFRYILDSLIGRLEMIAS
QHVNVNVTWEERWEKGLPLDEELINWHAYSRNIFP*RLNPVPLSYKRYSQAPRIVFSLLL
LNSKFIQHCFNDFSCVWIELVLNVLPHSVMCILNIQML*IE*FCHCAHQ*YMQCFEKEVL
*KNTQHTVFHRSTNLMPF*YTF*RRTW*VLK*FFQGPDNLCR*PLHDFVGEIQFSVVYWY
*IQVQFAMCLSGLKF*FSLGESHDVHVRLGQSKQERFVESNRLFRNKFSH**NCV*MFAL
LQHPSLVVRTQYNFRLVFVQ*LKP*LVILNRILYYIQ*LWCQLDQLIRWIILGCGM*VDG
HGTGLLVSKSLVDFYRSSHSAFLVYFSLFSGYTIRCLLKQ*ARNTTV*RDKDNKPPTTK*
YRCGMLLLEISITIVVLFVIRIELTKKNPKL*IRSC*AIASCQDLGFCSNNSKKVNKNNG
KQRL*SSMRKISLTADSKNNTSLSVLAFYCCYLLLITCSGCYLVAKRVYLHLTNGERPVV
SLL*KERQRER*NLI*HQTIQICCRDHTAKWSFIV****ITFRLDG*CVHSISILSRVR*
LDMGEVLCLRVQVPQQQ*VERYNIRQIRNIMLRIRRYIFQLAILSGH*EFESK*SGKQC*
EMHCCHSVTALSITFTIRLITNIVQ*IGKLRL*PPLCWRFG**LPVDNSSSSRRSGEALL
YIRTSAK*ICQLYPVRCYL*KQ*IHHRTK**VGIPSG*TT*TTF*PSHRILTGTDRIWL*
GARGRITHRIG**SCQGHLQRVITTTNKFYFQFGRIFAKIPDRLESQSTQ*RN*WVIHNQ
IKSTLPTYNR*SHKNQLYFSRLAKDSNPLRFPRSTEGMQHYYSLFLQSIYKTRGGHKELQ
QRY*IVY*AFQQCNSRKRGLHGNENREYN*GTSGKTTEAKVNYREIVEVEKMETEKSRNG
KKMLQQYH*CH*FVWKIRFPTSFL*YQSIYSIGKNPYRISQMLARRTAIQMAEEKGSRCV
*CSGFE**K*EKFISHIQ*LCGFHQYTGGRKLLHFRWIKQALNLRYFNELIDQRSSVALQ
DP*VESGASLLYR*GSSFYIRQKHSTF*SIEGKRFFLNGM*IILCIYLFFVSC*LDYEG*
NFGKRHCISFI*S**KPFYIIFYCSRALRL*FRKNKIKICLIPEHTTIQGDIGGQQPSFG
FFCKILQ*RW*R*HRNLRRLNQT*R*TYRSYIR*HCFHHN*SIGH*NTDMLFFLKLIDGQ
RFTLCK*EFDKKLRTSIGRGQAPFNRRT*GC**QTFRCIRFRCYSREEKIIRYHNNI*KL
YKRLEGQSIRR***CHQGN*GNFTSETYEKVFKKTKRNSKEDQDKRL*SRAHRKEEA*QR
QRVFWRVKKCFWK*KQEQAFTSSKSA*KNIAEAS*VSSEEANDLRKEILP*KGSRFISQN
*KEKYFFFHKRITNC*IFSSSS*IQI**LDRKTT*CWKWRTSSRKYQNIFSSKGYKICLL
QSLSACDRKYQ*RKKCRTKSGSIHKAG*HFQFCRCRGICVFLS*KT*CRNR*SNNWEGDE
FVISSWK*RAARPC*GDYSK*GFYNIGWGPTY*YPKRIFTCS*C*KLK**R*TQTE*K*S
F*R*PLW*FYS*ALP**TGEH*QLE*FVSRGKGAPRKGRIK*KH*HISQN**RCIYIDAE
TLSTSE*SADRKF**IKRYQQ*REGRKGHKIRR*LQ**RNSERNN*TKKFC*RNN*TERN
IPHYS*VSAASFKN*LSKVTILY*ALSRNEGGFR*A*CPL*LETLG*SSLLK*GTKSQY*
GRCGNYK*KSG*CQGGKNDSNF*SD*V*NAATYPNLFA*GASR*LGY*KK**QILRN*RR
T*GRIEGQQNR**RCR***SIQFYSKNREAPSIQSY*NIACENYRKDF*RH*KI*KWLSI
*YFVHL*YSQQ**T*QKADGIKISIPR*NSG*QILYSSRGTHC*ISGGRTSKYSAKY*RY
NFK*QEHRR*VE*R*Y*SKTYRTVR*FRIQFI*YSIWKYLHEY*QYENIIRLKFE*NRVR
KCSESSRVS*WTINLCFASE*HKA*ERGVPSKETKRRAHLGFP*QN*LC*SK*EN*SIDA
RA*YCSFEKQRQ*KIQIYWRGIYR*YDKYAVN*RCFVRVLKRFCCVE*R*R*RWETELRC
WWPRETEILLSVLLIFFFFLI*CNVYIYIKYGQIRKRGKNLPLK*N*IY*IPLPTIKGEC
FWINRGSIGGNTILAELSFHI**SSLIEIYIIVFHNLFNLILGDIIQTTSYVVAILRDNI
EIPGMETVF*VISKGII*TYMSIKT*LYS*TQCTKFVGYYSC*YLDTVCTLHFQMLKYTY
QLWFSGVP*EGIKTIAQPRGAI*DRTNSSYSYLQFLEINCVAFLLLIGGSFYIFSLEYPF
FFFFFLRFSHLIAGSGALLQGLNKVILFGQNDKYNY*SYL*PARFLIIYTLS*STQVMVR
LVLRN*SRLA*EICKLQPP*L*LFNF*IQKSASTKFSYSTTATPVG*PFSCGFNSALLIL
PIGPNKSNKSLLAVENGKLLQ*MKQFLSPPGLTPSVNFAAVSSMWTAASCARPGSVPLVS
SRSSRL*L*RSLFFLLLKRPSLTSKTLPSTSMPLNVSIALIISSSVG*MTEPNPLENPLK
SNSTSARKT*PHSLNISFKDCQFIEYGKLMMNTSNPLSISSLVAFLENSLAASGGGLSCL
TISFRSIKRAPSNFDMASWTDSFLVNSTVPIPR*WPFDVIMSASTTSPTVPNNSLRSSGV
QSKVKFLTKILFSKFLLVASNCLSKSLSTIGPKVRPLPPPRPPLNDLLPPLPRPPRRGGQ
FLSSW*RLPP*L*SYRSLKREPRSRL*RRLPLPLLLLLSL*SSYLSLSSLKRRRTGDLDL
LLSFPYIPSSLSILAKKSS*CLFPFRP*LISNGKSSI*LISSKLSFFFNFFHLQVNTSLP
TIPK**QNAMRRSYDM**MLTTIAISLLGLPKPLAKAALDGESLPSLCPLPLHHQIEACK
CRPSWFR*QLQDKKWSFQDILPEP*YLAGSS*WESLAGSTVVLSDYIYTPCLSCPIHQVQ
DLSLQIVYHLLRL*VLHTVSIRRRHCPFWAYRQPLSPPK*VHLGCIRWSSTICQLSPQLS
CPATMPCVSLLLLLHLQYFPHSFPLVTDSTSTTNWNVHCQGFGALC*RFPCVLGKC*DAI
AADPLTY*GNLVFLFAAHHQRE*PRWHCICLARTTLQHPNIRP**ER*PCVLL*KTPPT*
RSHQGIVSLTFFVSGKIEEESRKPKEKNSLVTRHLVQTYNHSNL*VNRLMVIDTLYRCIE
ESPEGDRKAERLT*PGGSWEMSTISLIFSSSSAASSVLVFKGVLGNAIIPLLAHSRTPNG
STNFKKAEIRVGFADNSTIQLVSLMSTTRPPKLLVKLVISFKCSCFNLNTSLAGKLAGWN
CFSLISATNSWESAAPALVEVWWCNSRSSKYSVPNREILAITSSLLMISELV*SRTA*TG
TKSSICLRACSTTPSCPCKTMVILLRSLTSVLHTTNESMLKPLAANVPETLDKTPGSFCT
KQFKTCCFLG*REGAGVS*MMDETALLAFQEGVSSVGKGGLVACLCICLYANAEVDEELQ
RTMVAHEEATTLRWPLCNNDLSIRKTGLVSSDVLKILYIRTMYFHIYHSPFLLGKG*KNI
FYGTSAMRKKVSHDNGEVIRWMCHRTRNCWRANSRPCLTKVSRGMVPRCSILDKHSMVSV
RA*SWATRLYS*LSPSVLATAMEFTSSSSTCEVELNCWTLALFAVRTSICAFSECMVCSI
ACSTARKWFLSMAIISWNLAIDSCMTVCLVSILSAT*STSSLYNSLTTVCRFCSIS*WLV
GEISVLSMSIRSSALDAG*GGGGGGNGGFRCGDLGFGGSGGVFCSCWSCVLGLGGRLGA*
SCGGSCKRLINSCTTIIRFIAAGSQQWSMGSAIHPLESMYS*MGKELLMVFMSKFSKFIL
IKGGFTGYILGTHMITGIL*GDEPSSPVLMVPYMDNSSCGVPSECVNTLVLGLKL*KLSS
SAKESWKVVLPSL*MG*MTLNSQLTTASGTEILPFADIVALHSLSFLGR*DTNCPQNFAV
TFYSRSVKKDYYIF*PFIYTLRNKGPTNNKEQRVMSSLYVS*SLLSASLFFLLLLLTLCA
SNLAILLLVYS*WLVPCPCCSG*WLQRTTKRMCNIFFTMCLHITSFPFFFTNKSLFVLFC
RTVFGEVQ*F*HWP*CF*CGPLRSFASSIPWWLHAVQI*DLNLQNKASSISSQVTFPEYK
KNKQNKYT*K*IRIEI*WHLNNPEIF*KTQ*VYTDRQPHGL*NETPSTVVSKCVNGPFQS
LIFSIIRTHVPWKRFKRHEAETGV*YPCMRKLVIHCTKHACAHTLMWFTVPLLCLSVARH
VLLMIMLE*TNNLK*FLLFL**EISKEKKKNKKN*RAAG*ATTKRRNHLGLHQQL*EEKA
GI*LAAICLWWIGACSYAWE*FHLSSVPSCNCLYQFSYGMGFSLWHCLSTSH*GCSWGRR
*AV*LHKQAH*TSMWF*RCFNILLCFVLLAAS*DSSLDLYWVCSTQSAGYPVYT*V*NGN
GGLLRYVRSLNVLPLVLSTLCEDKLLRQYPCLSPIPRIYQSLT*KNSMMSLELMI*L*RM
M*TATSPLAKRLLTKKFSIIIMIHSTRPPQTMNPLIFGIGLTLTKTHSSPMKL*CLFLIE
LSFEEMPVMRTSLI*RFYEGILGDIAITSSHALTSE**KYVEFLTA*F*ISFIL*SFSIY
IYILILSLLYFLPVTHV*RRKHK*KSSSTWTHSRPNTPKKQPTQESRYNVGHPACP*LLI
AYSG*HILMTTRLLQLTRPHYRLLSLPLQKPFNIKRQMSAANPSPFGNYLNTITKSLQQN
LQTCFHFQAKEIDIIESPSQFYDLLKTKILNSQNRIFIASLYLGKSETELVDCISQALTK
NPKLKVSFLLDGLRGTRELPSACSATLLSSLVAKYGSERVDCRLYKTPAYHGWKKVLVPK
RFNEGLGLQHMKIYGFDNEVILSGANLSNDYFTNRQDRYYLFKSRNFSNYYFKLHQLISS
FSYQIIKPMVDGSINIIWPDSNPTVEPTKNKRLFLREASQLLDGFLKSSKQSLPITAVGQ
FSTLVYPISQFTPLFPKYNDKSTEKRTILSLLSTITSNAISWTFTAGYFNILPDIKAKLL
ATPVAEANVITASPFANGFYQSKGVSSNLPGAYLYLSKKFLQDVCRYRQDHAITLREWQR
GVVNKPNGWSYHAKGIWLSARDKNDANNWKPFITVIGSSNYTRRAYSLDLESNALIITRD
EELRKKMKAELDNLLQYTKPVTLEDFQSDPERHVGTGVKIATSILGKKL*ILFYHSMSPV
NMEK*KKK****MHYLKLLKFANIAKPLR*RMS*PCYSFPFGNRGFRPT*TY*T*QSMTN
KVTNCINFTQKGVELNGIS*NNALVGITSLPNKSIDSAKNDINANFDDKPTVEHPIQFIL
I*GTYLKHLSRFAITHK*FMCSK*KTPNLPEFFNGKLEMEQPYVNMPNTRNTLIIIMEVM
EMP**ICLVDL**YNCLKTIMQQQETQKSFRMRKLDIGILRASFNG*KSGNL*DSCSLTR
DE*Q*CNAQYKYRPLPTKSSRNKSYESP*IDR*SLL*RF*HRMAMIYVRNGSFLP*LVKP
FMYTFSFNYAY**KTCQALQNNNKHVNDSI*LLRRAPQPLLWKTLPQ*G*KLWVFRSQRK
KKLVKTRLCSRTRIIHKKNNDTRKAISIWD*VLHERHRVSKKGSKMDYDSSDTMNGGSSN
PLITKMNTMKLLYQHYLDKVTPHAKERWAVLGGLLCLFMVRITMAEGWYVICYGLGLFLL
NQFLAFLTPKFDMSLQQDEENNELEAGEKSEEFRPFIRRLPEFKFWYNSIRATVISLLLS
LFSIFDIPVFWPILLMYFILLFFLTMRRQIQHMIKYRYIPLDIGKKKYSHSSN*YTLTPH
TYSTNTFVS*LYVNKII**LQNNCDYFLLLLIFSYIGRIHEVID*AKLKGRGSFSSIYKW
RA*DASN**IFVKTFKKHV*KELTASNLSA*LLIPN**EMGYVEE*RMQKRE*CHASCEF
EMFTRL*CPYSVACMCFSVLVFQVIKELSKFIIERILIKWHNRLQWKMKIISVAKTTAKI
TVTQLSR*FVNLKMTFLQFINNNRQEGQGYISEKLFKTKKNEMIRKTVTNLVAVRLKNLS
HEFDVIENYLRYIASTSEHLFTAIKRHFNKCARKLLKEAIDSKSNSETATVVLQEGFSGI
CLLKASSIILKLKLKFPKKKDRTDISKLCDKKERMTQWLEISILMN*E**YYAPLDFMRR
HC*KNF*YMQRRSK*ASFKEPR*AVFAHCSSSTKYLQGIDEVVRNPEYSMIVHNTKKLKE
SRIMDDFLEHLSKDDNKAWYGAEETERAAKLDAIETLLITDSVLKRNDVKKREKYLDLIE
NSGNNNGKIFVLSTSKITVSNLTNQQI*AVS*NIPSNTLMNFSKMTKISEISTLTSNFFL
FI*HLSNRI*GLLVFFATYCYHFYYTIVSIACSVAKL*NLSKSLI*TEPFPFRL*YSTYT
FHKHGMAISAKQYGKSTESYSLKK*YK*VT**YLILLYF*KK*KIKSSLFLKNKI*NISV
FDFRKLKKK**EIYISLNGYMKRLLVEVLLIYYYSIEVIKKKLVKQLNSKKVMIEKVFEH
LSYMLMGLQFYH*YSCLYFSVRP*CPRFRAIIESTRYILAREDSLT*N*NSNEFPPHSYT
PNNKHIKTS*LFKMWSSIEEQYLQN*FLQFPTRDPLVMR*ESYIAYNPCFITHIIVQTYW
CNHYHIHDL*LKIFHDKLRKKSR*IVSYHSLVKVCA*KEDRVLYSFYQNIVIVALSHELQ
SIFLSTGQST*NNGIRFKKDSLIGLYTNYFTPRTKHNVH*ISLSQHCI*W*HRTNYWHSF
NIIQLSY*YFLK*S*RPACRKVMICSVNNWKY*DIITMTILTKVIGELRQLIVLF*IYID
A*QFSRQIAPAKPTSYRLFFNLLPMWEFYVNHLECSFSSK*HVISSEEIETY*FLW*EQF
INVLS*VLLPLEIMSFASHFIWKKQISTKCLVMS*ASSIY*LPNSFG*YEFFFLYKSLLW
NCLAVYFNVSKENILFYLCELHCILLVPFGGFLLFYSITFLDCALSVQSLLY*LAKNI*S
FSRVLLEEMLA*HECDLF*N*LFCLSM*SVTNT*NALIDQISKACRHLLSNSKQNFACAL
LQFSILFLSLRQCIFFY*QHH*SISSPAHFQ*SCS*RS*RNVQT*KCSFRISKSKRYMYP
SLICPKMSIA*FSLYIFS*YSEEERGCDLSISALSNELCPLLRIFPLENYKKWEKVNRCS
GFNIVVDNV**EGQSSPPKLG*GR*GKTEV***SRMKVCGQKNLFFLY*SVINTRPIY*S
KTTLNQIAYWCRREVDI**SSRVLNLVWDTFGKVKRRGISGLHLFLAYFNNLLKARIASH
*QRSGTLSNVYSNTLIR*VPIASL*GTIPNQTFI*NYR*TPFSS*IKYLAKTTKCSFILP
NEKVIAVRQKRR*KLSPIQQYLYL*FSIALCHYVKPRREASYGVFI*NNLRILNNIRYII
TTILMRFNVEWRC*TYELRNDYSHFLSRQLIVLL*TLHNECRKLFRLSLGDEFESKIPLN
IQNHTG*YPQH**RSNEFFFP*RFHRLFQSHSQNQPLQTE**I*HFCLVLIPRQLVLPNH
KDKS*NCIFRIHFE*AP*TPFFHLKSMYPTCQ*LV*HLLFLSIFSRLQRQGGSTPFHLVA
GNKELHELLYQ**TFHVGLSILYVSIENVVP*CTSQ*APKL*NCQ*SHQIQVYL*H*YSS
ERGPPQEYE*KFSFQLFL*QAGQKYHHQ*QNQSNVRQITYLLEYFYPIRIGQQPLY*IEN
LSSTDDVRSDS*WYQNQHKKQAVLS*EDPLIYL*SACSNRGAWPCIFLSLPEKS*VLLIH
VYIYSIQRF*SICGLSRKSHRIIRLFPQAFRKQILI*GTMFPNNTLTWRQKHQGISANKL
*IL*FLVNN*HFTKLCLPLQLGGWYR*EILHCRFQAKNNWDLSTVG*EKSYNKIIRTLKI
KIFSLIMVFY*QFLKKKYHTKKKGKNFTVQVRSN*R*FTI*ISAHHAAIIREPIHCVCIV
LDK*VIYGKRIPLKKKLSRDKRRNFPN*TKESYILVEEIPNIPRI*KIKITIWNVAFGL*
KRTRLIFHLVVSFLNKLKPVYRNLISNCIFIV*DSINGRIQGAETERKVEIEFFAFGLTK
*GL*NQEFCLTKNNYISKY*EMILLVQGLTEIYF*YKKEKIK*KELILY*FSNVLH*YIC
*DRINVSKN*ILDANCCFLHDSTAG**SFVLLLFCSCSCCRFSLSLSRIRSSGLLFSGGL
GFFCREKFFGGFVECFTLNFSNSQFKWRRSS*AVRSCKGTSTPWRATVYLFYTG*LSK*I
LITQW*KDNSVMS*IRQTGFNGTFLTTSVTGSTNEYPRSFAVQRALGP*STGFIPKGGPL
SRQITKPSWNTEQKGVIFEQRFLSGNRNIFRFLRSVHLGEDFIR*SFLDPVYISFTTSCL
HTFLNSLG*NVYVPVGRVSNYRNLYHSYSASIESVLFCLLSFFLLILT*PLFSFFLFLFS
F**SLQTSNKNERKTSKNVGCYSIN*LPE*CKLYESK*VR*PRQ*GLMPLGKFIIYIKFQ
EGEAPSFPAVQYFTRRFLISYY*KGHNGFINNGIIKIMRVYLVIA**LPQFSNH**ILCN
*NEEGNSNVHFLNYKYHYHSVWLKEYIIVLNKC*ILNGHEERKICRGV*K*DVIQL*FAF
NVFDQFLVFLSRIGLWPFNGSTDGPISDQLSKNTKCP*NAK*NGIERRFF*SIIL**DTR
VSIYIWPWIFGFTMFSQYARCYLVY**N*LE*FIIWKMVHGKLTLSHITRISFP*HSMTI
TGNDSS*V*SIP*IFFDRIFRVVIIYLFFKCK*PF*YFLISTPMKWASQPVQT*CKGQIR
***C*AHKMGCMCRYITTFVIRMNG*IKSHQVHEIFILRTNQVDQIFSIIGIWVHFTHFA
IFEYITINFSCNNWQFTQQV**IFKSITPIILLGNSLSISLSKL*LAFQGSYSNRELSHW
V*VLW*IIQKLNDMTR*FRS*H*IS**VFNLRLSWNLAS*Q*PKESFW*WL*ASFCLGQV
LLNVGDRTTSETNTVFWVQNGTFPYAPWNTSHTTIYLF**NIANFSFAMLFNELPYILSM
DGVDFAKSLF*SLFLA*I*L*I*CNISV*I*IRNCHFSCY*YY*NKKF*EPVMICVDIVP
*NLIMRNEHHI*RTKF**SYIRSTSRIMGPFESMTIFRLTSPISYECNAQKVIALTIVIV
