Protein Translation for a region of Chromosome XIV



Send questions or suggestions to SGD

BLAST search


Protein translation of the coding sequence.

Other Formats Available: GCG | FASTA

PAF*PKLKKKNENETLFFSPTALLHSPK*P*IALMYVSSKPCCLLPGCSTKSYLLPLFYV
YFL*IVFLSYSFPLVSRYCRATNTKSKQ*NTTTSKRIFPRKKNFLQYTILHNT*SLTFVT
TISFTLQLLCSNLYIIIYQIYRLEHHRYPALCEPLPSACTAVPSCYLQRELQRLPNQANV
VTTTPPKSAPKDIPVSAEMFYCRTALSASTGMPSNAAL*MG*LPAQADLASAFLDLIHIC
SSTVDDAC*TAA*RTADPAVQRSSWNANAEKLQLSRALPQRPYRLLPPILPGTFFRPSSK
STAAPLSSIHASCSILYNTTL*SAFQTCGKLGSLACLLSNPIH*LFLFF**WPGTKHNFS
VSESRSLPFLR*KISNTLQGPHDMARCLPSILCIPRHFAAFSPQLVLPKPSSDTILSGQP
NRHRARTSFDSPCIIRIV*ILPLGRSIRQYHRGKDV*FRQTEIQETVRHSYSRKYWEIVL
SVSFSLAKPFDSLSAYTTLC*CR*LDGIYYPQHCHLYWRPPWH*RWYFQW*WH*CWSWC*
QW*WH*CWSWC*QW**H*CWSRYFRW**H*CWSRYFRW**H*CWSWYFQW*SH*S*R*CW
QW**H*S*RWCWQW**H*CWSWYFQW*SH*S*R*CWQW**H*S*RWCWQW**H*CWSW*S
HWYWH*HYHECTCRCPHHCCNTFCTCHCYCSPGS*TVTQRSTWKLSPVFQPICPFFLSVP
LCQQTGLSWSHSIQHAGPFFLSLIQVHRTRVPVRLYSLP*SVVIHPYDSLPPNCFF*IID
NRGPHLLVSLRLE*AQ*Y*VYYQA*SPSSIA*CQFLQSLISFR*ELACYRQ*QTPLCETP
FLQHPASRVSIPP*NTFSKSRPILPLRWLCLQLQWPSTLVQFQRGLKEASVLLRAVIPLS
SKFYEHALKAPRISP*LD*TSVLDSWIDLC*DLPTV*AR*CPSTSWPVP*AQYAATQHQL
QPQVLCRSKRLLSQKRQNQG*LCPQIATAGRPPFQSCETHLQ*GNPILRCWS*RCTQQYS
PTQLSCL*N*C*QDHRRSPRINQ*RHRNLLQ*SFLQGPHSSNRIGST*SCN*QATLCTVQ
TETTHISRRP*TPVLSRGDEITPSYHSPVGPVLPQRVCLPCIFHDISATDASP*IQRSCQ
RVSGLRRGYRLYSWALGAFFALLLKFFDDDLNSPPHLPLRLPHSEY*RMNNGSRFQGLTI
ESSARKLVPAIKWRSSH*H*LTKRNPHRKYFALFERNDWP*VHSSPTRTNLFQICYLRSA
VLGQSTPDASPENSASEVHSSEVPSCTAEKLRIQPDSPSRYSETCRNTKLSSKCLDLLLD
LDPQIPPHPSKDHD*KRHNCYQAHIFAFALAQ*QNKTRNLK*VRQAS*VEAPMNRSCCNQ
CTVGCVLLYHRRIRCAEDRQKRVAEALDNGKGILRQNGSST*VAP*ARQLQQ*LYF*EPR
SFC*YLFSTWAAQFHDI*QVSFEGKNRSPDTRQFLALAL*TKLLDYAK*GWQYQPL*AYK
SSRSILPKGYQTEPCMQSKSRGHTRD*TVFHILIHHQKKVPKLFYKSPSARFPALLRGTE
F*SISTSQRRCCHQIYLNPLRYKHKTTPIKLSRHLVFF*VFVEC*DCATYILSSHARPQR
E*WVLHS*WIDPLRHQRHHGDPPRN*AHMLAR*YAKYHPIGPFCSSYRYISVKSTLSQWV
YVGIDHASAALCRLSFRQVNLLGMQKKSIAHLRVVTKTCRVPNCIHISLWCFSEDPLQ*V
CQKQSQ*KYAS*SCRSAWHSLFRNNVPGHGNSTHYSILC*GKKEKGYRNPFY*ISKYALE
TTCRPSS*FSWE*DTLKGLVRPGNLVRLQQTSGTFVHFSRP*RKRQFFQKTFSYPLHQF*
ILPL*LDQTFRLRRMTALPWGSIQIKLLRDNVPSRFCYLEPTQTRQSLLFQTYAYRKLSF
YFCKFRN*Q*YVDCYAF*QEIHQYKQKIVQFPSYHHLRM**LSY*EDAESALCRCKSLAA