FPLCLPLLTP**TSSYGKGHTFFLQEKIGRDLFAPSR*PPDKCVECARY*FALF*DTAKP
LIE*PKDGFVQHSKAAYVVATTLGKVSAMFSPKDSREPCVTKFRRYSISKPQKDAYTAVF
HSN*KDISRSVNKTVAYAYEHGPFILRKWQHIFLFLM*IVRSSFLVR*MYAVVWFLARRE
KRGHTCCWGS*FSAFALLSKRSIDPKRFLQYRSDKRSCKPTVFKL*MI*WIISYIEYHTS
AVQVFINIGLLQLTL*SPLQFSRNHNLYLHSAI*GTSEITSKCSNMPCALVYCTSFSILQ
KKTAPEYTCFTSER*MPYHFCQ*RHHTL*KQCGASRDSNPGPPAP*ARIIPLDHTPSFEK
SRQNSA*SLGYSPIFPAIVIDLFLNDQINSQLLKVCEREVKLQNGRFKSKVTLRHT*ETL
SLSCCYYFL*LTYCRIPNGLRNRHETITKVTTE*ILSLKRMMTSG*TVRISLDHSLNFIF
N*EA**KIINKLTQLS*PMLPRT*VISSTTFTQSISHSEKWVNVEIIVGIPLLIKAIILG
IQNILEVLLEGLGIPIMESIFLYTNITIIPHSVLYVSLSYYIINPYTSASSNFDDSFS*L
MSSS*HRI**YIDNITIS**TIVDFYSNTFELV*NCEELSGILFIRYANCNNCQVVLFS*
EVFRPHEMANISMDFINIIQSNYTHLFFAMSWV*EKMLHRP*ERLQECKDAASEVVPVMK
QKGHINMVQRFKFRHLFLFTICFKILIVQVFNYIL*VTEQSTHQDFCSFEVPQPTG*CYL
V*FIHGNYVKQ*C*HNGPLKA*ENFAGDKKWFLMVKK*FSFIIISL*NFSRSTLSFQKSN
KAEEVVLSYSMTNCKTRV*LMQFPRSKQTVSLNLW*HTMRMQVVMLLYLCVGLLK*LELS
RFVGIWP*ILNSNKNKA*KC*I**KLKTSNHVLQIFLSRIFSLIFVLCGNCSGNNRETFE
KETR*LQKYGKKGNKHSFFFSRKACLTIHEAL*HIDAALHCYIIYRKKCSQ*ETNLQKKK
LILSTSHSQQNFFFQLLHVNYGVLRVSN*PLELISFP*K**GMHDNTLMCTQLAPQHILS
FSLYNIISCEKAPSCGTNLLISVKILLLVYTV*TIKFHYEL*I*NRFGTSLSISAK*NYQ
DLYFMVYRRQDIAFSNIPVVLVSQLLLL*QSMLRILGQN*N*SILLPHLKPHLLVHLSAY
LWRPLPMNLHSHLGVFLSQEI*RICSIFHYYKSNSEYSINHYQVNIDSYCL*LLSILFPL
PLACG**LPAKA*F*NPHPRYTH*TEST*TKTK*K*RKLKNQKRHHKL*HYERSQLLKLK
LKVPRRKISSVCNEPSRTASRSYMI*RCLQVK*YFLRMITHFVPLMYPI*HRHYYCCCLN
EAACRYGVLFLVLIWYRQPTGVYKQNTDLHFQVRSFIEVHKLFLNYFVNLSYSSSILI*P
KHSPGYKAYNTQLT*NESHLLNTLEGHCLVERNIIN*ALEQGVT*MIMAFLLGAVGASTH
LILG*LPFYAYLNICNFRSVH*KRFDDLVVLLIVNSLCRQIISSLARLFVKSSVYTVGS*
SA**QRYCPLDLHKSRSKDKHCLFCFHRFC*KFCMHIQPIFNTWIISVQRLQ*TPQ*L*C
FFQSSPHK*IPLLLDAIFRCTSKLWLV*FLEPRGEECSILSKAMRKKNSCDISQLFCMVS
LTQL*NHTRRVVGKFSTYISNTFSVKVTQDKMTPWPSWLRRATVNRKIVSSTLTGVVNFS
FLFFFLSPTEKKFFLNPRHGEWKNHLARHFIKSTSASPC*YVNRPSSCHLTHFPLYK*YI
*YYSF*RGKRKRRRKYTTL*RYSAIFFSKSLLNPNIDLYLEFRF*EFFIIFFF*RFPVGF
VITCCVVVVVVIAGLLLFTLTLSNKIWTFKVLFNKLY*AFKRF*VTNKNWKA*GSFLILG
SQPFFTLHLPLDIN***VL*LLFPVIKKKVIRFYFISTLPLKYMTGMNDNNAAIPQQTPR
KHALSSKVMQLFRSGSRSSRQGKASSNIQPPSNINTNVPSASKSAKFGLHTPTTATPRVV
SNPSNTAGVSKPGMYMPEYYQSASPSHSSSSASLNNHIDINTSKSSSAASLTSSVSALSL
SPTSAINISSKSLSPKFSHHSNSNTAITPAPTPTASNINNVNKITNTSAPICGRFLVHKD
GTHEHHLKNAKRQEKLSTMIKNMVGASKLRGEAKSAVPDIIMDPKTTLKSNKNPPTLFAG
FMKQVVDMDDKYPEGAPTSGALNCPERDIYRSDQKDSKNNTHNITTTKKDRQCFAEKYGR
CQEVLGKGAFGVVRICQKKNVSSQDGNKSEKLYAVKEFKRRTSESAEKYSKRLTSEFCIS
SSLHHTNIVTTLDLFQDAKGEYCEVMEYCAGGDLFTLVVAAGKLEYMEADCFFKQLIRGV
VYMHEMGVCHRDLKPENLLLTHDGVLKITDFGNSECFKMAWEKNIHLSGGVCGSSPYIAP
EEYIKEEFDPRPVDIWACGVIYMAMRTGRQLWSSAEKDDPFYMNYLKGRKEKGGYEPIES
LKRARCRNVIYSMLDPVPYRRINGKQILNSEWGREIKCCHNGRALK*TSTSLSNITIFWN
NSVFFT*SSTLRNALLSGIRILFLASIVLLLYPVWLITDHVQIGKSH*LKKNCNLI*KKK
*YITIKKKKIIILNLLLDILTFIVFMLTKTHARGYYRFLIAFLKRVGWSDRADSKL*CYL
GLLI*MKET*MTVKN*RQKH*FILSRAHKYLGLSFVLIVLRF*CLITHWHSRLLIVGPNI
VESALNECNHQYRTLAES*LKLQNLGQSKVLLMKLTVVVQFSIGY*DFRKYL*LSSILFQ
PLAV*RHL*QVCPLIYELLPSQHRSLVSYGLSFLWPPQFL*NTSKTLLLDLVRFLLRARL
IA*QFRYQNLEHIANNSYQRCNHHQQHILNRHRG*R*PRQW*SVMLSQLSMSPRNLWLPF
VMPHLLFEELYNDVLPCHTLYQWSCRHS*LSHCDQLC**LS*NLPNSSCISFLLASYNRI
CIVFYITAFPFLLSRLPVIKFVFPFF*FGFS*LFKIRAFGSSSPCSAQFSQQKFIGT*RK
RFMSVTMKKTSRITL*MANDRPFVAFQLHDIRGNIFSANLKVLSETYILFFLK*NQSAGK
TSKGVSKKVK*TYMLTVYNRTLLTSSIFS*SFLYIVYILF*SFSFEKHLIAK*HNVINSV
RLKQPFYLNI*KYD*LVWLYKS*NNYHIKKLKNKKLLFFISIVLVISRSCS*KITLSVDG
NGNGRASTYEFCFVATPAYALYQAMKATTTPRTPPALVTPSLLAK*PIDNSRKVNASKKN
NKKNITVDFMVQTVKPNVKMAHPNK*NPKALFKSDSLSS*ASKIPNQGM*IAAKLNQNPP
*EHNAVPPKVFSKAISQIPAINCTKPP*NIAQPTTTLGTVIPCALALNMDSTNVVNAKAE
RPKGAGLANLCTGAGANPGFKVPPKAWYKSLFKNF*RPI*IYSLLSPPV*ILPNES*DGR
SSSATPLTSLSWEL*YPAGAFSKSVFPLVCSLSDILFVCI*VVLWLFSYICVSCRLFAFF
L*TDASSFCCIVIAIGRYIK*TYSKISGKYDPTKVLYIQLGVSDRLEYRGEGAIAAQPAI
TKKSCKKMQSSPTFVTPTIPK*PPNRKSGKKSFRISLQMTFQPAPFCSHAFKGPCLACSH
GATRKNRSLENHSAARLFHGAPDQRAVDPLENKESCGAKNYYFLCKRRDYIRRLSTFVPQ
LST*GLDTPLLKTPH*TEPGS*CQIQGFGQQIQMCSR**RLELQYLSRTFSLSASMF*PH
*SIKIRRRSKTQRSFSGT*RPRL*YS*Y**IVR*TVVSPKAPARLILWSYSSLQKLCRWL
GFPTISQG*TV*GFQYI*KKHCLSCLNQSLGKQSMTRV*VVQHVAGPLRSLSY*CSMQVA
SNSYWIFLL*K*SFPERTS*DL*M*QNRSTLV*RRTAPFCSENR*YHWRRCNIVFPRINS
IGSSVNNYPIIV*GFCTCF*NFLNSISITVAENQQIVDLWVNLHSKRYFPHHLRLKLPRS
PVKALHNRRYLYIYRVVVWYLSQSQ*HLAFHLFPLHLLHL*VKI*SHLYELQDEPTLSVL
YHHC**MLFGVSYYQYR*YPYQLLNRKCF*FFSFSPEDRLQK*YQSNNQQYYSCPDRYIP
HFSKILTLFWHFRNRPSHLYLTGPIYRINKIYLILADE*IAPMSCYSRWITLPNIQ*HYW
HY*HLNQM*VHPKIKPMEMSLIHMQWKLGVFHLH*YHDQIHYQ*YDL*YQ*FLVLPTPYK
LLPSWPRMTMLLAILTAHYLIRFQKQSKWAAKSHLDRRTRLFSRKIYGPY*YR*LLWNPK
RDLFSVSLLGYLIK*FYPHQIHP**LIFGRASRYHLFHSAQFLQHHLNLSRGHYK*YFQN
LMSPVCHLHFVRNYSPHLHLANEWETLRNPIHF*ITEI*KCKR*QM*KVPGPSQQSMPTP
ISLAMTLLDLLKEICNLESHYNEHIHRIHTSK*YKGHQTRSISNHS*KAH*IYIALFLNH
S*NLLALLLSLSGNPRYL*TP*HHTTQCRERICIERHYTYNGRYSVPSRIQRHNHLSHNR
SFLTDLSKTENYILD*VYHRQM*FVVFCRSKSVEFSHWSHYNLKILYLQSYHSYNMSP*Y
*DQA*THHRQNLLDKRHN*SLPIRYHNDRCHFVLLWDDPYYRFHPVIDRHRGAESNHHLQ
TLLYTHIYQCTNCIQKTVCIQK*VAYN*NMAGMYHCPYLVQLDANFSKKYLQRMGSYLVL
QVPLSRIIIEMIIYYSRDNVDDFPYCNCF*LCIFSVQVSVNRLIFFSFLFLLTLIFILDS
*LQLKTHRYYNICIIGICKNYS*VRKE*GTIAYLHLKMPIWARILYFGFTLILLSGPEKG
SVSLLLELMLPS*STWPLIEKEITVARDLFAKRTKLKKPRHARLPVFLLIAASNFVTQQG
PSDGSQVL*QAIEGSGMAGKGLVPHAMMPTVISRAKFVRSYCYSLSFKQNCPNRVTTTAC
SHTLFSSNQGGGLV**NLVKLTFTYI*TCINWSMQEIHIWSFLIRSFSSS*MLSFSLFYR
SSRK*LSTFYNKYKTMSLSSKLSVQDLDLKDKRVFIRVDFNVPLDGKKITSNQRIVAALP
TIKYVLEHHPRYVVLASHLGRPNGERNEKYSLAPVAKELQSLLGKDVTFLNDCVGPEVEA
AVKASAPGSVILLENLRYHIEEEGSRKVDGQKVKASKEDVQKFRHELSSLADVYINDAFG
TAHRAHSSMVGFDLPQRAAGFLLEKELKYFGKALENPTRPFLAILGGAKVADKIQLIDNL
LDKVDSIIIGGGMAFTFKKVLENTEIGDSIFDKAGAEIVPKLMEKAKAKGVEVVLPVDFI
IADAFSADANTKTVTDKEGIPAGWQGLDNGPESRKLFAATVAKAKTIVWNGPPGVFEFEK
FAAGTKALLDEVVKSSAAGNTVIIGGGDTATVAKKYGVTDKISHVSTGGGASLELLEGKE
LPGVAFLSEKK*IELN*NR*INFFLFSFPILYAKIIVYFIF*IFFIYIRIYRLLFIF**L
LRFLLKKNSLLF*CLYAVFFSHSIFLCSGSAYFKFNNSKILRSLKLSRRILFRNKPCCVS
LKPFCAANILIHLLYSLDPV*CILPAPSSSHLQQKKSNLLQ*FPSLAFRDIYWSIGFNFV
SSSSSSSINNVPSSFFISFSSSNSLGDNLTPMKNFLIISEEYHLFLSPYPTIFAVRNLST
ILFKNSFSKFGVSCKKQWI*PSLYNLIQSVSMIFANSVVSLQNGLKNKRSMSPHLE*PLL
*LPCNSTWHSGSMPRSAF*TFFKCVKHSFRDILHNQSS*YDQPNKIVQSDTNSSGSFLAA
TQKLSKFRRFQRLAISDPMP*QFLKYFNLSSNPTESFKPGKTPVSNITCIFLAILGPIFL
NLVCASSPERTLKSQFSIDCLASL*LLARNFSPSISYFFVNLFNAPIINSLFLYFVLSVT
REALPLSPCKSRLRGFEACIISLLLLSSFLSLSTSVEISLSLSVELCPSSALSDITIMDG
*NLIKSSF*NANLSFWTHFVMQLVFTH*MPDCSILPRNSSTSFKPASLWKISF*VKCISE
STKESSIKMTTSLRLD*RQF*ILDTIVAPFFSNILLKNLLEDVLGLGKKAKNLPFRDMCD
LSNRSHVYPLLIITVTYKFFASP*NY*PHVFEHLKVILDRDRLRR*KNSASEILFYLYLK
KKKQEEN*RYSIIISTATSWLYKFEYTGFHPFLHFCYLHDQIF*RVPGFHKVGTFTAFLF
TKL*PRWTIISFKTRDFILWDTNNLFGNFYEFGRIFLRVY*QYTISRWM*YGQQVSLTIP
YIPIAARISFFIAT*VDLI*YFTQYLDLIRACQ*PTIKFTIVALRTLVTNFF*IVTKNMT
IFKSSVTNDFMNKLF*PIYR*NVKITFKIFDN*RAKRFETIS**TIFVILISGERFHLIQ
RNRLKNLLFCNFIYTI*LNNPVMILIF*FVRKQLIEVRLRNYRRYA*R*QRQ*SRSIVFV
FMVSVHICLGKMTPLRFQPRVQ*IR*FSNGADCVNSCDCFIKI*NNNGFHILHCSLLVTA
IVKCIGSIVNIALCEERSLLKKTIRTNL*LHNNKKKVYR*TSSVVIHKIKSFANRLSTHF
YINSN*ENEGTDSNRCKS*AFNLCSSKQN*CLISHPIKLRK*F*SDTIVQRGH*AYFFNS
YEKKNVKESRKFS*RISSILMYRSAKFFMKKFGKKKKKKNSI*SKKDAQARNRTGGPTMA
TLDFTTKPLALVILIHDSRKATILCIRNILGVLFKDRGILKMESIFLHTNITIIPSSILY
VSLSYYIINPCTSASSNFDDSFS*LMSSS*HRI**YIDNITIS**TIVDFYSNKNILERS
TINIRIRESVWPMLLL*LGRSLTPRHYSALKQLNYKPAFLTTKSVSL**IYCTYFTVDST
FTIKICKRFCYWEQEYQPFSWKIAKCKRIYYHRVIKNIARSLRIYIAKNICRQ*KICLTL
PLQVVFYWHRLFTANY*KFSSEKKERKEMS*IQISKYCHKCFLYRQITSRRNIHFTIKCP
KITFLPGKELL*RDRL*AVVTKVKKKANPI**MMIH*ISLRIYPLVI*QRKRKKESLMVR
ANPLPKKGSVCRNQGRRRRKNCQRMKRIRKKIKFLKINYVT**NFSGQSLRASFPPES*N
WKV*KKITATP*SKTSHQSLVLLKFGNFPSKSKIGLLSIFSTWTKSPQYIMIFCFYISGT
YKVNQKKN*YQNAKEN*SNGTTMWKIKKQK*KR*LQRIRLANQLMVKKKKKVKKTVMPNK
GSKKRYKTSKRKYKCRIKSLFKEV*NY*KFGRMMTRSR*NLRISSLMFNIEFNNVVQL*Y
IFYCEIRSKSSGINRFRKYNFLQNYNKIV*VTYIKKSHKFLKFEVKKIRWIHNLP*VIKI
FSTHNVITLIYKTTLRPLISNNVAHQKHGRSDPSHLRLKTYLEISCPHIPVHSYDRIHT*
NPSALLTLAHSKLGTYQLVAPYRLSFLLQL*HILFFSSPYTRYTHTIYHRQKDQCRAFRM
FH*RTYCSCLHLDQQLSNLIK*LGESYCP*A*PCSYFAVFYPLHPLLVHYGIQRRQRECH
CTFEVWHEWLAQVPQLERAINDA*NLR*GI*KEEHSPRYVYLDLVRNLHTYSNHELVC*L
DPCSPW*FFVYLFLVDLPHLVPYL**G*SFCLQMPTYHYRDQSG*SKYQL*STENLDDKA
EEFL*V*YHTRT*LLVIAGPRQRRKHK*RIFCP*SPVEC*GFCMLKHQ***MWKKRQEPS
QSSPSVPSPLEQMRMQRPKHGQGQR*YKRRMIGHKPICFELGLMQKNTKELTKA*R*RTI
NHRKYI*AIV*CF*LKVQQWI*EATNMELMACP*TSQNSKKQIT*PYKLRRPKAMARDRV
IHCNLPMPNK***KNPSITDEFRITTSQNQQPKIICQSTKQILLEHSFSLRN*LN*HKAT
ACRIKQ*ARELSYYTHHYVHLK*PKLDCWYRTPFSRSQMQQDLTAKLEQKRN*SPHL*YI
LDFVQTLQR*WKFPQLQKSTLILASEQYRHQWQ*YLLKVHHIA*RLQKRTADIRKWVPNN
PILQLHNLRFPYTIAGNAKYYITGT*RSTRKENR*KYLLVSKKKSQT*NMNQLRF*QRVF
PFQPSFHHFSAILNFFLLHNLWD*SL*FGKNWYYRVSH*KREQYLSF*NQRKQMHQMQYL
KESETIRNKHI*NMPQLSVGRSAECTSKSSGTMFQKKL*QSTLCSSKLKD*NSG*SLYPM
VTLKQCM*S*IYHEYRGHLYL*CIPNHRKRLSGVHRQGSIP*IGSSSSDLVAVKILEKQL
ELLRFGK*NVPDSGPR*WLIH*ETTHLDTYNVHWLQFYENVMNNQ*PKLQRRRRMHK*YE
L*G*SSH**SA*LAVDTFCIPGYLFLEKSDIKRVQILWRNYKLPSQKANENLLLRFFWLL
LLTRTNFT**KSMKRIFRDSKIPNWHFCIYR*AYFDCKKQH*KELQT*TKNT*FQNREMR
YNL*KFT*TY*AYNLNKTNCKVCCYSHIVILAGSH*SKRNSI*NVINIMNNSTI*EQRRR
KYIITEVPILEKKKVEYPSGKISSMR*KN*IDTMDCFDLSFYLLLAFFFHSPSSVFFHRR
VHRDYKVPCFGRVHYAIELSKCLYI*SIPLSHHLGGLFVSFLF*DD**SFCCISS*YWQT
D*FLVHNYGSLQDCLLLG*SYVSRNCMH*LHDSLRV*FRSKSWFCS*QYFL*DLLVVRHS
QFFFQHQQPLFEKRILQ*MSNLHKLFRVPYMPSFYRLTSSHQFLYLIITFSPYLTF*LL*
LRRNFQSCHNYYIAY*Q**MSGYLPSNLLTKR*Q*NSNISLFN*QHH**KFEQASKSRRS
SFQSFVYRA**YLFRDPL*FTVIQLKNITKLSRLHSHISGVCLCHIRYFYIIQ*LNPYRW
HRNTAPRKQGLGETIEFLAMREGKALIKKNSAYPILLE*VAINIYMLIW**GYKCLY*IF
GISINYHLLKRTRTKKYEMSKATSLRSCWIEALKCHLLVVFVLLVYYHMRCKKMT*RLRN
SHQLLWKLKCKY**CNRIMKRIK*KRIIKYYYVEIPIPF*EFLYP*EELLVYSVYIILLP
LSTMECQKLSKYHPIFNFIVVKTSSPRYIS**DKIVE*NYSYIYVKASEIVMLSAVAQWK
RAGLITLMSSDRNRAALLNFLNCPLIIMELTSSITGSFFAHIFNHLLSI*VFVVH*SFTN
*GSEKIKICI*KSRFYTANFFITETFYTKRIHSYWKENQLSFCWVV*ILLVHYHIQYKKM
S*SCEIFIIFNKS*SAMIENVLG*LMIKYKMRRRNNNNIKWKYRLSFKDIITWRKTSWVL
CIFNTFPLSKIESQQYPHFRQYLHNDKVF*IPYNDNNQAHHLGGFFVWF*N*NIFRGKL*
SQNFTFPVTLIIFIVRDEEVLLI*RLSMNLLMLL*ARDIKHRQLFHLIYYQYYVCLELTI
QLM**LI*LLYNYHINVQLIDLKSVSLLPELHV*NFLPH*AHSHVIRDVHLYVILAFTQQ
SYITINGHLFQKVYIMKRIIILYSDSWCDTFADFERNAMSMTERFTHNFNNSSCLNLKYI
PR*ISYKHCYLRLRHM*CSFFLFPRKKKAL*GARTPNLMIKSHTRYRLRQQGSLIMKNYV
**VT*KYKYCY*NVN*NLNIIF*SLDE*LVIVGFHCW*RL*FYVYRIVGIKIHYRLSTIV
ILSIYYHIRC*DDDISYEKLSSKLEEAEVQGLIM**DNETYKTE*GIIVILVCRNIDSIL
RIPISSRRTSSIFCIHNITAFINNGIPTTI*KFT*FSCEYIRKQPPNNRV*MLI*KQKLI
SRTYYGYCIFSKFQMIFLLDGIHGHRNLSSISPICL*GLCKITCLVLFPSIT*EKKITIQ
ER*YRIHSNNGVHFQ*IMYLEEKG*LGNKKKNKTMILHQT*GNLLEYEKYKSVKSTSYIV
LVPLLFRRITEMKRNDVINKQRF*YQKDILNIPM**LTIPVLTNIT*RCTLRFLCV*TFV
GWDSRRSSLR*L*LNVL*ECSCIICLCKNLIMYFKTCMLLCESECMIMLRLL*GTSFLHL
KFPRSSADK*MSYQDNKR*C*SNCILNRRD*SFHPFYYCITWLYMKTLLTFDLRSLLF*E
NKERDNDE*RGFYRNEKPSHN*WHVYHRRHRA**I*YSL*ECPRRRRDFCHFGCMHNIFR
QCHIQRFEVDSGQRL*LSKGSYKGNRLMGY*CEVSR*L*QINYQRVELLRGK**FEKVQV
FDAEEAD*RR*LDFHIWAEDN**NACVSFAMFWV*MLRHNKRSATGEKFKGHKTNRDLGA
IPRSLRL*SSK*H*KCNAEERCYGNIISKCRRIKSLIWFK*QGTD*FGRMSSISASFR*F
HG*KQYVYSTMRCPRKHIGK*EV*ERTNL*PFPRLPFQNSV*STRSYWRGKLVPWRLCSF
LCPNEKLRYC*YMWEHRCRRNN*TIRNTEVRSNC*NLERNHILG*TEILPFTVRSSI*YK
RSLQKSNTMIISACSLLLFFCKNIHIYI*VSVIYYLRLGVVTRFKKFELEL*NLHKYAFH
FFDGKLVNFSL*KFTPSLKMLTIM*INPFLIFPMQPWGSRSITSPSPIEFLSNP*AGY*G
WPCN*GVLSQLI*EINIRINAGDRFIVKIISFFLGEGWCQ*F*AVMKV*VFIIRKKSNLF
G*GY*SVSSWC*RSRLTYQP*ASFKKLQIL**IDVQTTVLQCSGT*FLSEFMFCGFPNKG
VVLLY*LISGTAHCSSLQILLILLLFALNFS*YRKKYLSSVQFIFVYISFEARPFLPSNC
YYGNY*NHMR*TILAINSTLFAVSSCRTGLSIIMVLTERLGTLTRPIILLLEPIRSST*S
NSKFIWASTATKLPTKIRSSVRETIKVFPIKSDSFKMSMTLWCPLLSLLKTIFTLSMISS
HLKNSQNSCTSRDIF*KKKN*SAT*DAQNEPITLNFMIERKDCVI*NRVSVYRMSQNNTI
SSMNPERAYNNVTLKNLTAFQLLSQRENICELLNLVESTERHNSIINPERQRMSLEEMKK
MLDALKNERKK*ENATFTIVSYKILNVNPASLQMKNFKAYLVHQKSQYLIIIWKLLYASN
GHKSHLTL*NKLPRMYPVIQNRV*QMRIKIPYYRLILVGYAKIKWCLRLHITKKN*NGLL
SIRLFRHGSSKNIS*FWKNEIRLLIIVFVYIIYFAYFIKKLKLDY*ILSFISDIKRRKLM
F*NVLSKE*LRQSQAALSSIFDSLLCFRFGFVDCSLSRCSWALWNSFFCFRSRIFHIVRS
MVMRESSCQR*PWQFAITADCN*QVTWINGKYT*IQNTIKDSLTVWLNTVTTIT*TPTDK
VQPNDYHAGTQHKCIEPSSFQIEELTLAYHTLGNQHSDSTNGVITPLVGGLDQ*TN**RN
NPE*GTHDLN*QRMYHIQGGNVVILTSSTSG*LD*K*KAWPGQEPGNIFRVKDLSNTGNF
TCDRLANLDVVKFSLNTSPT*IRSISEESKKFKESDQKCRS*GISSQSGALVLRNEEHHN
IA*QYKAKDCKHCP*PIRTSLGNVHIQAMWWIKP*SLVTI*KA**RIVHLKFVVFSNQKI
LKSQTCCFVFVIINNNN*VNICCCVVLQNVKTRNKIRK*IGVTLNN*RLSQTYI*FF*CD
TTCNEVRD*YYTF*LMMNMKTLAN*GEESFR*DARKKLVLAIAERDDEITKMS*FGIRIN
MQDVAEGIGIRVGIGIGIWLCLL*PYQIFLQSTLSMRFCLLRESSYGSTLEKF*RIWKMA
NKIAQGDARKVSQMDPTVCNKGCCSGFPSLSAPCTSSYSYLCKTDMSYIAFIF*VFRSYY
NAVKRIHNFLTGKKNTAQCTHFNPRYHAALKLFDCNSNTAVEVFFFRAAHNVIYLN*QDV
FSAVEEN*HMTCAGNKCSSFLLLKKGLWFTCLLSPCQVLGCMMLRSAGNTNR*KTLIGYY
*M*RPCSSEICIEKWVLSLKMGAITCLVKLSSWI*LHKRIEIYIRSIIIPETILSAMPSR
GHALT*HALIKKVQIFASYG*YLKSTGVHFFFY*ISFLQAF*KKISHVVQRWLLKLLKLD
R*AILKSEDCDCEL*ASSLPCP*SSFSLSSIGAIL*L**RATIQKRLNDHQLTQATSFCW
DQDII*PHTKGPMKRAEAEILMVAPLMTDLQLKGLEL*INNIICGDVKAPQNVFIPVIMY
K*TTVYQLGIRSFCRKTT*GTITYIIGYSLTKVLKIVKQSKFRSTMGKMKITTKQPKIPV
VDKRVPVCSGS*PIPPDIFHGNFEASFFGFSGSTAKS*AKKTGKNSLYTIKCKAIIKFTD
IG*NTFV*KT**NILLSLQPSGAVSILACTASVGSCREYVLIRPTDCLLVKIGSIDCMLS
VSSSLVVFTRGLFSSSSLSCPRMLFTFSLRW*MFSESS*MRFCQGLLFGCIPNIFFLIKS
PTSKP*SLLSLKAGCVSSKNNVALVKPNIKNMHTTTFGKAYGYDLIILFAKCGNHSGTSF
IVPSLNTRNPPIIGPTTAPN*NNKGIVLKAKA*CFLSVAISPIMVLITPTLPFSNPIKLL
ATKA**KLRENPSINNDTDVPISPQVNVIFLPCFSENLPQWYADMTWHNANDEDK*PEYL
DT*ASLGAILKSLTMK*T*GNSDENAIGSLNLTKDTTTSWTQGKPSICSLKVSF*RAISF
IFVCSYAYHFLVPLLAFL*VI*IQALWIRTIIVFFTNDRYFLLYFVLAFSYPRFPMSGMC
HSLSINIGQAECQMEFSTFILKKNATLLYLQGWS*IKLTFKGGRMVNSE*IHRRR*ETNG
ISKIDGFCRCSIKGYGILYIMVAI*V*DKSLKP*TKASVWCTSFFSQRNIPVQFSRSIHP
ACFHFST*LVIVIFP*TPTNYFTHSRNQ*IKASNSIVRSGILFHVEWFTKTWIVGNENWG
LKILSG*KFFMFSLQRLSPFRFILKV*NFIVAFLENFYCIGIRYIVPFFIY*IFPSCFNL
LCLLIY**L*RCIIFL*RDKLLRQEFLLVIYTSFNYVFYCSLNKRC*LVDAINKAHFHFK
HPKLRKVSWSITLFGSKARR*RPTP*Q**R*NFQVQLSGHSQISRLPKVRGCSWRRIGGD
LKQLAGTFTIV*S*YWW*NFGEVVFLEI*HELEFYKGS*P*NCT*VSGSVF*CR*GP*IT
*GLIFLL*WIVF*NGTHKFN*LDRIFDLQFKRLFSIRGALPGSIRYR*SLTSFQNF*ELY
FISICEWNNYS*WVHRSPIL*IQKRYTF**SYGFDPSIN*NGIMASMVYLLVQ*FNC**R
VKSTTFKEGESMKH*LFVFACSLSFSLSKR*VELYLNCGTFSFFPII*KR*KIRTRKSRS
*L*VVHTHTPHSTA*SL*GLYFIFYLFII*IF*K*KKIIHYFDYTTM*FIFENNHEKLNF
THT*VIMRSHQPDLTITHIVKSGKK****KEKS*QFGFYGICLNTKHTLVLVQIS*P*KK
KHNST*ARTLSSNNVHLQ*SERTKQIKERHSEG*KVERIQKRVSHTHT**SNSCSRMDIN
KDEGDRK*NGSLRPF*NLCNPLCLACHFL*IMVAIMAIQAKPTKMKTKITPPGKVIYDRL
KVLKWEEEKQTKDM*EQKFA*VTSLKLRKKKR*KS*LICSSFKVCSVFL*ILLKGKKNKW
KKGSNEKL*RKIRRNKRKKGKLRLQEKQ*IAFKALYTGKHGRLNLKKKNGKLLSEKIEAI
FYYAVTSLY*HLSAFCFLFVVFFLIVVLILLCWKCENCFDFTRLRPIPGFPKKGIPVQCN
DSHRNSRGWVRGCGNLTIIWYGCTWDSRGSARGYRIGHRTGHPD*VWYVASLRNFIECKV
SPSSKGQQLKNARCPNDDINLLV*ERVNTPSFSLFLFIV*LVFLLSTSY*PHCHRM*ESG
SLLN*V*RYTKSK*KSLSACICFLARDSQGCVFYFITRLSHLKLRYQNRLNRRCCQLCRQ
*DLLRR*LCLEANPPLC*Q*R*LVCCCCCCFLMMVMFRPVESQLLMVLKLSFLVLSLMTK
MA*RLFHQCFHRRCHHYHCQHCLVLSLRGTRPKLYYKC*IHQTY*PNNQSHLQSLLLRCS
GVRGVGS*ASQSHHWNFCPFLPHRKYHTKGCKFRYFGTAQCIPVENMAPYQ*IQISYRSR
YCRIHVIQS*THCLRFCPYDHLLPPSSIVLSSSLHTQARAQSRLTPCDDFFHH*SSILWG
NFH*RKPYTCLHL*KSLNCGKPH*CFRNLSTI*PSSDPLDMRAIHNPSSIFRPVSLPI**
HLRELRYRSYHDR*Q*PN**SWLNFFLAAIPLVASEMYLLPPVFQ*SLHNSIPTLTDIHA
YVQRHLRSVHNRELAVVFRSVYSYPHIQ*SWIIFAKVVL*H*IRRSKMEFSL*Q*DFYVQ
VVVSLHYTWYNSHRYLATYG*QL*MVYHRQMQTEQFAILVLYHYCSIFEGPIHLDGIPH*
DQDPKIR*RLYRGVLGIVQ*PTSNGWERSP*GSWVP*KVWT*YSYLHHISIHISHVKTVC
SS*I*VKDGNRLVKLLSLRGKIHAYR*NTSRKGQIQDCQSAIALSWSDGVLLC*SSELKK
WQTPASQTMCEILF*KALWNEIPFQKKVHSHQQVQYQWVDHSRLIHIAVYPF*S*NHPYY
LSRRQSLWDCLSTSVYSYKTNISSWSTQIATPILQHLHPL*NHHEMDLH*NHSARYRATL
NHSEVPSIESVILYLFSDICNYLASLILLICGLLGSLHIVPMFFYNFMSFLFFHF*HRTQ
ISCLVMIFCEIGIQN**EKMSYCVHNSPDCLTSPTPGIIVT*YILSFQVMFYSIIYVMYI
*S*LLEQKVKKKVVLTEGEYIQIYS*M*IIN*SRAKRKIQENLFTLAVWF*SFGIHNFSA
VQKYCDVLIKYIV*SDFVPVKERMKY*LVHLLVATGCPI*IFHLRYKKIKKVNCP*F*KT
VTSCL*HQRQITLKKCTKS*HM*EHSKHEIFNGT*VC*RILKTSKNPIIKIFLLVKRGVQ
AIERFYQYSTSYYKCSTP*QV*ERCGIIIQIVLTAFLLIKPMIS*GRSSFHIIEHLLLFS
ASSPRVPSTRSICFKRSIKVSSTL*SNSALHSINAAWFLLS*LPIVEASFSPSAFVTHLF
TPFVLLPKSALVPTSITGRLSLPS*STSLSQRMGIRSKLARFIIL*HSIMPRTPVNDLMF
NRETSSWPAVSRISRVQS*LL*GIILVNSFSIVG**DSTNRDSTKRTVNVVLPTFLAPIR
AIFL*KLCVEFEEDIVAYSIMSQVISFLAVPQ*NCFGKETIRTSPKE*I*KYQYASMKME
ASSIISLEI*LVIIRVTAVEIVRY*TWQKRLVNTYRETTSSVLLYLKIVKNQKNKSVFKK
RSYPDSNRGCPDQNRK**PLHYRTRTSCNILYLKMRYVSMTIRHPKRS*NTYETTL*QNE
QHEIKPGLP*LNYPKV*MPEQLV*IRDSALPPLSMIHILYEKWVNVEIIVGIPLLIKAII
LGIQNILEVLLEDLGIHKRESAILHNSINIIIIVLYVNIH*SYYIINPCVSASTNLDDYF
SSFASSSNTVYDNILVT*ILVSR**LIFIPTLYNI*DK*HSVN*SDKLF*QLVTSLRLFI
LGLSRHSGITRARNTT*YLHSRYRHINIKILNIETSFRLRFGCRKPKMQFKWVNNLNG*K
SICWNKNPLSSIN**LYYQYIIIYGVKMMT*VMRSCHRC*RKLKRKD**CNRINEYKHIK
RNEE*S*Y*YVEI*IPF*GFLYPRGELLVYSVYLIL*PLSTMESQQLSNYPHISHYSR*R
L*Y*CWNKTLKYHPFRSIHATSILSHEV*EDDIKIEIQSSNLMEAKCRD**CNKIMKHKK
QKVGVLLCRNTDSILRIPMSSSRTSSIYEILYPLKNSGPNDNHNIHRFLT*TDHDHPSEH
LAVAILNSFVSGLFLARLISQ*RTASGHLVLNF*PKLDDFSSH*RCLNVNTERACNNHST
VNQLVSYLREILKR*EDSSHNRSTSYIYRCPTAEVK*R*INRAKRKKKYRQNSDRS*LYL
APPPKSPAQVTQVHNLLRG*IKEKLEQIFSWPGNCLWIGKALSVKKKVLAPSWSLLLPEI
LMLSLHCFIK*PIFRVTIILKFEVSKMHQTWCRN*LTYFNFYQEVENSRVRERIAENKIL
TKPFRIS*QEAFKNIDLEIVLHLARKKRKIS*TEIEKCMMKN*VDLFRSVLAAIVHDTFE
KSPEIFHYHQQDQ*IAKRIECIYRKGFEISAISSL*SSTSILSSSPSFSLSWLSSSSSSP
GMSLASI*GTCFLDKFSFICSERMTTETIPLDIAVAKRA*QPLSNLGTISEAKNNIDHHA
LTAPENIFMEARTIARS*RSA*QIMFAHEKKTACPAYATPPRYCAEKTTFGFSGSARIST
ATITITNDMKTETCQCLALGILLIYTAEQSVETIPTANIPEG*LFLCANVYFWFCNHNAN
VELDAKPKFSPPRTQTRENIHQCHLFKTLGIVDQSNRVLSSLAGSLLLA*CSSCSLKMYL
VIENLLTALV*SGRPGKKINP*IAMGNVIQKSIMNNHLQPAKPFRPFK*VKILVCINPLN
IDPTKPLPVKIALLMGNSSSLYHEPKTKCVPENVQLSNKA*KNLIAQICLNDVTLYIPKV
NKPQANVQKLSHILGGTHNNIKLLGTIPTM*PIMKTVLDTVKSFPTILRSSFIPDIYALV
KPTRST*LIQYCKQTNDSTNKSILNRSNLFLMARLEETDSLSTSC*VIDFDSFIMT*AQA
LSNQKF*KQLLNLE*IGILLYQNYRSASFLLRADVFLYNIRM*KI*SMLSSCNSSKMPFK
IDYSKSTIIGLHGSMEV*AIL*Q*RIC*IR*SFLLFC*ISSSKSILHNTR*PIYYSIYTF
YLRISIVLHN*FVIPNVFFLFAINILSKRKHALDKKYRGRVEISKRKYYNYSEEAAFSWP
SASSNFFPFFNKLMSF*TKLKVVPLEPSSLSKT*LAASASTYTKALNKLWKGNVSKL*RV
IVK*VKLKNK*HTLF*HILSKN*FEVH*KR*YYTNWFGHLFLVAKRYYISNNDCY*QKYV
Q*IQSQCGRRWTFSRSPSSW**HGRNELEYVKTLQWISGFLFVLYLSRTHN*QMTCYQIR
GICLSQLLC*LFFFRLGANAF*ALLHK**VLDEKS*KSEKWNRKERKYRIFTEHYST*V*
FYVSLKQRFQKENMI*RRHLHKLWISKQKNN*Y*KIEA*QKYQARPW*LPVVKVLFVFTS
SHSPPNGLFSSSS*QVKVIPLPAPLWGRATLSVSLIVNLVITPLADSCARPSVINLAINL
*PSPFLVKTTGSLNLHVILFFSLLKEP*GFDKALVALAPSIFTKTTRSSITICDISSGKL
GDILTVNTTLAW*DSNLQTG*ITIGAIGSFMEYLIAPKVLESINEGLTLNSSGATRSIKA
WFRMTFSNLAPLLILKLIPIGKGEFMTELGK*LRAISPISWEFCNIPSLKEALSTSAILA
FNPN*DVSKEEC*NND*PTKDVEEPVA*GFSSLSSPVI*EESVETGRSWGIEDKEEEVGV
APEP*LGKES*S*ESLL*MKFCFLEGGKAGARICKGLEST*PEGWLSTVAVGSEILGEAG
STGNGFVFDCG*SGG*EIDIGTVLGKLLESGSFAVGGELCCGVEGGTSEGVKVCAGGVSA
VTGASTFLGVAWGGRGGVSLASPGVQLFDFDDE*VGRRCF**IEEVAVEDTLVEELFGVS
VMDA*I*EFDDDCCCLLFLVLFLPKIEPTLDLRVWDDFFDFKEELLVESENSLFMRSL*V
RLEDAEARRCPMFPNALLRLSFCGDFFSLSVLAAPLDTETGRAPVAEAGEALLGTTSLEE
EDSWKLY*LASLAKRSISLCGSNARNFVITVSHSLVVFSK*SLKLV*NLSIQFFKVSKRL
*SIVSNSSNK*GLCWSHCLLASSK*LEFSLFLL*CSIEAAFLLSLECKSLLSLQLVLFST
DSFNSRTTCWSKVL*YSVLDFKSDFSSSITVSHTFLSSPSELNLNALISCGVKTLLSII*
AFKIFVISSFSAIIFLNC*A*FLFRFANSLNNR*KSLFNNLTCDNLILIVSVAS*GLLVV
NMLSAYLVLCSVMRGDYSQFSNKLASIRLQQK*FLY*GNNYETFSLYFVKT*MQYRVFQS
AST*GALLATHNIEMKDHGLRKAIHNHIQISPVIYKNI*AIDFLLPPDLVVFTLQN*IQY
*RQWRC*YSVNESKRWYSCRAPT*L*MRKLKHDSRL*NIVINK*TGLHE*DSLYSLLPTQ
P*AMFKIV*DYFMRASFKKKFTYIT*VEKLPSDV**VNQ*NEMDTKRRRHGR*Q*RERHF
FFHVF*KGVACFTRCSCQQNSKMMIFLNTIYAR*YLKAFKLYDYSVFDSFKSLNRFCNSW
*LCPYISVMTLIKSQS*IFLTKRL*GLFFITKLTYELI*LWALYNYMYTFFNCKK*YGNT
STIHA*LIIFYLFYHPSFWWSQMELG*HLRYGQFSNQIWPKLSKQLDHLDLESWF*YHR*
L*S*RERQ*YRLPYT*RQHLGQPT*QRMEKIHLCQP*PSYHQ*LWRWFPYQINR*HERKY
R*KKRKF*QHQKLGNCHELEQRLNGNSKSISDDIKRNVVSIQKFFFLILT*YLCFSIEKK