AK*IQLVRNLTKISDCLSPSSTT*KAEGCLIHRLISGLQK*SSRYVRSFSISMVHSILTI
CLVEENQDSVRCSAASWIFSWIL*IWTYA*PALSLQLLPLSKRPI**KVINYISLLGIRP
RASK*RSPFWRTYIWRVRQTNFPQKCITPPNKKTDPFTHDVSSYFLGAMSHYKKIP*R*I
VGLKSASQSPKQEILPIFVQGYFLDAICPYGLV*HHPACNTVTYIYPHPHPHTTPTHPHH
THTHTPTPTPITTLTLPYSNPDERVSQLTLHYPTSPLVTLPHSTIPLPTTIHHSTYYYHP
PPIITVTLQLPKSNSTTITLPSTICYSLYCCSTLHIETLTNNRK*YTYTYPTTLIPLPHA
ILTFTCILIGHTYTDATVYTISTYPAITFHSTPWPISH*ISTKCTHIIMHGTCLSGLYPV
PFTHNSHDYPHFNIYISFGGPKYCITALNTYVTPLLHRILTTQFIYTYANITKKSPLKSP
KHKNILFFNHNT*THSIAYQYHHDVINLNVP*YVIPLCSIPYIVI*LYSIVIQTLLLHPI
FSYYCHRISH*RMIKTNNFYCKGCHPRSILLFAIFIYRISKQAGEVLITQRSCII*VPPY
L*VLL*SVLQ*HRT*GEAIDMVSKGCPHWEVTWFYESSCQIRRTDSSCVNICDSYVYFLL
DVYTVLSQEIYA*NMYFIQAVTAVRAVTLLVAP*M*TNVTAHRDVPALKFCKFVITIIEL
AR*KTGNEMDALFE*LSFFA*NSPILFPFFYHEVTEPLHERARLGGFFFLLCCIKAKSQK
LLSRIKNPSNCHLTTENERE*T*K*EECRCIILQTARIPKDCSTSRSFQKQLYLVLL*NL
QVLSVSHLDAIMATT*RLVETFQQLYLPTYSFTSGPVSGTNICPCYLWTFS*AFLIETTH
SVLQRGY*KHTKF*SS*LGSCCSKSKFVLI*K*GLEY*VLFLQCHGLSRSVQNNPSRTIF
FEKRRSCQG*VI*GFRPLH*RSIGSLF*RS*KTMEVV*F*EIMEPCWPGRC*TSQRSLPI
*AYLVFKEDFQYFYVDTIP*FFVLHICVTGNVPSITHLLSRVDSFHVGTRFPKHEDDRFI
RENGTQDAVLVDYYK*ARKWCEWMGRNCKKNE*VLV*EKSLEE*RVFL*RD*L*MVF*PL
LLPRSLCKEIYAGSIIECGTMAIY*RSAIILQ*GVLSVKINTTFSIYIFCSLSAANNQNE
TTFYHYNHFLFPYFSLVDRNQCAIILPYALNLLSFSS*RCCIPCIF*TMGWCFYQARLIT
WRGLLHTSVENAYRSGILK**VILLFINYNRTLSQLPFLFSTFTVK*RDVQKA*ENLC*I
LDGHCIPTVKLL*IHCQLFSNFHQVAEF*YPFALAICLNEQNICNVSSFLEILVYIEGLV
RFQISL*NTQEKNHALLIIW*LNIHKTV*FWVVMAV*LAIERKKLKKKKKIK*FLHCDVH
YSIMNWSLIYACDKLFLAQPHIIRE*LPT*ENSQKIDKKLLLAFFTSSITHCVIPQSSHS
MYLYVYTCYNVKQCRIYI*IPHGFSLVQPTYYFFPFVFFYISKVKLA*TMSII*KKK*LY
SVSFILFDISITLSS*SRMYTDNRVDCACTDYSALFNWKIQAFKMRNCYSKDPLR*NTDR
QIRELASVPWAQIPFPPHSN*FF*LQKKTKPCDSSRML*HQSQALLYRSRMNVEY*QLVK
LQGLN*LVSISF*EH*KYTEYKLG*KEFLS*QQ*KSTF*TESLKKIAKD*PILV*KRKMS
NMRSYTIKQLWTAPKQMSAKKILLKCMDTIISIIQNTPPHNSLSGSHQSILYELYK*LFR
IGPLIKLYINGLVSFFFC*HEVASYCFLPCSSSKESIMSQYGFVRVPREVEKAIPVVNAP
RPRAVVPPPNSETARLVREYAAKELTAPVLNHSLRVFQYSVAIIRDQFPAWDLDQEVLYV
TCLLHDIATTDKNMRATKMSFEYYGGILSRELVFNATGGNQDYADAVTEAIIRHQDLTGT
GYITTLGLILQIATTLDNVGSNTDLIHIDTVSAINEQFPRLHWLSCFATVVDTENSRKPW
GHTSSLGDDFSKKVICNTFGYN*IGKFQ*GEFRMNSDDLLSP*LYYTSLLFTVVFKNKFS