VDKIYCH*HNRLN*SL*ITLEAMNSLNCLYVSDFQCILHVVRNIQQQSMENRDALKMFTM
*LNILDMAGSCGFLLSLGLK*NLH*KVLSVIYSD**PIHFNCLPEEALHHME*ARRRDGL
PQADKFAKMQ*RMAMLVLKVKKRTQKKRVVKCTDVY*VRTPHVSTPKQSLLHFK*GERRY
ITSMNKNDNQ*VTRIEMSGPCEVLESNK*VYRIYQNL*AFE*QKEPFVLILELGCREDVA
LKVTNPLQ*YRSLECKLFC*FSYKFTVEKTTVTVNQ*KKDLTL*RKEQEKKMYIWVYYPA
LDNIFQ*FCQVTM*FMHGLKKIHC*SKSSPKICVAKLCLRYVNKVTMKLFYCSQTIKTGS
NLSYLFRLQRLFSSAH**GDICLEERKSADLIIKQDQEQLNRLKYRAFQTVSYYYLILVR
VMKVVTL*SG*WGK*EAFKAIAFVPTASAPFQYNRISLM*LLIQLTQINHLKNS*KDYSS
KNCKPIGSFSFLPKKNTIRI*IQLLMLLRKS*DSKTM*RRLL*Y*EIY*YYNQLITKLNQ
M*KTWYSMN*PR*YKVIPYRII*LLIAKKAQLKMTYANSITIPVLHFRKALIYAMIAEIS
T*RSRNDGYNY*RH*LTQLVSQLLFKLFSLYLTFR**INKPWGS*KN*GFEFSKYYQIKT
IVGNLHYYRKIL*NGTFLCFPWIAHL*NCKTYISIRS*NSVTVS*IH*HSKFLILAHKIT
CNLRTRISFFKYKSHLELTTRSFFT*NSIPLPQIG**P*KDTFIWKLRKASFVFQMITT*
SVYLKTSNSKRALCTLLEF*LITIIE*LFMLMEV*SISSRYLKTLYAN*ALVNWDP*FVQ
LKYIDFICGMDY*QNLR*IYFKLSAPITNIHLARKKKGLKFYRSAKTF*SLRLI*WPGLQ
QKYLPQNTSMRLNFLKWKISLLMLTQMIFFKISPNRLILR*NLRKARTRKIFRKWVSAIS
IGVQTWFQNLCPLILYGLRF*T*QNPVV*TICFIMYHI**IFYEILIFLIGLKKTLAFLY
LLIL*NKK*HKIYLSL*ISNFSIYS*NFAGGISTIFPNP*F*ILMPTKT*SLTWIYGI*M
RIKVLWRQAD*KLSDFFSSKFQV*WKPLFILSSIPINSMI*IS*KNYV*AIRLSQKEKIR
TVNLMSYQVI*FLYLLLY*KAILINDICSGFYISHITLLREKMYVLQRLYFKR*INFFRF
T*IKVVTKMRRYFQRLYHLS*Y**LWIK*WKIMNQTLLRA*ISYLR*F*PINRFSNNFTK
MMV*NSY*LCFVR*GKAIERRLFLCFSHILLAIIPQLTKYFQVLKT*LEEFQTTR*LQKK
LFIWLSTSLSGM*LILMPVILLLYWT*TTIY*DSSKI*NR*ALFRLMNLYLILKKVM*WF
HY*ISR*L*MNRRTSQSSRALQK*FQSSLKVI*CVLLRNMPLMISKSI*AHFFVTVQNTN
WFIQKL**TIPVT*SYHL**HSYPKYLMTW*IAITI*T**C*SIHTRCQISFIFFANFDL
IRHR*LCLKIFISQVIHVSCIVLFRLINHHFTISKTFLSRNCYRTSKSA**T*YIPIL*S
R*SGRKKNTRCFLSH*WRIRKFYLHMEHVIMRPLAYC*YFLPTDYVIVDTTKQSSIV*K*
SLRTRKGN*RRWRVFLTQRIKVKYSKV*VISSHAITLKQ*TS*LNNTHFFSTIHNRYGS*
TLSPISCLRTTIFLQ*ALDRSKTKFTNGKMQDQNTSPKTIKSALFYLEKTTHP*ILKSKS
PYQDTLTTSKRIEKKMQFSIEII*IF*FFI*NIHWRYNQIQIRPASGHRTLQKILMG*NG
GFCLLGNQNMNHSLTRKMLIKIL*QVVTDKGEKVEAFYPTNLSNIWRLLSRSQLEI*MRI
EKFLDF*RITIPLQLFGIAV*LLD*KLRRGF*FMAVITFTL*VITILV*RIKRF*NYQKY
RKNHGI*RLA*LTALMLKGYQLS*STKSLFGNFSISLSLPNDPFYFGMSPSNYCSKRELA
LFLVFTTKE*EMTFYGY*IRSRSTFQQIQFFQAFYKK*TTEEIV*WQEME*ERQALLLNS
LASSQRTTA**MDLRSAKNGLGERFLIFITC*VSTS*REGHSTI*PNIQCFRGLLQITKV
TYSI*RILKLTGTYRNLWALKVRKGNYSL*SVMKLWLPWKMLIPHHFIMARIIPQL**YL
HI**G*SPLSNPFCYCKAEVLALQIVYLVRLKGPGALLLLKIQRMSGN*HLNFFFYLNF*
STLIVMTLVQTKAVKKLTTSYFHPGQMVTQRFSFKRIEKL*KVLMYQHIYMNGLI*YLVT
NKRGTLL*NLLTYSTD*VTQAL*I*ITLTMKMSAELSQALFTTLVKRLYKYFRNLIRKK*
PAMFNS*QQRYGVRFQ*SQYLRRQSLI*MKRTGPSIMLYTILVTSIHYTGGASLSQTCFS
ERKNR*CH*ELCIKIG*KLD*IFLKRRIWLRLHRLRTGSWANS*LAIKMG**KFGNIVKI
SIRFQVTLRTKKQCLGTYAS*RRCAVITTTIRF*P*TSAA*YMSGT*LISN**GK*QMMR
KRSQYLNMQGALWY*LRITPFRSSI*MDKYIHQRNSNQLKL*AQLIFLTSLS*TQVTESI
SIGKRWKYY*WALKMEL*KFTSSF*IFIMNGR*SY*SSSVPKKGKP*LALRDRGRHTCPR
KDARIQQSLMR*K*LREH*MAD*LFGTRHHIVTPFFK*FNFCSLYLYF*N*FLIPSSIVI
AYVSNIITNAGYFFLVFLLHFAYGKRQKGKRKKQTINSSLNYVKIKTQPQI**RPEIRIT
IDFVHHLQIYSLFKTGSGKEAVILLESLTSKIYNH*IIPKGPA**FAY*LVHRTANRNKA
*ETWGIRHLHEGLEIRKGTIIPIILTEGILPLFIPRIAFQNQAIMDLYLLLLPIIQQIRL
*LPVLHLYLFLQRHLEARLVSKHPGHLDMIRAQSVGLRHHLIRQQEKLEAVITQMWKDPL
QPLVQLRKV*IRAP*HTPIRISETHAILEKP*ADIILNLLVLQTLPTFPRHYQTLHRFML
PTGVLGDLDQWMIIVLM*RTSSKQIMFHLLIITALILITLGATNGDPLERLPDHHLIIMS
AI*RPPAILTRSIKGNLFGKQIVLLF*NQLIHSHRLPFILKNFTMRINWTNQRLQLKLKH
PVKMRQKPYRTMITIFHQENQFLNLMHL*NPIISRLAKKMHWGKKKYIKVGVR*QRNILL
L*K*KSMMN*KLALKK*VKSILMESRTKFGRRQKQWPVQSKFPKKVKRN*HALLKGRKAQ
KLEIMKEHTIRKP*KQT*QS*Q*TMIIKVTKNLLKKWRGVFSHYQKQKRDYGN*KTRKET
K**VNKSTY*KRQLGISQSILFTHRTNLYISRLPDLS*RKLYQR*KRKNI*KK*I*NMII
SISRRSMKKNAKF*LN*VKI*GRKKSKINVKSTN*WSRKDVKKVSKQKRKKAYGIHPRLP
HLVAEIGLTSLMMRKWKMYCYKSTQIINIIRLLQQFLR*F*IQSANTLTNSVM*ITWLQT
KSFGRLEY*KTPLTTLLTMSTLYFWRVI*FILKNLVKFLTTWAA*EVLKSVSYIIIEQRK
L*IINNFLSIRTRKEKCQPLPSAARGRKEVMTRKSKLMRVKKSQRTR*RRKKKVRTMPRK
MFSRF*FKVLK*KVIH*VHRKKLKI*LNREAKSLQVNWKMLRG*TT*KGRMMKLEKRAIS
PV**KPTMGYK*WIQKELFRMVIIQRRPKNLTSV*RMRYRERNTNLHQSIKQVIGVFVNL
NSFQNC*RSLALNGLSYQKNWVPNLLQW*GITTKEMQLAMDGNYWLMKPT*SEMGLVQNL
YNNLKF*YNQNDQTSMPIVIFLLNKDRLWVILLDNQLMGIIHLFHLSMAL*DHLGLIFIV
IPFLKLVLL*PLYHHQDYHLFSFLVQKWQNLQ*QICVTGP*TILTRWLMQLRQ*QIIKTS
VMKGMQLTLAVNRRQSAIY*IIRIEA*NLLSKALQDTKHSSKTLPA*TIL*YKK*NRILL
RQDRVLFLHY*IL*MGMGNQTQMEGRCCHFSMLFLKALLLSLYRPLALVQ*VVRLQSSIF
RMIRWQLWLRLPPRQMQ*AVFYLKRKIIIEQTAETGNTYALLLFHPMVGETLEHTLPYVC
*CTILYIYICIYIKGGVFNYNCNFVFFLHYTVFSDFKRLYLSVV*ICHILFLYVFTCPGV
RPLLKIAKPTEK*TSRKSQ*KIGKYFSFHYYPQAILYKVKRLN*LSSSRSHEFTRYSICC
SVVRALSPTS*LFTNFGATIF*YFVVGTFR*CRHSCN*R*ICSKRIPIHCR*ITIKHFAP
CAIRHHCLLRYYFWWQVFVK*VETI*IKWPFPIA*FGFNFTFIDAFIAYG*TISANYCSA
RVILRYL*YWCLDSTARYIILHELHCQVY*IYRHLFLGAKT*KIDIFAYLSPWRYCLIML
HPIDGHHIYFLGPYFIEPWCSRGYVLVLFLGCQRHQGLVEGMGYQISNYPICFGYRFHIF
CCLPKSSSLVFPNFATLW*LCGFNNCHLCRLCHYFFIFGTIYFILH*RL*T*RHQNQ*SG
KACPRRCCRKG**VC*R*LEKRSYSISITKTSTQKKKVSVKSLKEFKYSTFVYSFFLSGS
IVTIITIIIL*KTGWFCYILHTHVIVEKSFPFPFDSHQIILSESFIC*ILLTNRPL*P*I
TTMIFLSFLALF*RLLPLMLIAYSYLKEQRGWRSYCVYLFLPLQYLGLLLAQCSIYPYQC
PLPLLQSYQSFVIGIRGLTPLSHNLKQMQYSLRLSLTVLT*FGRK*FHTFLLWWHFFLLF
L*SFLNRTHAHL*ML*VTLRSVKRTSKNSNTNRRLDQCDSRLQFSHTKRMTIFFSFSGLF
HSAYHLLIHRDTRRKTYRLHSHYEHQLLPSRLF*AIS*SAIWNRVVFVI*SFLHRCKRPL
YLFQLPPPDRQKHNLQLCPPLWSLRTILPHRNHPNL*SRR*FLLLFHP**KL*LWFSHFS
KHLSLKCCF*CLYYQHPHNAIKYYFL*QHL*ILHIFLDMA*FLGISVFVKTILEIFSQEL
QVEK*LGVSQ*FLTWYFQPFPILDACETTVKLICVTILIV*FVHYCYILCHKKRKKNLIL
SSTVI*KSLQIKRE*KGLYPKVARTIMKQIG*K*PIRCLLSFIPKFQQHISKMGITVIGS
LNYDLDTFTDRLPNAGETFRANHFETHAGGKGLNQAAAIGKLKNPSSRYSVRMIGNVGND
TFGKQLKDTLSDCGVDITHVGTYEGINTGTATILIEEKAGGQNRILIVEGANSKTIYDPK
QLCEIFPEGKEEEEYVVFQHEIPDPLSIIKWIHANRPNFQIVYNPSPFKAMPKKDWELVD
LLVVNEIEGLQIVESVFDNELVEEIREKIKDDFLGEYRKICELLYEKLMNRKKRGIVVMT
LGSRGVLFCSHESPEVQFLPAIQNVSVVDTTGAGDTFLGGLVTQLYQGETLSTAIKFSTL
ASSLTIQRKGAAESMPLYKDVQKDA*NLLQFFTFSLLNFSFRHIYKV*KGTKNAVIRNVI
T*GQFKCYLLRRKN*YHNRE*LRRQTLTTKQEHLWR*KRLQLAIYYPFYRS*K*Q*RLEI
QMKPTPYRMRLTRRNRTQELELPLDRIICHQLLAPRE***LLTQYVRQKCPQLTLKYRKY
IR*QKHHRSEFSFVMLLQ*LPTSLKMKLPYQGLYHP*QEQQLTKGMC*NPLLIVDLYQKT
GLSVLLQFHRTIQKHFLFVTLHTIEE**Q*LQ***NIAL**IWSLLV*IFPV*FCLF*R*
VSSRPRSTASIEYL*AERQQKIAPSRFHKVLSTAWR*YSVAKK*VKPYHQYLPKVQHP*L
MP*QTVKCSPADLVRVLIENMSILGRQRWKSTSKERIQHSLPLKGHFLAWYLQGPITTMP
KLSQRYIATRLHPM*NLLIKS*LLTTTLYLRFL*RQLLLPLPYRHRLLVP*KGQLEGEPI
NL*CVMEWLH*PIRKHSILPMPYTGVRQGH*KF*HPTKHL*Q***SLFSLLFSQKIA*EL
PNFQF**TSN*LA*AMDT*NIQFEAFLA*VSQLHLQ*LLYRYFAKRGPTCLSMCCFFPKQ
CGRAGTTLTLACMNLRSQADP*EQHKIQ*VVQFYCLNCLKFHAGRCRCL*KILHFLLILA
*CSCAILYQTS**FY*NPFCSIR*KISTGKGLCKDLLLSVLIMTFSEI*C*IANNSRGRY
CR*CQQTRQRHHLHPFLLRCNQTYFSIHCRCLKSVFQMGY*MNVSLMYQK*FLLKEAMLE
FQD*KFHSILLQCLPSPNH*SSGQIFHRT*LPFFCRNHLLSISRRSG*LRMYHKN*RASF
PRYSQMSCVIQRISYV*NSY*KRWFSLEEITRLTQLFPR*YCSHLWPFRRSLPFCFLKVF
*NQRAYA*VYV*IFFSMKMVLLQLCCFLYQRLDLESESQRHRLSHRLAFLVSIHLSVMCR
SNFSIRYNLGNDSAIQGQRCI*ESVRISFRGTIIAAFTVVLLHLYLRADCFFGVKHCFLV
IIFQCIGLLFPRAKSSIN*IEKRVRENKKEAVA*RYGN*NVSYAQS*TFLGN*LS*L*YL
*KITSNLRLVSYQKILSTVVMQVFLIFSTKHEY*LFVSVQEAKGSHLSLNSSVFR*ALEP
*LY*LDTPCLCCRYIKCAPLS*PLISFLQ*YLNSVYLHIAFVVNIAQKRLSL*FG*TFAY
SRYYHL**MYRFRLL*R*CP**AVM*KVHKEADCGKYV*LFFYKRCSCCLDVRRLLGAEK
GGLI*HLSGEIVFLLNDFAMM**LKQVSLSFVSIDKTVQLVTSRKWCAFAAKLSQERRTI
TGWKA*TRSQLLYRCV*NVL*ILLFQYPSKEKILRESMSLQVTMEIRLERRLRLLEVHPV
SIGKVNH*GQLHRTIHHLRSFCLSRIGEISFRSPGAVYFLRFPYQLDQCNESSIASFFFC
L*TAELCLQTVLGIHNIQPSDCTKN*GYLLMLSHYLANKTLPRFVLDEGRSDFCVCFY*L
WDRIVATLGGEHCQLSSL*S*VVSLRSQRGMAFAICESCAAASYSNRAVF*RPLVEHHPY
*KVNRPVPLRAVLVL*PSVYLRCHEEGNGRYFDTIPELHVGLSLRRVARRPETSRRS*QL
VIRHPCLHQRRAYTSH*VDVFLLFLCPDFF*RGGIL*RHRQLLPATAVRPFSCCRGFFLG
RYCHYRAVCDL*IVVEGRL*CWRYVFC*LFLRRFGPG*RSVRLQIGRLVQEGRRGHYLSV
QTS**CLRRGLIVYVFLRNIYIYILHRYIHICFSGSFFLLCQRLTAQEVR*FWSDCYCFF
FSSSIRNPVFDLNAR*TGILH*IL*ALGI*IWVLDVLCKPTF*YSDIFFCKPVSSVRFST
FVYHILSYHIKYQPIRRFIFLCKLIITSIVFYAAHFFE*YSNGSSELRCCLQQLLLLITN
LTVFVGPR*ES*YIP*FNFFFCCYTLW*LR*ITANRKELFIYV*YAGFKLICDLWI*KVF
NGYFIHFFLLIFLFFLPTSKLISISPLYIFLSSNILCFKTLMMSGFCLGCNLLLPNVEKY
II*NNLNS*LLLLTFTFYEMYQPYIIT**TTFTICLLRSLLSKLRTKHPNHTETQRFQKS
*KKNV*LSM*GQAASILFDHSRKISRFLFLPLDF*IKSKFTG*RLEVKILSFDSSIRHL*
NLQRNI*THLWLLEHITHSLAPV*NKMSCLLCSLKNGTRTKCSTEYGTTSRNSIIL*TLV
LVL*SG*RIIMLKYVVTDIGKMCLYIWPYRVWSWRRLFIFRVLNVVSIAILFETPHRLAL
VPNVCLYTHMAIPLSTCLFCLCLCICIKYDITQTQANNQFLASFFVLILTINDLDVTFVI
*TNWLYGTDDKCTITLGCCWILTNRKGKLPMRFT*LLTFLCLLVTFGFTICFSTFLTGLS
PFKLIFILFAFLGASTVEVTSFLICTFRILSRFITISSLPSSLLFIFATSLLSLGVSNLT
TKLLIRVYITLTRSCICFLWYKLRTGKFKTSQSNIFKGLYPLNISRHICINPLIF*RPIF
SIFIFISST**PLKNNSISSSLFIFLTSLCTDWTEDLISSLMVSKLPSITTRFTHSESTS
TLLSLI*ESSWKQSISVNKTRASLFFKPPSKSMIFKTIKNSF*KLSLEISPLFIPNVNVC
IIIPVNSVKS*APTLCNLYLAYMIVVLIKDSYDESQFTKFSYLNN*VLTFSIYALSLYSF
KATLTTFSIKLRTYASSLYLFSPFSL*TRISSKNCFTNFGHLPFSFFTLAKYLGILHCKK
YNLGFSKLLLFGILESSRQNKI*KI*IKCLTPPVKSGSYTYLLSASHAASLMPKK*RSSI
AVLNKILE*TSDFTPPLTTTSS*YRMASSWASMSPSCLN*EENM*SG*LMCIWQIHSRSE
SMRIHSNASFCLSNSLLSDVRLNSVKLNREHSSGDMYTFPRQFTSTTIGFSSLLFSTPFS
SFAPPPLFLNLLYFVLY*ISIFVNVSLISTICSYGVPSCSWILIVIEPVKHSVRFKSGCS
KWSSALLKNPSSPTTFSWPSSSS*TCLIPSSITILFLLNLWVTRNMGTPDPYTHSLKKFS
NLLLLTLSQTC*KCDEVNELFGKSPDIA*RKILGNTRDIPKDRSVLVILLSSMCSIIGAF
NCIKDKSLEDQDIGLELPVKVLPIGGFSKSCSTIASLLRFN*YLYVLLPINFLVT*NTI*
PAIPRQHQ*SFISKGVIFTQDHWLASAHANSFVVLNALSITSRGYNNLVLQMPNAAKSIC
LEGAVGKNTIE*QVKG*DPNSFE*KSIIFWQTTVEFITVNSSVSCVGSVKI*MGIISEPM
SSSIVSLTLSTTFSLNLSSSTSSSASTLGGDIKGKDHELKAPIAQPM*CGATGLII*NMH
FFFVKSIGCGSSLIFEYSEQHTITSLKLGLLLSSIFRLSSSPSSSSSSLSPSSSSSSLSC
ASLLLLFLPSSSFFKLESLSSSLITLAGFPSSSSSCSGVSSFSFSLSSPFCPINFEVPIF
LTNLGTLNSNSHVDFSSSKSTHGTQYDAELQISPFEV*TFHNQGLSAYTVSNLIPDFGFL
ISYSICNVIGVKTDS*NPGVVLIEGVIGV*LLNALASSKDILMEDGIFIVNWDLESVSGY
SFKLANLDLKKCDCSMELSLYNTFCEVNPFKFV*SGSS*IN*SHRRFSTRTSLIVISLQS
KVTYSRFWINGMIIIVALPVMQ*VARSISNEIFSWATLKFLNFISCKVLDSLTMALGVAF
LEKDIMKSTYLSCCHLFTVQNFIKKYFYIRSILL*FSSYAIYQLPHSAKVFKCYPVT*GN
TKNIHYIESSMYFIELNKTDFVARYPQE*FTTILDVCSFFFFDFFTNFSAILE*LLD*IN
KKNTIITQILKQSDKNCSILL*QF*FTTNSTLSRNLCLMDSFFK*LNAVKNKKNNHGICF
*EFAILVYITIAFFML*ENIYSFNQKEKGNNPTYPSVNS*SFYYFQL*TSKKNKIN*IKI
K*KMHYYYNNISM*TYTYYFIAFCNKRGKWWDKKMHCYSFETSSNKSS*ERCRFRSLHVG
TLNHLLPS*SRPSSCSNQTCFSCCWDTNLNLLTR**TKS*NNRNNTKNDRKRDPL*YHTL
NNHTLHRL*PVHN*NNRVRISIQVYIHLHR*TYLDSKLCLDH*FLGMHVLSIRKHQVELG
SSFAKVR*ERFHCLLLPQKFLGLILAQIFFCI*FYTYRKSEKKVKNKQNVITVKENQK*T
KKNTYITIIHDSKQVN*DI*YNCLLPQ*A*SSRKKSYNTHEGHIVHRCHSAWASICHS*L
KKSNSSNDMAIVVTITRRIGMTHSLKICRLKLEYAVFLNSPISFCFCRAW*FWHDNIINK
IYCKTPKKMLNLMLYVYDQST*SLKMCRAKIAATDAVNACAILGYRNMEVILANIA*NPV
RTVKPAKK*SSFSVMIKSRQ*KTELAVQANIPATVT*R*FQISILLLFFLLLSPSSRMIL
ENFTNPL*CGIKLPILNIVEKNS*VPNTLKNGHFPWNWYISSSSSILQRVMMC*HW*SQS
EIQSQNNNLEYKGGVSKNSIS*NMLVSGSM*FIWEFGHLLLYSHAYVQSINSSKLSPGEH
VTRKQ*TSRVTTTANLIFLATLLFLFSRRVWFHTLGCSFIRFMKNEK*KVQEYAREERKN
*C*HDIMQ*FIYERKRKTLQIFHKITPLQSNLTKR*CDIVIPTPQF*TRLKILRHRSL*S
GIVLLQFLSNCLYVQSRERFVVIWIVQFIDAVVKNLVWRRRLEKQRSSMENITRGQILNL
LCYHFRLNSLRE*DRCNSGDNGRRHRCT*QN*SVVVVQMR*RLNFHAWGKDVYTGPPIAE
LGNRVNVVIKGPYGDNVFCRRR*GPVGV*IEVPRRGNKYNTFFNGPLHCHVDYGAPETP*
T*IGHAFFTLWATDLCAMFHDELQTTKNVTGLARPVFAQDFDLHKIDPLCRSIRFGTYES
RHVRSVAILVAKPFFGQVNPLDDSVFEFRMVREDTRIHDIGVDVLTLIVVFIVVIEPAFV
AVLVPNVEWELVVAGNPGQVTGCVWLIRYILLFLDVFVRVFGGSVKRITRLGAIYTVAFK
SFEPEVGHNISHQWAFLQLVH*VLGQVHGHAAEGSDGEFLLNFVVDELSP*PVGIRSELL
ECCGIFEPHQILLCVCEVDQQRDEYALWLHDQCFFAVFLGGC*RMSST*VYLYMLCKIEN
KKANENNILCRFFYFRFNSLYTYVITTGNQKKKKENSTKRFTLPIVSIRRFYTRTIFLIY
RRWVATEPAPSLFLSS*TCLEVADIQPCTSDVVVFVSLSARDVGG*QVDSLDQRRKQWHS
NLDGRLGYLVPQQQRGVLHQLFAVYGKDVANKGVVRALGRVVHNPDHVACLQAVLVLFTD
ELPLNGPGIQRLYF*EGHLLHNLRRSYALHRWVHGDGFSLGGGDHVGPCP*SKQSDVPAP
HRYGSLSLSAAAQREDSILLLLLYWEFQSTKIENQEKKENTSLHKSARSH*PLTYRYKCI
YTSIHIQVYM*KETETEGNV*VCIFIVYKRICV*GCVFLLEPVSSFPPGELGVLRNFPPT
SFHELLLS*NETLGRLLVFASLQALAQLFLQVDVLLVHGHTVQIHLLLPLRWGPTAQHKV
VLLILFRLWVVHHKPATEPCHLGRLQYVVHLVVVFRVELGHKFPSLLQCSIQCVEKPHQP
LFRIVV*SVRIAQPLDRTDTNSRVKRARPERYPGAHILQHQVALQLSTKTGRKHAGRYIQ
TTPHMVSLLRQNLPRQSGPAPDIQNETARLQIQKLQRPQRHLRLDMLHSGRTRVLVCFAI
IIENLRWCQLLRT*HYFFSDIFPVFPYRTFLALLFYYALLLLLLLLFSSLSHYVCAAHLF
FLSIKLKNVRWCRVKKKKKSGLAIKYPAVVGLV*RTIAPSRPWQHADDIRRTSVVEERGA
IGTLTQVVVQHGLQQERQNRLQE*RRLRICCKTKSFLRSADSIPQKPTNGIRSRTIT*SC
HRSPWRFRHGRLPRRWWSQWSRLKEWSRLRRNVWQGSRSRRRSTLWTPTCKSTFHT*RAS
LGRGSTERMLASMCRFLGT*VLILAPRSWTAPSTCPSRRLSKVRCWRNSSKIYS*QRPRP
RPR*RLR*RLRRKRTRQMPPQEKNWSRTFQGSTCSHGCSWAG*PSGAAQITMRRTAVHGI
SWKSCST*QRTCSRSQCWTWQCSCALSSWFSCTGW*KSGSSTGSGLGSLQ*ASSSWLSSP
*RSPFTSTTLISTGSRESSCSCTPWCLL*RATRLPFTTGIFGT*SRNSSTLPNSCKNTRN
LCPQRPARFCKKVATFAFSN*TTRPRITTSPTTSVAAISSCSVCSPSSCTRSTTQERRAS
DGGMCWRRCAPSLAPSSS*WSRHSSSCTRWPCAVSSSTTRPPSAAGSPPRKSGSTCSST*
FRASLFCTCSRFT*YGTLY*IAWRS*PGLRTDISTATGGIAFRLKSLAESGTSPFTNFY*
DTCTTAPWAHCI*ARAKLHYLLFS*VPCSTKWPCSPFSEGLEDICSCSNCRSLCGLL*AT
PSFYGQDRSCPTLSFRLVSVQGPVSL*RCT*PYELPPYHVCPSQALDRYTIGNGRPLHRG
QRQGQRAPRSIYISIYIFIYIIRTLQYSIYHSLFKFRVILFFSLS*PQKFSMPLI*LRTR
RVCR*QKSMIIGVVTTK*TLIYGWLLQMVIWTEWNISSARVKAP*PRNPRTLTATLQCML
PPHTATWIC*RKCAMSTMETLMCWTTTAIPRCTMWRMWPLPG*SWKSWVETSLSGMWRAK
RHTTRSSRTVKMVS*SST*GLSPAWPMFTEWTACRVRVSSTANCWKSSRTT*DTPWKMTL
RKEPMRPLCNAGGSWNRSLRETTLRRSWKGTSVLWSESRCWARAPWRVPGTNQIPREENN
DPAQRLLQLAKRN*TRRYMNYFFLLHSLFPYVSFLYINRRSYKVKFHRVFK*NEKNVVE*
KKSNKYTVHKAASYSNTARKTAHRNGNTDQSGPCYISNGCLYPHVSAR**GLQSGRFEKI
DRNGFQTRFVSDKKEAGYVHQFTYKHQDQGPSPQ*RDAEDLRLQHYGKQPSQRFWHPSGL
RQDYMDTENRR*ASARVRKRKAPI**VFGRCRGRL*KTETAGHGQEEETRFVIEPSFESA
TTRIQ*SR*HHGR*RQRRG*GQCRGRIQGGNCRRTGMELR*KQRCGV*WYRHQEARQG*F
AMQYNHPVEGCRRWKSTVLAQLSYLDRYANGLR**RGLFDLQVHFDQQSVCYGTNRGSRW
FQRCRRQQ*RE*Q*KRCW*R*WRRGKYSKG*ARIG*SEARFTLTKGIGYKRRAPPLDECC
ANREQTGITPTAHHPRLYN*SFQRYHLWCYHLGCRCVAHSPPASTPAKFTKRGRNRC*RH
SKTT*NHKACLAVEL*CSKIPVFPRTVFASKRNADSLLMVFQAKRACAAGRPILQ*RCCK
NE*HIQ*QQQ*QVTNGQYLTTVLPRKTITSLYDLILSAIIARLLVSSDRANKRVITTRK*
KKMKNFRQNV*SFLSITYTRFFNTIYIVYLIFFHLVV*QQIFVLRRPPSLTPMPNASQVY
RSTRSSSPKTISFEEAIIQGLATDGGLFIPPTIPQVDQATLFNDWSKLSFQDLAFAIMRL
YIAQEEIPDADLKDLIKRSYSTFRSDEVTPLVQNVTGDKENLHILELFHGPTYAFKDVAL
QFVGNLFEYFLQRTNANLPEGEKKQITVVGATSGDTGSAAIYGLRGKKDVSVFILYPTGR
ISPIQEEQMTTVPDENVQTLSVTGTFDNCQDIVKAIFGDKEFNSKHNVGAVNSINWARIL
AQMTYYFYSFFQATNGKDSKKVKFVVPSGNFGDILAGYFAKKMGLPIEKLAIATNENDIL
DRFLKSGLYERSDKVAATLSPAMDILISSNFERLLWYLAREYLANGDDLKAGEIVNNWFQ
ELKTNGKFQVDKSIIEGASKDFTSERVSNEETSETIKKIYESSVNPKHYILDPHTAVGVC
ATERLIAKDNDKSIQYISLSTAHPAKFADAVNNALSGFSNYSFEKDVLPEELKKLSTLKK
KLKFIERADVELVKNAIEEELAKMKL*DLPF**IYFILYNI*NSIINREYEVRLSLMLIK
VNHDCESKEP*N*SSSMLIISEFSFPGSSSLDTNLTFPPFSTDISNPALLNASS*TTS*A
SIFLTYS*FLALFFNKNFKQTIDLSLINGSLSSMTQLERINARPPNSLI*SWISGCAYTN
DANISIITNLQWGKLSALIKDSLVLTRLKINNRSSILLPS*SVILISFTVSPFPFKKLIL
NKFFWKVSKRDTNIFTESYEIKNFLT*LNLHKSEIMSRQESKVECNWMATEGA*SLQLLL
KKAGISLHARRCRMG*HHDIIAVNS*VFQSSLLVTTNCNICNKVVNFPGCLSSNPLRYLP
KEAVVRLLLIHSKTDRSIEVISNFESSR*FLPFSIKKEFS*SWMNLAVTISKNILSLTQ*
*SFWGVSLSLKNSLENSSLLRYVLKRNKYGSQKCSSSSPSSNLIP*GY*RNCKRAGKVVI
STVE*FCCILKRHVKHAMYRCLISGVSTTYSLVACRKPRITRFCSKSFWGISWFSAARFL
IIKIRPLTVLVYGIELFSFNDAGNSIASKVSLNRSQKSWELAIDFLCSSSLNVL*NIRFR
FSTIGS*SSTQHGSFFIMVMIESNKLNSSRKLFIGIVI*LSSFLMNQ*FYKA*CNCSPDD
SMKR*SINLCQIFSSSHQFFIFSLPIFFFTEAMMPYI*GK*PRQSKDDSRNGSLSLY*AL
SS*CISILAMIFFFVDIKYKCNALYSSILGEYMM*MCINRGQ*IFFKEALSHFLLHHWNH
FH*TRVICYPSH*NQSILPRRQIP*LHRSLRSLRYLHLRHLLIEPRHHQPRHLPWTHQLI
PKIYRCICYQ*WY*LLP*PL*Q*IFVSTS*PSRRDICVHLCNHRSQIIEL*SKLG*TQCV
GIQWQNHR*TSESSVNILQEYYLQPRGFP**VWLHRLY*SNILHLT*TPLLMHLKTAFLV
APLQ*NGG*RPHPDQRDQIISCHWWNISINLPLKQRQMHSPLGRIAPK*L*PLVSFFLWT
GRHLFETLVKNYQYDPPNLNFRLHRQSNLMNLLQSFSYCLKIREYHSKPCFWTQ*IFLTR
LHLEHHIDKWSYYYHQPQ*PYHQNCNVL**KIWIVQNFWQ*TYLD*TYQILYPFYSQCCP
PAWHLLC*KWIFDPLR*ILQLLYHLVSLIRLKHRNKLL*VLLVGFYQIWTRF*LFYPMMQ
KLRHCSLD*MKDTKQGLHVRTKHLIIDQFARTKHECQNCPGTRHKPLHLMDPPLNN*IGF
FQYQ*MF*NYDT*LSPTLSPYHLTMMRT*PDPFSQTVQQ*LKRCVLQKWPNKTLM*CPKL
*FSHLRMLSLHVNHPESMQDYLWNRNGPAASRYTIPIAIRKLVIGPVCWNQTPAIRRFG*
R*RC*LGFAP*KAVESK*NQANRKDGIPH**IRQLKALLLDGR*HTLLWLGLRKKNVSL*
FSSCISKYLLLLACRRLHFHCRRHRMASW*IPRQRQHRLCLQCRFFPDHD*RTHP*RSLC
AH*MLSPQGSFPLNLRTIFLRLSLWKS*G*IWNLVTTSKTLCLESVPHAPYGGRREQTVC
LY*HLESSKSVKTCLRLMQRVSHQG*TSQRSIFL*S*NGEARYGL*N*QGWRDRPRQ*KS
AMCLVCSDQWQQYFCDARIQT*TICC*LSQTR*PYSPPVRVVACHHRKR*CYLACRPYLK
G*RT*NRISLGCGSICGLLSCLPVENDTIITIIDIILVIVHT*NYTRNFFFFHLSAHRKI
FPKNFKKNSRRM*SRLQVLDIIIMITSRSRP*QQLLLP*N*CV*TGRDLCGHRRTNGPPQ
R*RSTHP*W**GAAFWSRRPFHRHHRNLDMLPQSHPA*FAMHS*HGLPYASWSRSSVGLA
WQTLVPRR*HVLQRP*KSSLYQ*WGPTRSSPRRGLWECHSAGPVLSPPLVQRTRHRRVL*
GSQIDRQIRGGKQSPSLPGTNAEGTWYRRDRA*PKKCRHQLR*H*EPPRRGSVSGRRSAV
SCIHAAALSQR*CFRLPASWREDPDRWPRRPPVLRPTVRDRHPLSFSFLSLFFFLLHIPI
YMYIYLYIYISQRI*LHKTQFS*TVFSFQHCERESNGKEHEPI*KAEGTGQFFVQTGPVS
RGCALL*PTNYCSTAEPGRVQQQSHGADQTG*IYTGYSNVPARTAVHLNGRACSYQIQIA
ISSRAGTGSGRFSTDPCCRG**TTGGIRPVLRKEKGNTSNLSLKLYIYIYIYVCLYTLWV
FPCIWLIIVVSCQFFLCFSSRVNFLPREKQYKVSLLYRRIKQTKIKSTS*RQENTANTKY
HNNTTIIYTQVFCRLKLRFS*YETIHPWFFSFLNTYLPCKEFPAHLCGHTVHVLATNGTK
ATYLAYCNVHYIDENLYLGFTTRE*LRSTIHDIEKSVTTKHGKLAAEDRYFCHRSQFSFP
RSSSRFFCSGFFLPALSGPFWL*GEWQRR*TLRSIRILARVLSIV*FASICFALYS*YPN
QKQNSESNGAFCFNFKFIRLRGDACHGP**HGHGHGYGHGYGHEYRYDNVSIHRCLIHGF
NRPRAT*TKTFAWPSYTAIALAYPCGEIVLGKLQHHNLLYYTGWE*VCPSLPHYYAALGC
ICALPCVPGAKRRPF*VVLTPAVC*SMHLYFVRNGIVRVQKYFPGRRLVCA*YLWHHFCA
TSRFYACSLLRCGAFCPRLISIEKGVPSG*HHPSE*S*IYARHGE*CTWLSKSFFQQRHV
VLALFRHHDRHGHQ***TETR*RRRRG**HLQPRHFARRRLR***RRNCFH*SATSASSR
HTRFPNLVYQHEVPDACRAPLVRRQRGLSHAYLPAIHVHLCRPNHRLRCR*LARQGHPHL
*SLGPLD*GRRIFYSGRCLFSKILRFRS*VRLGMEQHQLHLSTHTNAFLQSSFPVCSCGD
FHHGIR*ILPHFLLRVHQHLLGAPGRKRRRMDCQGFTACVDRVYVHRNRIVWATHGVQAQ
PLAIRACPQTATDRCSCCHTGVLSKPVPRFHHILDWDSDVPARTVLAIFYYHSHAMGILV
VLWVLLPSANIFDSVFGAQHQQCRIQAFHGVDHLVLSPLWWSGIYGVHGSVH*SHGI*GV
YPHVHFQPQCWIRFFVDGLGNDFIYLERLAHQNQENQSLTAIMAFLFSFFFHPPLIFE*E
AYMLYFSSPTF*FLIISLSSIQSILNALSLPQNL*K*ISKISLELSSMTIIEGPYLIKVN
ILCIMTLLEVLSENVK*STKDMKISYST*CIISSSFLFSFFSFSTHHPTYAKLLYCLGSV
KKRLETCIKPTALNHNFKSKWHYGRVVKARDSNGIKSSAISWALPALVQILLVSFNFF*I
TSLIKTILFTAVTDLAHLQPVQDQSHALW*EL*R*YCVGS*THSTFVVHNGK*NTEKKRK
IFLGTHHQCKHLYSRQD*QSSPHKTTCRA*RPEDPSLHLTGSKKSSQPSQISKSNSEMPK
RTSRLSSQQSPMSSSGR*CNSTTSALDTYILCTTRERPSPKTFTIG**RKSMLINC*LPN
GAKPGMKNCAVCAAFKRTKLTTVALASAGCLVHS*RKKHAKRAHRCPSISASTAAAVDVQ
AQTNDYMHVAVLFWPCNYLSPNVLEEVFVSFVKDDHFPILVIGTRKNKTDARTRREKIYF
SVFFFFRNKDNALKPVDVIRI*NTD*NASSFKIKKLLLLLPYGAL*SFSNFKYMLHD*LK
II*SIS*QRFQRFKSYSILFPPFIIVTSTI*ASFIDRNYLLFRSKKKKNQQKFQLFNDE*
RHIHH*WP**FFNGKKHRAINPSQENTRRRKGNDYSPELNCEKNNEGSK*EAVASPLTGS
LVPNCSI*GQAPKIGHMRSVQW*PNLGRNSSIFGKKKNKW*TRQETSIFVCNFDLLGHFA
ISGGKANAIPDISLDPRSLPLLQAERC*LAKFNKT*LVFK*CVHQD*KVLRW*GSFLGGQ
TGCRNKIFQR*KSWL*ICKGLLTRHWEVF*NRFYT**IRTS*EWRRQ**SS*RGRKRGSR
EIPFH*NSIELLPYTESFPVTSHTAIENRQQCTEPSRKPRIDAEHDRKRCQQYRFLGTSL
CHEEISYFFRLTVAGECQRSFPGGCEKQ*YHPGK*I*YTPYN*RKVSSEFQKIFHLIQFK
F*RFISTSK*CRGWFSTRPTSVFPIEAVRSEKSCAHVETTISAIIFQFSTSTSTFLSWFG
LT*NTQDEAFRWLRENPIAVDKHT*GR*LDFEEMADSFTPF*RFVLFSAI*SYRDSNQVY
HDAGGHFGNPNFTKKVLCTRCPHKRNEFQICFKRAVWRGCLFCLEARN*KDF*W*QYYG*
QSKTSSLS*SPFQR*R**KELTFFFFFFHFLFLTEN*LFLI*WIHRKRLDES*TGLELSY
HIAFSF*SYCIVGSTNFFSRSSMV*SIAEEAGKNCNHNKNDTNFFSKFYILHIFIFDPYG
FLIQYLAEVSIHFTYLFDLFYFYLPRCLAFFNRK*KTKYHLSNATLEEKPSASEHHSY*E
KAIFTTHGPPNNHCKRLHDYFNTEPVPIGYTFEMSHL*RFSKSPRLNTLWPYILFPLY*N
TFE*PTKLSSLPFRVQRVLAEK*VPGQ*NNSKLYIPTIFLTRCTKDTEAYPCP*E*GSTR
S*KFFMDRTHIRV*K*QCKCR***LANCCNK*KKTCQKIHD*YITTEFQTIQKEFCNVQK
*TYQEKIKAK*TNGPVPHMSTILSS*SP*KNTFG*MPNFTITRQKTKNFYHFPYRVKST*
QKFIQIQGTNSRSRQKLMW*DLTCG*VFKLNDECRTPKIAEDQFYVYDSIPNKTKTVIVG
TVN*WY*AKHD*KIQSLRNALEF*FL*FSRTC**S*TKKTVVKLGCFTQ*NPPK**QQGW
NF*INDNEE*WEIFFI*EIT*KFQKR*I**ERMDGYVSEGFC*AYQGSKNENKNRFIGQF
RFSGTF**WRWC*KSSK*PGNRGSANGEGSGHCYQRR*SCW*KKFA*RRFN*C*LIKRIN
GLE*I**RPTR*QLRCVYVIRPVC*LVHIC*LIIYLKMGKI*MHKR*HRDMCTKLCNHI*
H*YILFRYSQFVMKASVVYGSCYCIIIVDNVCIRIIIQRCCNCLRRGHWIRQRSDLHVKC
*NNFTR*RDVFGNIYRTRCLHFRRKHSGNRSIYIFADFVAYPKRFR*IF**LYFYHYFFL
YKS*CIN*TSRYFVRATYKRWCCCGYTWHRLSYCA*RALHG*SSLAYIRQSAN*STTTTK
DHRCHRSPFNICGF**GRLTNTRLR*LYSISENTSGFRTVSQNTSGFRIVSQNTSGFQIV
SQHTGVFRIINQGTGAF*ILGRESNYSRSLRFCF*E*ASCRLHNS**NRFRDGMKFRKSG
I*D*RD*FRSKNRRSYSRYFY*LEARGYR*IRKCTRMRGNRVLGC*C*QNFFIWDQIRRN
*VKFGCYRNRMRRCFNHTL*F*CYGINFGDGRRNHSVCGRQQH*RRCCNILLGFCIGI*C
RYIPILNFCNDFSDYFCLINLSRGCRF*VV*KRCVGCIIGGVCLCGGNRSRGTCG*CCSR
ASC*R*GKR**R*R*RRHV**RR*FST*EF*NAFSICCYFAF*LFYY*RGQFLLQVRSRL
RIFCDRI*R*G*QIYRL*IQWKRWFFDNIRFCRRG*RLRNFRGR*RHNWFISDTLFIERR
RRRRRRRRS*CWDICRSEL*IS**RYPNKFLLIFCGGSHSASVK*GKFSLYIASNICSAD
DICTFSNASVIVINSEIRRRSLVYGSVFLEFRLIYIMSMFVNKAVHIMFVA*LNSASQNH
*QNKIQEKFPNIS*N**RCTGKLQNVDRVPHRSACQISRIWRKSNFCYSRFMYSWNQLNK
L*LFNADDGNQVIVR**CNELLIWGDIHRCYSIQIEHEGCCF*NFNTFGTHT*F*QGNSI
RVR**CCH**RIVIEKPDIRKNKIFIKIRFPCYKISVPNRRYFQRIRSDI*QKNTVRGEV
QIINFPTRFNFVIFRQITRVNDSYHSGHFRGRNCSYCGPLINVNKLSENGWVCSSVEINT
GHEF*MFLFKHKLPQVVVNVLHGGIIKQFIATN*NQVIITIQ*SGRIVNRI*CDLTKPSN
VFLFLEVHL*SCNFVWKRGIELASTTSHQ*SAFIYKFSTIYRISDVIVCRVATHYYASFS
KFKRREKKGREDVS*GIVMLVDKQPPSIEAAISVGYLKRSQFSFTLYNSRDINENYYNQE
KRTGGLKG**NRAVTNVVKNTRAQNC*VRA*QM*HNTK*TGYRLIIIKVI*IVNT*AGPY
TLTCVVTNVQQIDLLIKYIPGRIL*GFFFFSIAVTFFFFSYQSQI**A*HRKENNDRAKG
KAFPVEYSISTILLFAEDSRFRKKVIV*SQLPAPLFNST**ESVDIDELSLLHKTSLKAL
FLSFKGF*DTQISVNLLDKSKKVRRCSENCYRD*ELI*ALQLKETREIFY*MLHKSPSRK
RFASPLHLGCILTLTVLCLIAYYFALPDYLSVGKSSSRGAMDQKSDGTFRLKSIYRHGVG
ANHRLHQRLEVTPEVISAAGMLYQETTTQGQDFEDQEPLWTTNAEYATTNPFDFEFELRR
MPLLMKRMKERDPEFIESYIYGETYMTEEEEHAMWIDDDIVAPNITDRGTVVSLALMSSN
AYVRIPQTGDWRNVTEPWNETEPEDFGWDGDGIRGHVFYNEVENIVVLSIKGTSAQGLPG
SGEDETTGNDKINDNLLFSCCCARVSYLWTTVCDCYVKSYICDESCLEKELRRKDRFYSA
VVDIYKGVLKEYPDAAIWVTGHSLGGALASLLGRTFGLPAVAFESPGELLPSKRLHLPFP
PGLPSYMEGIWHFGHNADPIFMGTCNGASSSCSLVGYAMETACHTGRVCVYDVVNDKGWS
VNMFNHRIHKVIDEVLLGYEQAAKCVEPEPCVDCYNWKFIPSRDWESSSRLITKTKSHAA
PTTTTRTTATTTSSSTCVGRNWLGFCTKYEL*DPYIYYDPSVVLGPMRPFFLPLSDK*CI
ILTT*RFS*TTREDILILL*SERRQSGAINRSHILCFNCSLANSHTRRLEDRRK*IDFRI
SSATTCG*NPCCSACTP*YSAKSTLHLHQGSRLPPRMLIFRKNMSPVPPPHIVE*SLSNT
LIPFRSR*KRRI*LLSCTVLSCPKL*TTLLCWPMVLRQLSKGKIPMIYILTRTVRPKSTR
FTLTSISRVVWLPQMWVLSPSMGPNLMTKTFT*NMTGLKDSQWPILDLILTPRNSSSPLK
PMEMRNWMAKVSCLVK*LLV*IN*WMLFNTQKQTNMESLSMNYGSCISF*KS*KLVTS*I
CTLRTQKKSRSLEMAMCLLAPLWKTSSVTIKPTHL*PPPLEPPPMI*TTQFPEP*CV*LF
LAFVSLPTRACTKSLIRFH*DTSKQLLFDGLMTTWL*F*LIYIHDNYFFIH*RYLKFLG*
YPFDSLYCIALDNNFFRLHHHRP*FFGYERQLLLQVIS*LNYISFNLSDLRDNLVTSIFI
SGIHR*ISGPASLHVVGLFTKIVVSYELMHLHVFQLWKYWRLSSFI*ISGYTSYRLVYRG
SGRPWKAFTPTKTSSNTRTDHSFAHTLPWSKLL*VNGHFFQKVFLLAGAILLIVPYFKFI
PSHSYAMTIIDRPCDTIIFNIQKEKNAVLYHSYIIFICACMLLVFAHNSMRPQSYHLVFP
TTTHSFTVDTPVDGINFVFMTREVNRKFSSSYIPHFQRGIFGT*HQ*SAVR*PRNLVYAG
YMPSKCGDKLTISTVPKFDRVIKRR*DNIPTIRAERHMID*FLVTGHSCYRLGRF*WVP*
KHGIIIACSNHHFF*ISILFTDFFIIFQCLFLGFFWCRRLLTCMIECTNAQCVICR*R*V
INPVRMRLQNVDTSALRIDVPYTYGSIVRATIQ*TLAAPFDTRH*ICVTTHRILANSAHS
VPNLNSTILRR*S*SWFGARLHKMYRFPT*RSDPLGMTSESIT*TLTAFWVP*SYGIVHG
SRSNYFSIGGPGNAENPIVVTL*SMHWRLGVTVPNPCSIITCTGYHPRTRMWCEGRTQNC
GTVTCNG**TSSYRLDFENCSWRIQ*RDLIFCTVIAWFY**RI*VICYINRLHRVTGLLT
LNCTAEGIWHWIV*STVQLI*KFF*LFLGDSTGNSQGATYIVTSI*SLELD*NIG*IFRN
NSYFSGKLSLFLLFLRRWRNQGGHLYIVLVCVYRGYKYKNLVIYVF*RYSF*SSSHFFFF
FHFKIFHRFLG*QL*MKSCLHHHY*ITLHYIS*YIIFLDVDHSMSLG*VLDLSLSCQMLF
HGFVSSKGLSVVPQQ*PS*WGLEPNTFPRRLFPLQSFRLYWVVAVFDLQQRGT*WPIHYP
S*TKVVYLWPFLAQHILMPIHRPLQVFP*LPSLK*SLEPYTSVSPSFH*GTLFLLQNLER
LRSAQF*S*ILQRYVPYQNPHIL*FH*NPARYSPV*CRDAPRQIGANMPNLLIVRMCTLV
LPFHLQFFHDPITRLKNHPHSIP*RC*LYRDVLRHHSTGQY*DGLTFPIRSSLL*SGEKS
SSLLWYRVSLFP*QLRFHRFPD*LQSIPVQMFHRQ*SFFFATSLIHSIMRMLAIVGICFP
DL*HPIPYPFAWDSSS*SFPTSL*LPVSTCCLFLGWPLHQYSLQYQYSILPVACHFQLQW
LVHP*RRNVKLIMTYILIPSPSVLEIALHSAPGYYNH*SSASQNPLQERTIGKFADR*DH
TLQQGISTSSFLI*PSER**RTSSLS*RRYI*GNFFQNPFQT*ISNLTTHFPDIAS*SYL
EFLCSCSILYK*VCNMPY*FFVGRIQLN*VNNVSL*MKQNHLPFD*TCRFDKSVHN*NLD
*VKSTYLGYQFSLNPFRWMQKGCYLEAYILVHPKLLALQDIVQLVHPMSSKQLPIQKLHC
SFHQGADQKGLLKNSSFWTDEHACPNHLTNLLLLGSKEFLWNPPLSILECSNLFLLLLYH
THSNYFQCQALGPNHSQWIYFAKFLRWYHCHNLIIQEQQTYIHH*TQKCYRSIPKNSEHL
LTF*QVVHYD*SDKQQNFGTP*LEYC*TCSAFFSWHPNFRKWNLAIFLLLKR*QMLVGSF
VVSKDRIAIYVRVSKLT*EIHLESRFLHR*YSDRCFLGDPSISRVDRVL*NFVYWNQSTL
NSTEKINNEWLLLQYFRTSGQNPHRTANWSNILSVCTSIAQKVE*KR*NHRSFDRSSSLL
DF*AFVHMTI*SK*LL*LNRRGTPVVILTFHKDILCSSLSKFLCRL*NVVSV*TSKVIAD
RKFFFGI*TRCSFPSSIVLQESSFCSSIGAHHQNPLGNYPNYLSVRNGLSSRPTLASSTL
SSF*SSAKNSLRLF*R*ILQYW*LVYPYTFFSS*ANKRQRCDICS*GLVRWPPVHPGSIS
CPVEFETSLSLQKRNLNYLLNM*ATVPSLAWSSHSAMPSIRAISHLRAPYLTLVS*LG*Q
SSSFHL*QYLPSALWPALTAI*TVRSQFHSKLVHHCLTSFSCNKV*WRKT*HLSAGLHQF
CRH*TTE*FRHHRRLPRSG**VLCPSCSSHLKRSFLAFSSIAIH*KRIGP*KSADWGRRL
LFPSHPMLSNQILIVYGWNDLIISSRAYLRWYEEPELSRLQPLFVAVYSVYPSSFSPTRN
YLL*PP*VKQH*LSILNSYRMLLLLFLSYCSWHRFFT*GTKAREKTREIFNSRHRVNTKY
VKV*FPKNEENVIRHPGEIRFK*GGRYRGFPNKFQ***WHHHRHIQCRYGLEQKAICSKT
I*LRRYPRYSRFTSFQTWQRP*LTM*STRKTVHWLQRTRGNTLFPTSA*MHWI*RERPLA
KAQHLPRKGKVVAVVVAVVAVSPKRRNGSRLLSPVGH*SKCYTKVC*NETMYGGETGTFT
LQTRDLYPSARMKAIMDAPKGRFWT**TRRSMELRRCTTLTSH*LTTRKNALITMKRC*S
AGLPVEIPSNFRCSTCSCLVVPPMVISHHSSLTSRTIYVRNLHGWCPWRTLLVGPRPEFR
*LYL*SAILTGLLSLSKVQPRRPSSRPLWKGLKRAYLAVLSTKVLLVVYHGLLTTMLLRT
SSSPKKSINSTKVCLFKPCMCVHTYIHTYIHTYIYLCIFMYIYIYIYMRNYADFSLCATA
GTLTPDHGLEIDIQTTA**R*S*ILKLPLTVPLFQNLSRTYPD*NLDR*TTAKSIGAARR
YRQ*HLETHPEWGNNP*IFLSSYASLVGCT*LVTSIF*VKTNCCNTPEFLSYANRTSSWS
T*IVRLAVKKWPVMRVKSLGTMDSSCGDLYLEIARFSLQLPPGSIRQHSSSTHAGNTRNQ
IASTWACPSQTHHPSFSSSTIAKIWI*PGKSNLPYLT*QNPSISRSLTYGANW*LSVDTS
ISTMT*HTRYLVYRLTTPFCFAFAFVCF*FFFPCLHMETHLKISRLSKNIKDSAIKGQYH
NLKPNHLNQIKDGSGKTI*Y*GNHCFRYSR*RYRVYRRGQSKDRRYR*FIESYAGCRRFC
SSSRRFATRTPVQTQ*YHFSCIYQRSINSFLPFRHSYVCILSKN*ISQ*TKY*NKHPFK*
SQILTLQIRRILNLQIRQIQDQMVRRTWIQASILAAYLPVLGQVFYLDRKSYRLGYLDSP
EDWEALQTNPDGLCQQDTDHHPHTLLLG*RSSVQLP*VRDMGSTVLFPGFVLLVPGTHRQ
ILACPHYLQFVF*VVSL*VSGLAPQVSFLFLVAISILWAI*NRCNPPHMPW*STYHDE*Q
QYTCHCHPESESPLAQRETMLNPSHWENL*CENSLGMIWFPLYGVTPPQFYRWTPTLVLL
PVQPYSQSLFNSCVTMVVLLMLIRVFYEKKRITNLYKLI*KHIQ*MIYKG*EIKNKGEKK
IHA*VH*NYRKNLTLVLIFHHRDTPTP*RLGTNSNLGIVSLYYK**ILTLCLILETSEVI
HSILSLSFVRSPPR**WQRFHHVLHQ**FSGGLAFHLVLN*LGTAKCMLHP*TCHFVNA*
CGRYIPLEGKSAESYFPMK*IIYHKSHSMWRFQERKEY*ILMNLA*LMRHEKSKW*SNLD
QFWRWSRTKRCCF*LTVATDP*FR*NWSY*TKTRQ*SLI*SFGTDRLSSIVSKLVLV*SC
RNSI**FASVIIH*RFFAGFSIFAAYPRN*KF*A*S*YLYQMIASK*KGLRHMNCRRCEG
PPTLQCCQFAGHSSS*LPSLKSLHKLFQLTQE*IFCPQICSNLWHHYRC*TRMKIFFFA*
KQQQRQKSP*RRTLKRPSPRWSESQ*RLLAHRGQKAVVWGSAVVFLDSCCSKWKRFCPEP
CLLAYYPG*SYQQPLVDPST*KVFP*PQ*QPFLLDFAFSVGQYRFSYSDHRVCVQNVPNT
P*QSNLCWIRT*YRLFG*SCRPGSRNPHCKGPQ*QFETTDIW**SPYHEESLNLSISRFS
PLWHDESANVFALQATNLSSICVHFAEAF*LRQPQGLEKECWTYRWVKAKLELELVQDPL
AFDSYSH*RQEVEVEAQIVRDLVDPTQAALEIAAEADPVGDPVDDPWRGNS*TVAAFDVV
VFPSLASTRLAVGGPFAAEQEPEPLYFGVKAPLLEVVQ*TTKIPLASGLEVLLLPFHRS*
GR*FLLQ*LQHMI*PWHRRHYHQLRCRCCRCCEDFQNQSRYQPEHYHQMFRRSNSRSPQV
RARHSPCNSLQSPEDHPAHYRYFLTQRRTLLVLLAALTSG*NLCFLQGVHVSFHSPCFFL
*KEEEEKKNFV*CEKNK*GSDNNSINNRLQSGQLSIRRGEFDAAGECLCVLQAVAKCWAE
AGLVTGSSRVRGSRHE*DQPVREPGQLLH*NDAVVA*CVWKCPELLCIRWPWGERCATVT
VVSR*IVQ*PGFP*TLLGQAGLEEVGTGICKKVSRGKLLET*AVHV*KILQQVYKELQLE
TRTAADEGGR*CDPWTKWWQDDF**NGEYY*QNCTAH*ARPSAIVLRVCQVRSRPMLRPG
HRSGVHSVVHISISV**SECTH**GERR*LVDHIALWIAQTHCHAGGRL*DHPLRSRRDC
TRINNNSPHQFQ*GTTPFEHRPFSIGPRRLWRDKVFE*FRQH*IVW*CRWETVWYI**AG
YFLVSCRKYLAFAAI*KVEAALQW**MLPGACHRRHHQ*TCRPRGC*PHHLYGELLGTEK
GDSSICCRGDNQIYSGNSH*TLRQRHLRGG*AFQLGQLAQC*QNWPPKRNQTNECTI*RN
KIKLNTPLGGNKS*IIIFCIFFLPFISMYTYILLFIFFIAHFKHLSEKMLRFLMLIERLK
KGL*R*ANNAMNNGSGRYLLTPPDDLHPYVPSSKPQEQVYPDFKPWEHTAAEDQILANFV
AKGFYHTPMVNFESISARSSVHESLVTQSNILSQQFDKIIKIREDHINKIPSNSTTTLHG
PGFQLPNRITLTDHRKETWLHELSSSHTSLVKIGKFIPHGLKRRQVIEQCYLKFIPLKRA
IWLIKCCYFIEWKSNHKKKRSNAAGADDAISMHLLKDWTDTFVYILEKLIFDMTNHYNDS
QQLRTWKRQISYFLKLLGNCYSLRLINKEIFHHWLVEFINKMENFEFLPLSLHILMIFWN
DICQIDTNAPVAATITSSQKEPFFLVTKITDMLLHKYYIVSSSKSMINDENYIINDIKKN
NKIKLNILKILSSLILKIFQEQSLEVFIFPTSNWEIYKPLLFEIVSNADTNQNSDMKKKL
ELISYRNESLKNNSSIRNVIMSASNANDFQLTIVTCKQFPKLSCIQLNCIDTQFTKLLDD
NPTEFDWPTYVDQNPLTMHKIIQLILWSIHPSRQFDHYESNQLVAKLLLLRINSTDEDLH
EFQIEDAIWSLVFQLAKNFSAQKRVVSYMMPSLYRLLNILITYGIIKVPTYIRKLISSGL
LYLQDSNDKFVHVQLLINLKISPLMKSQYNMVLRNVMEYDVKFYEIFNFDQLVEITEQIK
MRILSNDITNLQLSKTPLSIKIMVAEWYLSHLCSGILSSVNRTVLLKIFKIFCIDLEVFH
HFFKWIEFIVYHQLLSDIESLEALMDILLCYQKLFSQFINDHILFTKTFIFIYKKVLKEK
DVPAYNVTSFMPFWKFFMKNFPFVLKVDNDLRIELQSVYNDEKLKTEKLKNDKSEVLKVY
SMINNSNQAVGQTWNFPEVFQVNIRFLLHNSEIIDTNTSKQFQKARNNVMLLIATNLKEY
NKFMSIFLKRKDFTNKNLIQLISLKLLTFEVTQNVLGLEYIIRLLPINLENNDGSYGLFL
KYHKEQFIKSNFEKILLTCYELEKKYHGNECEINYYEILLKILITYGSSPKLLATSTKII
MLLLNDSVENSSNILEDILYYSTCPSETDLNDIPLGSGQPDNDTVVTNDDKSDDDDHTVD
EIDHVEYYVMMDFANLWVFQAFTCFCIKKIMENNEPAMAMEDLKNFIFQIIEITNSNDLC
SQIFDQLKDMQTIEMITQIVEKDFCTSCLQNNNQKIDDNYIVVVIEIITSLSMRFQRETS
GMIVISMENYHLLIKIIRQLSELNEGNLSKREIQIDAVLKIFSFHQDSIFQRIIADLSAD
KPTSPFIDSICKLFDKISFNLRLKLFLYEILSSLKSFAIYSSTIDAPAFHTSGKVELPKK
LLNLPPFQVSSFVKETKLHSGDYGEEEDADQEESFSLNLGIGIVEIAHENEQKWLIYDKK
DHKYVCTFSMEPYHFISNYNTKYTDDMATGSNDTTAFNDSCVNLSLFDARFERKNPH*SQ
NISKWINYKFTNNSNYVSVLIPNQLIPLNDTVPNDMFATDYKTGVYERWLRRIKTKCSSA
YKISTSVYQSI*TGMITPKGTHDAVAKFQKTDLHQDLDYIVLQQRRTQLETLINERESFV
KNLCSLFHKIQNTKNYQEFVDVLAENRDLLREIFTVENGFQKQKWISNDDIPQIDWDKFA
LDINAYIAENDQLLALYEDGLL*SNSGYGHF*TYIYIYIHICVYCINHKEEQRPRYSDPK
YYV*VTGWGSCTFFTIF*FQMWIVLLQILLPSIL*WKKLPR*DIK*ASPLTKESRIG*YI
EKPKLLCCSISL**GWR*DR*KA*DSSPHTPVLLN*RT*QNLGI*SSKMIN*SSIFMLLG
VAPVR*CNHT*RN*FRLIQM*DLSSATWTNHQILPKSVK*RLCPPLFLARMANSSARSLE
LTLLL*RRESKIYKFYIHEHM*FFFF*F*I*EKR*YIYIYIYIYI*KESKLIQYTNKFIS
KNNEPQYSETQEKEGKG*MVRKVTVCFKAYLDHNITNK*IKKNREKDIMTMN*RIV*LVT
FVKCSFCVLFLIWRYFFILPNPCFTITATSSKNVIFWTQRRPVCHSHRYN*IPMTLQHQ*
RIAGFLIPKQDTTIFGTGQDVLIILCGGHGQYKVFMPDIRNFTSAGIWSFRIALVVCILQ
IPELNRSI**AGYNALSISSEDNAINRVLVACTGFVFRI*SFHQESGLGIPNSHSTI*RT
SSDVFTITW*YSDGGNTIFNG*SQ*TLACT*VPNTNGTVTRTGD*FVT*GKVVQ*INILF
VALKNHNNLSIFNIPNSNQSVFSTCCQKFPIWRKTH*TDIQVG*WGRRSVQVFHIFCQFC
CRSHRCGSNCGGSSGCHCIVIRGRGGVIFSDRISMVIGSRIVR*TGHQRTI*NAIHLSSF
VAACG*VFTIVTELHATNN*SMIQRFV*LNVNFSW*CRVV*NIIIICLLLQSIGNRLGI*
IQKERWDRFRVVCSLIIRD*VVILVQTSRGGVFLLRFDFSFSCGGSGGRGGGSGVIYLRG
IIIFRFSFFQRRFRCLDRG*SSGLFRSRRSVDGCVTQWCHGNLGRWLLLLKLLLLQLLLW
*LLLGV*GHHRQSGGRQL*ANQIRTASLYWEGRWRTSSCVCCWSGGGRSSSRWLLRNWNR
CRCSG*LLLLLL*MLLDLLLLLLLPLLLDGQRCNLMVSLLQP*FQVLDLFFVRVLHFPVS
*FQFVDGVSYLLHLSQLLVHFEIVILLVLKTVGICLL*DLEKLLSDGIEKLIQLILRIRN
AGSHIGLDGKLISFFPCLSKKTKKQ*KKSSGVRKVTWRERKLNNCRRTDRGARVQPVVLA
SLMFINWG*MGEFLSICLLMYLLFCFVVCCFDGRAF*FFRSFSVFFEKYEKLRSVGSDNV
RGFCL*KC*GESSKKLLTPRLLSQKEG*IRAFLVYLFVYVVLIYICLCLFMYK**CLQ*N
ICYAIKNVSALFYS*RSYNG*RSDLRPGNAW*N*ISILRIIYCI*YSVPHSTGVKSEEGR
PHYGSPYSVHPLRSSRIISFYFVYASISCICLH*KMIGKRSH*NQNSEEADRQEGH*IDK
QEQ*KKESETRQSNVRKMDPLTVYKNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEI
KQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQG
THSGGSSDDYSIMDYKLGFVKGQAQVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSF
PLSSLNQFYNKIAKSLNKKREKKDETE*AAT*CLYIYT*NSDYSFAYLICPSESTTRLFK
KVFFAPLSFMVFKILYNDLPL*SSIPFEVFSTFSAFLITGFSTFFAGVATGWCWCCFCCC
FCCCFCFCFLLPLYNAFWYFSSSLMQDV*FL*LTPSSNVLEQSMHV*YALGHL**CFSVF
FLGTVSLHTSQLNVTIL**QIFLD*DRLLLYTEYS*SSSQVKNFQFFFTFSRQGKKQPKE
NEPLFLIYLL*DAASPLICINVVVTKLIFRRYFDISVHESTYFRKLNETVNSSQYPVSNG
GKRHSFSIGF*SFSSIIRPRGTLVFALLCNH*CISV*MCVTWPCVSYFHLFFHNAENLD*
SRKKGYNRSIPYWIVQSINKQSHNRTYIHAHTYQSQWLWNLLIILLTRERSTQST*RLSE
APILTPPG*LFHPMRKKNTNLSLPVPPFTISCNCLMKPRSSTDWHVCPHQGQTLRRLLSL
VGVLILRH*RQGPLSPPILLQLLIICSRVTTFKLPPETRTILTKMNC**KSVTRPVPVIL
FRLPPSNRGRLPLLP*RNPSHLPRALLQFLRRNQSRLLPQHLLLRFLPVLTTTMTTTIGM
SLN*RNATSIRLP*NQINHLTNQLAKSTCKK*LLKKRLRRTHVLFKSQPLLVPRLILVLI
SLI*RTNQN*RGTPSLTPFWAPLNPPP*RNLH*RMMMIKSLRVLETRNHLLNYGPKERQS
KTAATPKLRLRHQNLKFQKMSLKVNLTSKI*NQNLKDWPLQKKRRKKWKTNLLLLQRNQN
QLLSHQNPSPSHKNL*KLKKPSSLRLITRRSATHYPVCTLKRIMRKNQKRMMMTGMMMKT
RLLNLLCLRGMLRQEHQCKKKSLNKKRSPQAYLLETRSQLQNKKKHLNKHLKKKLKKKLR
KPLHSCHQEALQLLLRLQDEQLQRKSQRKILGPQQNMITMLQKITN*PLWKMTRLSILNL
STMTGG*GN*RKTAQKVSSPAIMCLWATRITRQRHAIILFLRKKILTETLKLLYRYFHEP
SLSVK*TNYFALSFFVSSVYMTPLQYYFSTDGVPVRRCQNLEHKTTLKQTYCTPASHTDL
ILTTTIMLF*NRIRCLPEVYGTWCFPYAHYFGFTSSLCIDLLETSFKLQWNVKIKKCMKS
LPVDI*S*IKFSTMEVSTSFCIFIPLIIGKAHYKNTLSSTEYNCNELICVIRSDIFSSKP
FN*SRGSNCVLPE**YFTACPYFSIHLNSRFSRVLINWRSAVFILLFVCAALNRLLHFI*
LLNKF*SSYRNFFQLCSFFLIDNF*YFFFIL*YLR*RNKFININLSCLIGESLVHPFFNC
TTS*DISLFLFIRATSHCSIIL*FTVLNFIDIYVS*SISKLDFI*LRKI*RSFLNHRFYF
F*DFRFNISKEPGKFRYHRYYNFILFSFSFFKKF*PDLTTQPIGASVQFFRRFNIEFNYS
SYYQ*PNFKNYSNSC*RHIVITTNIEVIQYGTNKWF*FNLTQLYEPPL*NKW*LRCFDFK
LNRSFSIYNYE*IFIYTIVEFKSGLKK*NS*FHCFYCFHTIWYRFGYFSNRPH*FSGFYS
I*LCGNFNRQF*YTRELELCS*INCKWKFTIPGLVKLFSSAVTNHLGCHQHN*YTRVCNV
NHIPGLCFYGHQNG*RGDHRICYMVSSNTNQITSNWGQFVHF*RSTSLLI*R*FYFELQF
QHSCCLEQRS*INCKRKFTIPGLVKLFSSAVTNHLGCHQHN*YTRVCNVNHIPGLCFYGH
QNG*RGDHRICYMVSSNTNQITSNWDQFIHD*RHTNL*TIFNINIGDIDLTIV*CHI*GD
*NYKHPSHDRKYFNHRAHLF*WHIG*FLFVHQ*S*SCVFLIFLSKFFIFRRLYGDHY*LY
RYIWIDQQVSIY*CI*PNRSQPTCEL*CELTH*FYFKFNRNHRSYI*YSQNFVK*RLFID
DYAIKDQRNANACAFYCHNNGERCCYGIHNVVPGIKYCLYDIHII*NISFDH*SLLSF*V
YSNGYYQCYCNKLYNPPFINL*LYGIIFYSIRRCKKSRCF*SNY*YPSFCYFRSY*Y*HS
SVCYFCDGHC*REFNHIPGFYCFRNY*HSRYSKLYHYWKLTFPGFVY*NDKYYCGFPKNP
NY*YRGMFPFQMCPNSHYRGCYFERHAF*WTFFSNSTNGGSRGDIVIPSNRNYEYRSMF*
FDLHTDCYYICANEKYSFSILNFFNVKFLFSLHQKKFLRSLLRNVHLFCQYAKFAFGIHK
FRKTLHHICLSMVKYRFN*YNNVLFF*CHINK*KAQ*YYLSIQLLFGVLFTFFFYTFPIF
TIYSYYNNQRNQNCVHNLVSIGRKIYCSCFFSIFPQC*QVCFVVKTILIFISDLYSIYII
YCYHHHKWFEDCIHDLVSINK*IDFRCYYSNFLDSQS*NYFRFICNIYFYFFEHFNRIRI
FIWIFVERSMLRY*MYARCANTIILTCFNVSIFPLCFYIIIIIILNNNCINTNVNTHLCP
VITII*LYISIFAIINFVVIHFFTISRFYVINTSNSNSSIFLHFHSVFSTIVL*IIIVVI
ASLVVYFDVSVFIIIIIIIIIGIVAISFYITNC*HCFCSTTNYFHRNTNLHRLTMPTGGI
HYL*WIQL*RCDFNCHYSSIYGY*YYDMYWI*VPENHI*QL*WLLV*SIRNV*IKRYNIC
M*WRRMPSFRYK*AKFSIRHDDVCHYPKCHNNNISGSAFN*IHYINYYSEASYIYIQ*Y*
WRTDNHNKFQPNCNSISNDDNNENKSGHNFSTKANNYDLCRATTFLQWDCYFFCCCCILN
LDYYTHCQYVCWFGVKISL**VLYDNGNGDQLHLISRIYYMYVYML*TDTLFTYL**CLM
RNQSLLLLPQGCHHNHTIHYPLVGMTLLSPNLEKLQTLWCRDKI*LIHNLCNQGLKE*KN
LL*PSINHASSAHLLSWPICRHSDQLNIHPQKRTG*LTILLNKIYTSSRKMRYLLMPA*H
ILQMY***L*NRVILYNWYIVDRRQILPLIRLYSQLKPWSRFLIMLLSEPKITALSYTTW
FSLLVKLSLFKIFHYFL*TAS*RL*FHKFLIQAMETKLRKCRQRRTKFEKKKKKNLLPRS
SKLSYSSKA*A*KDQSFSFLWQSTFAVSN***DKQRIIIQFEIKNSNNKKHNFTYISNSF
TKNTSVPSVCCK*DASAVNHGNISKLSAQSFYLVNEAINAP*F*D*KKFIKIRTNINIYI
*CASDNPSDKIANYTTIGHGEA*THHYVFTVLFILFSKVCYY*CTSVYHDTVKRACNIAL
ICR*PFFTFKFFFYNWRH*TSR*NTT*KAVPS*ANNR**IAKHLG**PISNTFKD**CGI
YKVIAR*AIRKLL*IHLPYM*LPRKYY*LSSFFCVHSTSTNPSSSMKQKNKPELKKKNQN
H*ECHILPKLLLALQLFKEYQDKYHYLQCGRPMHECEEH*VGSWENMSRTFNKVLFILQQ
TLEELECNRELPLKHIIMIAPSSASFFGNILSFFPLSAILFKE*HKT**PQFF*RKFFFF
NYSMFETYKNSLSALRITANKVQQCWYT*LSKNTVPPHNAYPRGGACRYPKYLLVI*DLC
KTMHLLAKTSMSIV*TSILVRCPQAQAHKLIWLVMETSKIFPYRFPCM*NATIAGQAPNL
TSSNQCLIITDQRAVVLQMRQLQKKVRISVNPGRRYIQSCYKVPLSVSQMSIVLQVAHLY
PMRRYAPHLMRSQVALLRTRSYLPLTCPQTRHPSTLLAPQVI*QRTVET*VMDL*MILTK
MKSSKISIEKSAKMAVPPPWLTCHYPIHQLIPQGKIAKPERIKYL*T*HHV*GGPLPNRS
IRQRMG*CGKITLP*NNLQAWEIL*NRGDLVV*EPSHSVTSSKTLLSNLNPSKKLDYLAK
VT*VKCI**GNAIPTRYSP*KF*INMR*SRGRKLNEYSLNRKFSRQVIIHLL*HCIIPFK
PKTICISVWNTAWEGNSLEPYKQEKVNALQKKMRSFTPVK**QLWNIYTYWASYTEI*NP
KTYYCINLVMSCFLTLIYPSKQRDQKNPP*KTLRI*IQKFVQMDSELIPLLVLKSI*LQK
*SEGMATLQQ*TGGL*EY*FTRCYLAVLHLKEIIQMKHSLTF*PRTSNFHMIRKFRRIVK
T**RNY*TKTRQKGLVPNQELQT*RDIPSSKKFSGRS*ETKTPL*YLH*MITAANFLLYC
LAINTRKGTQ*VNRKPKCSVRKLQTMMKLMRLIHSMILIL*V*RRKITIS*PTLKIIPTE
KFYTKQLVQGQGITAHIEVSLKTSYLNYNMFTER*THGQISVLFLSIYLMIKM*KII*K*
TNKQRNNSKTRK*MKNIISFIV**CCI*NIRTIRISGYPMIVISRVYPLLLYYHFLIFFS
KS*IISTRLR*WIPSAILLKY*MPDL*YLCPGVPISPHSSHNYYKSIPFLTYIEKLHSSS
PRQFFVLPRNPYDNSLLTEI*FLPAWENG**IISRGSHLTQKNTLLKHKKLLYHRACQYL
FPLRLIIVKTVYCNFSRCVGYQAFPL*K*NHRL*YHRAHRFE*VRFQICLI*SLLRGQMS
RSVPL**AVPLV*YKMISHPYSAPL*Y*FYRFLGTS*YHLVHNEHPATR*LDFLHFLRLW
LVDHSQKLV*HNLRCMMWLLTTKYSHTAPN*V*FYGALYILP*FCSRILYTVVQIPELIS
PCNILAFESVSGFWEW*IY*PSSYC*LLSNHLASP*FASFSLRLSNQLHL*NLDMDV*DI
FVFLPILPLTVTVLIRFPFEFLLYPLNNHSYLN*KNPLLAYLNFFPLPQKR*SWSKNEAT
EW*KVVHSIH*IV*KVKEIVCLSFHLMT*NVLTGKIDAS*SDQRKKLFALNRNRLLF*KL
YHTLCDLKFLISQGYDSTFDSTIQKIYCC*FRM*CTQWHQAALQFGVHQPKV*ESILSTF
LIQTMSLYGPITKTKNLYHHHG*KCPNFAGS*DQVTYVFLMRRANR*KESTSPAHYCTQP
YANIT*KLSV*ETARVEFSHSLLLLPELHDLPNHTPACVLKDMKYL*KISLHVMEDHLYL
PVLLWAVNI*FVSVVSHQQD*ALQIHHTRLPRYLN*QKLRNI*PPFPDVRHGTKPIYCLY
HREYVSP*GQRWN*HQM*LW*RHLKSFFQKRLICWHLDHAS**RLFLLALPRQPLNYDAQ
VSLGERLI*HPGKNSTQTAYDCNLED*THR*SIFQAQV*CEVFC*PLLHPLQNICTCSLL
**QALYLYDAFSGPSPVCPRE*VSL*GTFWLFFLRNLPHPLPHHLQPQHFHHFVFS*SYP
IS*QSQYH*MLSKYH*SFLNFSNSWKKHCL*VESYH*LLLCLQQKINCPLHQCQGRWIRY
QRHFQPQLLVLAYASALILPPS*KTCLLWVVPPLLLIDSTK*IYLHCFWLSKVPV*VHYL
SPLFQLIYH*KFT*SQYSVRSDKYTKIFLFFRWQPKSNHRIRIR*TGAKVSRGNTIGKR*
AIEKRHSGTIDYMLSATYRDLNTASNLETSKEKQAAQIVIAQISLLFTTLNNDNFESVER
EIRHILDRSSVDIYIKVWERLLTLSSRDILQAGKFLLQENLLHRLLLEFAKDLPKKSTDL
IELLKERTFNNQEFQKQTGITLSLFIDLFDKSANKDIIESLDRSSQINDFKTIKMNHTNY
LRNFFLQTTPETLESNLRDLLHSLEGESLNDLLALLLSEILSPGSQNLQNDPTRSWLTPP
MVLDATNRGNVIARSISSLQANQINWNRVFNLMSTKYFLSAPLMPTTASLSCLFAALHDG
PVIDEFFSCDWKVIFKLDLAIQLHKWSVQNGCFDLLNAEGTRKVSETIPNTKQSLLYLLS
IASLNLELFLQREELSDGPMLAYFQECFFEDFNYAPEYLILALVKEMKRFVLLIENRTVI
DEILITLLIQVHNKSPSSFKDVISTITDDSKIVDAAKIIINSDDAPIANFLKSLLDTGRL
DTVINKLPFNEAFKILPCARQIGWEGFDTFLKTKVSPSNVDVVLESLEVQTKMTDTNTPF
RSLKTFDLFAFHSLIEVLNKCPLDVLQLQRFESLEFSLLIAFPRLINFGFGHDEAILANG
DIAGINNDIEKEMQNYLQKMYSGELAIKDVIELLRRLRDSDLPRDQEVFTCITHAVIAES
TFFQDYPLDALATTSVLFGSMILFQLLRGFVLDVAFRIIMRFAKEPPESKMFKFAVQAIY
AFRIRLAEYPQYCKDLLRDVPALKSQAQVYQSIVEAATLANAPKERSRPVQEMIPLKFFA
VDEVSCQINQEGAPKDVVEKVLFVLNNVTLANLNNKVDELKKSLTPNYFSWFSTYLVTQR
AKTEPNYHDLYSKVIVAMGSGLLHQFMVNVTLRQLFVLLSTKDEQAIDKKHLKNLASWLG
CITLALNKPIKHKNIAFREMLIEAYKENRLEIVVPFVTKILQRASESKIFKPPNPWTVGI
LKLLIELNEKANWKLSLTFEVEVLLKSFNLTTKSLKPSNFINTPEVIETLSGALGSITLE
QQQTEQQRQIILMQQHQQQMLIYQQRQQQQQQRQQQQQHHISANTIADQQAAFGGEGSIS
HDNPFNNLLGSTIFVTHPDLKRVFQMALAKSVREILLEVVEKSSGIAVVTTTKIILKDFA
TEVDESKLKTAAIIMVRHLAQSLARATSIEPLKEGIRSTMQSLAPNLMSLSSSPAEELDT
AINENIGIALVLIEKASMDKSTQDLADQLMQAIAIRRYHKERRADQPFITQNTNPYSLSL
PEPLGLKNTGVTPQQFRVYEEFGKNIPNLDVIPFAGLPAHAPPMTQNVGLTQPQQQQAQM
PTQILTSEQIRAQQQQQQLQKSRLNQPSQSAQPPGVNVPNPQGGIAAVQSDLEQNQRVLV
HLMDILVSQIKENATKNNLAELGDQNQIKTIIFQILTFIAKSAQKDQLALKVSQAVVNSL
FATSESPLCREVLSLLLEKLCSLSLVARKDVVWWLVYALDSRKFNVPVIRSLLEVNLIDA
TELDNVLVTAMKNKMENSTEFAMKLIQNTVLSDDPILMRMDFIKTLEHLASSEDENVKKF
IKEFEDTKIMPVRKGTKTTRTEKLYLVFTEWVKLLQRVENNDVITTVFIKQLVEKGVISD
TDNLLTFVKSSLELSVSSFKESDPTDEVFIAIDALGSLIIKLLILQGFKDDTRRDYINAI
FSVIVLVFAKDHSQEGTTFNERPYFRLFSNILYEWATIRTHNFVRISDSSTRQELIEFDS
VFYNTFSGYLHALQPFAFPGFSFAWVTLLSHRMLLPIMLRLPNKIGWEKLMLLIIDLFKF
LDQYTSKHAVSDAVSVVYKGTLRVILGISNDMPSFLIENHYELMNNLPPTYFQLKNVILS
AIPKNMTVPNPYDVDLNMEDIPACKELPEVFFDPVIDLHSLKKPVDNYLRIPSNSLLRTI
LSAIYKDTYDIKKGVGYDFLSVDSKLIRAIVLHVGIEAGIEYKRTSSNAVFNTKSSYYTL
LFNLIQNGSIEMKYQIILSIVEQLRYPNIHTYWFSFVLMNMFKSDEWNDQKLEVQEIILR
NFLKRIIVNKPHTWGVSVFFTQLINNNDINLLDLPFVQSVPEIKLILQQLVKYSKKYTTS
EQDDQSATINRRQTPLQSNA*KNCIYLYTKIMISEKKI*LV*YYISENTILNKNRSNFD*
LFLLYMGRFHF*TTEN*CYPYYCFGE*****ASIYIKQELQLPYVHDALRTKNN*VIELE
VL*NSLYMVSLFKRGKAPPLTKEGPTSKKPPNTAFRQQRLKAWQPILSPQSVLPLLIFVA
CIFTPIGIGLIVSATKVQDLTIDYSHCDTKASTTAFEDIPKKYIKYHFKSKVENKPQWRL
TENENGEQSCELQFEIPNDIKKSIFIYYKITNFYQNHRRYVQSFDTKQILGEPIKKDDLD
TSCSPIRSREDKIIYPCGLIANSMFNDTFSQVLSGIDDTEDYNLTNKHISWSIDRHRFKT
TKYNASDIVPPPNWMKKYPDGYTDENLPDIHTWEEFQVWMRTAAFPKFYKLTLKNESASL
PKGKYQMNIELNYPISLFGGTKSFVLTTNGAIGGRNMSLGVLYLIVAGLCALFGIIFLVK
LIFQPRAMGDHTYLNFDDEENEDYEDVHAENTTLREIL*RPKNKL*CL*VFVFISKQVLL
TS*NVNKRKIEVCLFTLGK*CDKELPGFAIPI*MMK**KSGKRLS*NHLYIYVKM*TM*K
YVPYKSDALPERFLFPTNLVET*TNLVIQNHRVSLF*RYLFPLLYNSHNLHFLFY*MLIY
TYGQKFLGQKRFSSNRLLELHLLVILYYFSLWFRFDLLMSKAAEALLALCKGHLHLL**V
CQNWPYTLSNASYYSQGAIFLLCCPQLSYYPSPVLSQC*LFLEMFPQNNFYSYQKIICTH
L*LMQYSISEFFEVYQ*PTRSYLPIKHYNYPHSIMF*KFFLNTCS*SALSHHCQSSGKPI
PPELQDPL**NFVTHLQWIFSFLPVMIEYCYYSNINLR*IQKSFLPELPQPRNQTSLKQS
ILWMIL*KNL*KTWMVLDLQ*I*LSLN*EFPERINLMSPL*NIYIFLLQQSQS*QVEPAL
*IQVMDRTSAVSVSLFILRSPYNNHISFLYLTVHLMLENFRILYYYYPDMSRRYIKMFLS
KVSLYRIR*GQP*VVLLIKYGAKELYIYG*H*K*RFSPCPDLEKQNFIVIKNF*NMIFKA
*ALGFWMTVLIKLGLRILHVYKGFFRKVILKYFFFSSEHTKVNKKSSMHAFLCKIYKR*T
GQEQPHLNKGS*RR*CRCRKRK*TKDDLRCVMIRLSSNNC*DIHTNRPLHTLCLGEYPAL
LLL*YSLFSTNKQSEHNGKTNFNCCWCRLHRWPSPPLRPF*HNLNESTWLSCMLTSLISE
LTCSIIHVTNCPLN*TL*HYIDLNYLKRSQQNDH*FSNVLRYVEASHLKRSMTVLNHSSK
WAKNDS*NIFFTFIFFHTANPF*NQW*K*RELLSFTISMIAIACIHTKECK*LRESLKS*
NCIFFNSSHILNWSSQFAG*LTIKKIVHMVVFLSVSHY*NSTKKFLQ*QTRAYDYYVLEG
ES*IHPQRLF*RPTEIHIDYRSYSDGISE*DPCQLHHFKLRCRKTLL*GLQQVYLINRLL
SYKNSM*SKRPHK*SIICLAGTNKTALVSFFTYVKKNFLQ*FKRA*R*HYNPF*SNIHIE
CIHHKGFFRAFFSPLYVDQNY*WNLQRFQKLVKYIRLFTKQEIYHDKPKYYIVMFTKKKW
LYTSSLEAFYNKQVG*LRHKIDFFEFNKNTYF**FQW*KQ**LCR*NKILISSI**YSRY
*YIIYKM*ENVIRNEKQSLNLMETKCKDW**DKIMKHRKRKEK*Q*YYYYYYYVEILTLS
CRFIYLQGELLVHFVYLYYSV*QQWNPNNYQNFHTFLI*NLSND*RTIAKLYRARKPNNY
MCQIRKK*RKQRVMKKSY*TFRSYLL*CFATSNPFNNQFKTRVGRVPC*T**PKSIIRVM
FQYCYYMFTQGKHIITNL*SGST*ETIVSMYKKVTM*FLHLHNI*KGPINLLNLLPCCI*
ARS*STTST*KKLKEFEFYVQTDC*NII*DYGNELALKKI*SFIKSSHYRCYT*CPQSVY
K*FCSIVSVISYKKKIVANL*PTST*KNCSFSAKKF*HYVSCTLFIAYRKVK*SFTS*NI
S*IAFLFVHICKQNFSIIIL*IVSIYIYIYIFICLLFLSVFSIFY*TMFDFLNRNLIPKY
KKCYYIAKTHQP*KKVETFYLILSIHHKIRTIPVQVMSLIFHKNI*KQ*IMY*TKIREIK
TPFEVIPITY*YV*E*AQVLLVFVKTTNLYLALRRFSIPKNKNFIVIYKSRNYQSYPSCS
RR*ARTLSISTNILVVSEERVDCLCIFAKYIYIYILHRYIHICFSGSFFLLCQRLTAQEV
R*FWSDCYCFFFSSSIRNPVFDLNAR*TGILH*IL*ALGI*IWVLDVLCKPTF*YSDIFF
CKPVSSVRFSTFVYHILSYHIKYQPIRRFIFLCKLIITSIVFYAAHFFE*YSNGSSELRC
CLQQLLLLITNLTVFVGPR*ES*YIP*FNFFFCCYTLW*LR*ITANRKELFILDFCSFGE
TV*NFQKGKVKQYISLYQRKSRRTTWMIFVVWRKT*TELCLTF*VLRLMKSISILIIFIM
YVFISRIAFESIY*QYFSL*WKVI*LK*SNIHYTKIFLTIG*KYTTTLKKRRAQRENHQY
HPKHGHF*NRFLEESKALIPRKKKKLQRNVALLHFK*EFGYVI*ESNLNISYTNNL*FIN
KRMRSK*IRFQ*LK*HSRVFLLVSAFRNSKIL*TLVLVL*SG*RIIMLKYVVTDIGKMCL
YIWPYRVWSWRRLFIFRVLNVVSIAILFETPHRLALVLNVCLYTHISMCLYNCYCLYNVV
TFSLNLILISMTFI*EETYDQHNFANFERNMSFYCDKVII*ITCHQHFRIWRYNLSCFGM
II*FLKKQI*LTSLINIY*YL*MLR*IAIFSLLFL*LEFAQENVFPHTLAFFPKCWNKKQ
LSSIN**SHYQCVIIILC*TMT*GMKICQRS*RKLDARIDNVVGK*NI*RNEE*S*YQYI
EI*IPF*GFLYPRGELLVYSIYLILLLLSTMQPHNNIKIHQFRICRLLS*ICI*NCQAQI
RRRFRGGWVILGHSTNFI*DQVYSTGNIEIFIQLSFYGQVGKAPH**CGDHRFKSDWKHF
LSRYSVTPRLPPRSRPSSSEK**ILMDLVPHKGSMFHKSSIILLYIKFTVIRRSLTAYDF
LYIPGRLLMTFSASRRE*GFESLNVE*INI*MQ*VNIRRVLLYPVYLII*ILPTMESHYP
SQDKILIKAWATNIGIRKIGLIFLHIILSFFFCLKYSSSPI*KIINS*ISTSIKFDDCFP
ISMSSFYTVNYNLLGT*ILING**LILIAIKSTF*DARTSKHRYYENAKKYRIFSFFSL*
QVVRN*AIW*FELIR*KILVVLQRCEYF**N*VSAQLFQFWNL*RKFNRNIERSKAQLCS
GKSQTNIKSVNKLPSYVRIVKLFGLIKGFQHGVPKHLFLG*LW*RVLT*SKQYTIQDLYH
LH*HTPF**S*VLPTFLLHMISPLHHFCSRKISFSLRHRK*LRIITKQTNAQTKLLVNLL
KCKSYLE*LKKKYYAIPYISIPNFIVL**YSVSRTMNIFQTLHALLGVSCIIIN*N*RFR
KRNFEVKGWRKKSIPISTLIDLSD*NYFCVFLTTISTILFNFNSSNH*FFICLIKSHLTS
PAIGYQIVVKFNVLLH*IAFKRMWNKEICNNDTNKTTNCSNNKSPSCTQIIPNGLETFDA
YYRTDFTSHSR*TIENTSNSGC*RFTTNNTKHITWSSIT*HIHECVEDNKQGGDFFQLVV
RTSND*TKDDVPRETKHQRIFTTNTIGQISTNWYTQYS*NSQQ*VPLCHFY*IILVLDNG
TDNC*TENTIWEGNKIIHKPCTTCTK*PFPIKFQC*EIWYISLDSTFFIDFCSSSLPSKI
EHTQWPEAPYCKNSPPDRL*MFCS*TDFVDD*KDDRSKWTTEG*WQICHHNQDTTSFGSG
IFISRLIST*CTGRIFCTNTNTYQTSHNC*HPKHARYSSTVRGSTQSTTNNQDSSGHKDT
RFSTIIISSDTHKELAKNNTN*GCVGNSSRHF*AIVFLTVLHNKNLV*HTH*TIYVTITY
QSKTGRNDCNYVFPFIFL*GFSTGCTPLGIIFYYSRISVLVHFLLIYRCDIFVFHFLSYS
IFLIISKKINSRLRLVD*SQETDNKYCNEHLLQLHSSGFIYSRVSYFIQTHSGCLPADVP
HQRIKIARLKN*VNQRTKLTNVGK*SYDTVDGMPICLYNQSMLRWGSSKEIHEYEDKCGT
KRQRGRP*DPII*PLLF*HHCCWVQHSTPLLLRAASFDSLLSLPSCTCAAKSINHADTLA
FRGYCQKDYAQYCHIHMHVLFLIYLGKTWGWNF*NALQHLWLYSQEK*VLIVML*CVYGI
CGADTIRSIVHEMMTR*HVLFDG**PCILLFLYSFRKRHLFAEPYRRYR*TFVDNSFSLP
FFLFIFVIFNSLHTLTVELLQTNTNKNLYIVN*RCTDQSIIV*CTQTRILNTTLHTY*IL
SSQNEDRIQNRLIVAETKKVRILVKFMFLNRATIFVGRVNDYNSK*LELVIINFYVSCAN
KRKIRG*KKRKAALGELQWRLYSWRLYSYKGNGGLG*WTILRKSLCLLLLIKNRHSHLLC
VKKITHLSSMRAAANQPFERNFELAMRLECC*RQSWLSVTCVSFRRVSIFLFDFKITALT
RETG*FVGVFI*VV*WRKLFLYLAYSKYPHLTDF*KMSPLTQNELHYQAFM*TFRHHLW*
GILLCSGFKVDSQFFITKIWWHA*LSGFRQFSHHRKASSVLS*ENVTHRAKQINPGIKI*
FKHNFILHCKYISQ**INEIVRPYVSI*HQSRIVSIFCRQCRTFLLFIHHIVRYVGIFY*
LKHDKRFTQNCIEILIKLNFKVKLVFNGCYFLTIRALPQDFFTWNVHGLNFHGLFAFISF
N*L*WL**YSFAISFVTYIGKGNLIIIWYTVTLCISNKFRRAFVVGFSTTVTRYFMQNHI
FECPFYQTTGVLFPPFIHVFGAIKAFPICQIPVFEIFLFTRFIVKMQQKNRSHTGHFLQY
MRCWCCFLLD*P***DVRLK*ILSLIHLALY*STLMDGYKIKRQQAHIDSMFYLGPRKNK
VWIVHHHLYMKETGYIQ*YFPDHQ*HIIQKNYGPPSMLDHRL*K*KFFGPSDRIHCHRQQ
NLSLI*SQQKDLKVLDCKNNPEVNISQA**YHSRTNRHFLHQQLSNLTM*GRYQRIFWFL
LRLYFQYSLLGD*NSQWKDETIQILSLSRNQEK*A*NFQTDGLVSIQQVRISTLANLI*K
SLRDLDQHFPHL*FLSI*EG*SFR*NLHEF*SL*RAVIE*AAVPFEK*MHHWISRCP*MT
SRYARHLALKRPHMTSISCIE*QSYL*IHQNL*TFCLHHY*KPTVCR*QLSDILHRIHG*
RTNRVSKYHYQ*SQNPC*T**NDSFKLLYRRLFSFPRKV*F*KRIPIIAQVNFTWVI*NV
CVYHIAIAIRNKKFFVSRMSSYKTVAI*IFF**GYS*SPP*LPTVVGNVEFG*FTYKSET
SFLSMERINSKSENALFNFFDRFPIFSSVETYPYNPPTI*SDRSVGIIKTH*IK*CFYRS
LRYFWDKFLCIE*RK*YNYPKSIYGMK*YHN*GSLTFS*FKVFFQSSELYATIQ*LKKR*
RIIFWLQIGGI*IYFGLQVF*KYSHNILKISSLGNCNYFESGDFELTMFTSCTAIKVTCL
PSNGENQEIRLET*LGYLDLLMSPVVR*YHKDTLLNLICIFKEWESLRDHSLEWYSAE*I
LNGENFPSLCPIDAF*DDVRILFW*RHF*YEDSLKYQ*PFIGIPLPNWSLSPRDVTNATI
ILKLGKDFFFKISGKDSTDPLTRYSF*TIGFTSTPENDNAHVRLIALTTYAVESKPYHRK
WYKSPLDRIVLAIKPIFSFQLLGDLYCVIS*FPFSLLIALGKGNVRGRKVRRNRSDSEPL
L*VRILKELRRILLQCIKFRQVFANGNRCIILCAWYI*VQ*ICSSWIVDSKDI*SWKGDA
QQIT**VMIFTVLICFPYKA*SITNNFIKKKKTKSL*HT**LCIQKKNNICSSSSLIRQL
VFHQSSYRF*CLPGYEEHRKARSYRPLLEYGEFAHH*SLD**T*RIRWQLSWLLGQQGK*
CHQMVLHGRLLNTVLFCQ**HFASYSPF*RFLLSN*LIRQR*HPVYRPHICTLVEAYFDS
RHSRLNTRYCCTCV*FVLPRQYHGNQIVDQHHILSTVFRVSEKPQQ*SW*SHSIYWLIG*
ATDLLQLHRPIIRWGRFFVGLMAPTSGSSPSYRSTPSQLWSVTLG*WLPLPKT*QGRQVE
HLHPKI*VHWVICRQPQLK*QNIQQKHHWKETLRKIRE*THKYNHQ*KSL*DRRLGPI*Q
FGRQRHIPE*ILEARPCSQCVPNQSGYQQQRVS*SIRILLPIQEWERPL*QPLYRLQ*RQ
PSWFLELQLACL*VICNCR**SVFSLPFYRIWLEGS*AR*RKRKK*KKACPLYKNFSQYL
LRNT**YCLSWLLYSW*YYSLGFDVFSSSEGFPMC*KPIPLDGAARQPGGSETS*SAETR
KAQLSDRNCCHMKT*KCFLEIP*LRKV*YVYCSSLLPHFLSRKPFN*MNYC*LYGVWPCY
FSKFRVK*TPSDQYSNETSH*FCSILRPKPGNWWL*VLIYNYMKTKLGMLSTFSSMLLTA
QKRSEQLYWSHSA*RRIKMPRSSLLKTLSLFIGKALQVYSTEVDKLWNLIHTE*VWKTVN
LEDFSLLSKEGSLLYTHLGSHEYC*LVRV*SILHRLLTPRSLSFP*LSSGFPILIPHYRT
FLI*IVFLSGLTVIFYFVF*LLKAVSRNISRFPKFKN*NYEHRRQNAFFINYYEFSRKWL
QRK*ICIC*EEKFGRTKSISLMELIIKHSLRGAFEIFYIQGHLCCVGY*TWDFGNTSKKH
N*ALTMNRYHKDRDISFDLEATWSTNY*YTSPREHF*NRIK*SSALNYPYTFFLHIWLEK
RDYISESKF*YCYYELVTILFLSYTIL*TSTSLNTIRLQRLQLRNCTKAFAESLHICRP*
QYTTPNTRLMLYEFKRWKYFFRGSRLKQTEFRLRQ*ASERGSKSKIRIFFLTESGNFTGA
RKRVFQGTPAPL*LAFPHSAHTNTHECHKTILHIRNL*KMYDSFRNKSISIEIMRLCER*
DMEDM*GAK*ASVNESFK***QMEERV*IELLQLYAFEVCAFISLFLVKITSALTNKTNT
MVKLTSIAAGVAAIAAGIAAAPATTTLSPSDERVNLVELGVYVSDIRAHLAQYYLFQAAH
PTETYPVEIAEAVFNYGDFTTMLTGIPAEQVTRVITGVPWYSTRLRPAISSALSKDGIYT
AIPK*RHAFTNELP*TLKNNERIKKKSFFFFDINTVDYINIYQYYKPIFDQDDII*VHQQ
RKRNFLLGYPSGEAVESAIQYYCIYS**VVLKFDTFGSVAFISPTKIN*FLYFSVCWPGV
VYTHVSFWINAVDQGLCERQVRVTILNFRLLLYEYLHFCAYLCVYMFLLVRKWSKC*SKD
SVKEVITKDL*DKAVLFVAIFSGVEWKWFDSIIS*ARKS*RANICNNPNVI*CGSAETLN
IRPKSIIRPHNKME*KIKQMSLIEHQNSE*KLYKEART*PALDVA*YY*NKKKHRTTEKY
KKKMLYPEKFQGIGISNAKDWKHPKLVSFDPKPFGDHDVDVEIEACGICGSDFHIAVGNW
GPVPENQILGHEIIGRVVKVGSKCHTGVKIGDRVGVGAQALACFECERCKSDNEQYCTND
HVLTMWTPYKDGYISQGGFASHVRLHEHFAIQIPENIPSPLAAPLLCGGITVFSPLLRNG
CGPGKRVGIVGIGGIGHMGILLAKAMGAEVYAFSRGHSKREDSMKLGADHYIAMLEDKGW
TEQYSNALDLLVVCSSSLSKVNFDSIVKIMKIGGSIVSIAAPEVNEKLVLKPLGLMGVSI
SSSAIGSRKEIEQLLKLVSEKNVKIWVEKLPISEEGVSHAFTRMESGDVKYRFTLVDYDK
KFHK*SIYVIFFRIS*NACQISEFIMTHYITREKWFALYVYLKPILR*SHDLYIGTFIS*
IGYFLNLREILMKI*NLSTTVQSSKFYSIRNVCRVLPIHVEYVYICSAI*LNT*PTHMYR
SQTIKSEN*IPIK*VH*CNFRPKGRVLIMLLLRNLESEHV**GPLKALQF*KRRAQIFTK
NAYINILCYLRGWFNGLK*VEK*RFT**RVFFTFLHSVDFLLKTRADHYYTHYYKSLRTK
F*HHY**CYSLILY*CKR*INK*T*NWLLKCSDGFDYSKKTSVKIGLPAMQKDQTEM**T
AACLLAMPTKFITV*I*RENRFICQCCSKRL*WIQFLS*AQFRTATCT*KDWA*IFLTSA
*RCR*CYAVDMERRRYASYSRISYISGLSFCCA*SGAT*PVYQGTLCFVVRHGAC*L*QL
C*WYSL*RHIKKYTRTIVIHRKGHF*TDRT**AISSSVCRLRVIIQCIFNGRRKLLDSST
VTHR*SGRRVDAKKRL*NTFEVFLSKYLSLLSFYGHFTL*ERSH*FAFTRRQ*SLEN*Y*
S*KCAQKNRNFVITYNSNGHGLDAFKIGCKSSFNGKRKCLRKCQETFSFMS*TIMPPGCI
SLSK*EHFYLPFIFLRFRAFRSRESRLCTEPH*LAYSAPSFKFVHDLRSSI*AFEVQTFQ
RSRSDKAETDIMVRSSVITFSNFSC*R*CW*IK**IYGGIFNRLRRIY*SFLRV*KKFCE
*IERANE*YCLE*VQISRHFE*TNV*LHFSYTTSAAFPHFRKY*KI*RFYG*ELSYKFDL
PTPS*KGTKCDQSWQKYGSRCHGYSKN*NISYKYCGKYVFFKHF*CPIVTF*KKMCYALG
RI*KELSFPYFEKFQCILKASRVDI*LSRE*VSREHFRESRLYHR*TNMFYACKDLDVPM
SYFVKVFIQARKSEKIGLFQYIH*R**KRR*NDCHFRKTY*THS*PNGTFSGSSKGKTSR
*LLWCLPNCSHV*IRCVFDRCWRLSICDKWVLG*DFQ*W*NTAKSTTSREIEMGIGLQ*F
EKNQTKVNKQPEFAEFQSSSVVPDGGCSSLQFLRNKSQYRYVPKHG*RIFQYQRRRGFKS
TIGKQQF*CLLGFIR*KSERYAFFVRIRIFGKAKKKKTSQKQETLLSSTFFPLF*DSTRR
KDSSHFAVFLLTCSSI*KNEHG*AGGM**VRCV*ISISAVPLLRSAEMSYMHKID*KKGS
RYSNMHIITTTHFAVNRRIIS*SFAGFDDDLKKFNYSFDHLEEAYPSCLK*LGPRPTHLA
S*DASDFFLKLPLLKYPR*S*EKSHTMEHVRIFSNQ*TRIELLNCLILFTRQVEISLMPQ
TTAKTSNQKNGLVNGYSPEGYVIKLSLQPSL*KAIKSIKQVKVTLPTTVVITSVVYM*V*
GILSANCKLIGLIYFTFTGGII*VQSKNLWIVCIFWSSRARSSIWVYLIHLLGLFLRQTT
TLHLMVKLPLVSTKVNGTC*TEILSVILFQWLGISVWPSPHGMSWEVEDFRVKKQWRNGG
RMERVFVLSLAPPNKQMQKSRLVKHWPRLLRNMALSLLLLLLLPMFALRRKIFFRRLKEE
KLRISKRTLRLSVSI*RQTI*NT*KV*FLLTSDFLIILSC*IP*LKNMVRIMFR*FFSNQ
LRK*SSKYVTAGINVMY*GNDAMLLTTCSLQNVPMVLLHGIYKLDSSSIRP*HIIIQTRC
I*A*ICIYAHEVCINLATVPKYNLLCCYLTAYVQFINACSV*YIRAHSS*RKTY*RSPYA
LVKTWYSSNNWNITA*WSNSRI*HKHDNI*RCFHPSDEGGREQENE*HYIIFLYIYIYIY
IYHITVENPGDITDKHYTRMNVSHYYIIT**IKSVTIVRCILF*CKVCISTKYSEVASSQ
ANGNIKELLS**RHGSARTSSQSVYVLWLKNRIFLCLGDFSGDFSVILT*VYIN*VVSIR
*KRGITYVLREFIRYLGPPNEI*ILKCG*SWALWVNGTGYRPLRQVPCIMMWVHLVLI**
EWAMDWSVRVG*LESGIYCSIRVRMPHQYK*R*VWHVVVV*SGRVSMYVLFTIIC*RFNM
VGEQQYSE*DMVDGRVIVG*VVVELDMGNWRVTVMMGGGWW**VERWMVVGSGMVEWGRV
TSGEVG*CEGRFGDR*NQG*NRVVLG*CVGVGVWVWCVGVVCVGVVCGCGCVGVVGVVCV