DEPVVKPYIVFCQFRMK*CRKNIVFLLSGNN*FLTTIILPI*FVQDLHMFRIQHLFYYWG
SYKSSRKIIAVRNKV*KVANPGRRLSLSPKCISFYFNL**IQRLDQFFFVR*LL*NINHT
CTSTPGYLAWVVYECVEIVVKSCSFCNKGHCSRLSPRYDQCITLS*LIFILHCHHR*FFF
IEIPVFDDAFFYVSHMFNERTL*CQDSDNDGHF*DITLVLAPATGVMVSVLATQTEKNGL
LSMNNFFFL*LNDERWLNYSYSFQ*SDAPPNGITVVGTLYRLNGKMLWQGKIRIICSCGM
NFTHTHTHI*N*YVSPP*SHYYSTLLGKEL**KNKYIVKKTKMSEFKVKTGLAQMLKGGV
IMDVVTPEQAIIAERAGACAVMALERIPADMRKSGQVCRMSDPRMIKEIMEAVSIPVMAK
VRIGHFVEAQILEELQVDYIDESEVLTPADWTHHIEKHNFKVPFVCGAKDLGEALRRINE
GAAMIRTKGEAGTGDVSEAVKHITKIKAEIQQYKENLKTESDFAAKATELRVPVDLLKTT
LSEGKLPVVNFAAGGVATPADAALLMQLGCEGVFVGSGIFKSSDPEKLACAIVEATTHYD
NPAKLLQISSDLGDLMGGISIQSINEAGGKNGARLSEIGW*N*RCSHNANLFPSKGQSAI
VVSIYYVAQHGNHIQPVCIYEN*TLKLFHPISLTHWPC*RAQSFTYIHMYVYVYIYVFTN
MHVYSFRGRLLYAIRR*VGLIF*GDEIGALVHKDSKSPGGDNINAFIGFWL*CNEYSSN*
TAHEL*NIRIIQLAEGLKYYLFRL*KWCCYSKISNINLLRRQQTKHIKTSYYHLHEQYSC
PFFRSFTFSIL*KYHNNNKHTSKLCLQTRSHFC*TGNQPHTIFQFSWLKPKVTSRSKV*T
WPS*NQPILPMSLS*LDLVRSTWV*KP*FTPWLPRPVVSQ*PLLPLCWTNHLPVSCT*RA
VVSLKTSSP*RVRRSVTLVNSVRSKSMN*PSTTV*SQKTTPQSDVV*MSPSTSSKVRLML
VLVSNVCNKSNWKSTWLSKADQLLMLRC*ELTSWLAWVAVASVPFFTSATMNF*RRTLKR
SESS*KPSRRQPTTF*PTL*RLGKNTSTSSLD*TTIYLTSNTKDVTLTSLHLCTMFTVTG
RRLPVTVRD*PSCHQTMSRTTLMNTCPGQNQKRFLILWKLKD*WLFIKKNADRKVLSRDW
LFQLKRASSLVQPSLPLRLVYDFTLAVVSYSIYRHTYLRIRACIQALNELRLS*HFISLQ
NLHTLGG*GNCV*FVASFQNIVDGY*HKIITLTNCQKLSWQTSM*GVKASWLPLGHLLLN
FWESQHQKEQYFPGILFVPVLI*YSKPQCSA*DVQFSFLQSMGKHFSL*SEHRQ*R*Q*Q
TLFHVPQQF*SMLR*F*PPILFVRGHPQKYADPLHSSSVLPLLFYSEIFHLP*HPMGLEP
YQNA*PLE*YHAQSPCSIHSIYLDRR*KEFYHEM*RSNLPQKQPKQVYQILLNIGPCPAE
LKYANYP*LLRLNSYNPTSECKVYQSNQFAICGENPSHSHVNYACDYHSSWHFYHHLLHT
SYNLR*TWWQLQSGHAVFLMPSIHLSKSLTLHFGNCLQYQYNYLQLHKKHQEVQRPVPYS
*SP*SLTMRRRLKLLPELAVKPLCRQF*KEP*DVPIR*VVQVEV*TSQSC*IVVFYAIDN
MLSKIQSRSANWLAS**REEQHASLTWKYCHT*IWLEILPPGFLEYEQCNLFESSYEICL
LVLYSAESEFENICN*KRVNQMRIGLIL*NYYQILNDI*KS**PNLFFIMNKDFLFSHTS
MI*EIKSHLPRRDYKLYWHRFINSGGTRRLDSNYNRNTTVSILKYL*YVNNTYRQFSSKR
MGRG*CMNGTHQLKV*EKSFAKKLSLHFSYTIG*RLKCLLFTFLLLFHIIYIRIYFQLFF
SIEFIVMLNM*VPRILRTTLRIFSLGRIFFNITQIFGIPRCVIQLNTRGILCVFQISKYI
GHYLVKIFGSIYIEHIRRSNT*LIIWTVIFVIFIVR*IFIQDNVI**TCFKAPCPCNISH
SIASSTNNHHWDPKGFHIVYTISMAFHGKIKATKTIAGQGVPTTL*HDSRRLIPFHNFFY
HRFKHRSIRSIVNTVS*WHIDRVVFSCTHPYISQFTCAREKLTIFVERTCHDTIRCIKRF
LYTITMVHININIQNSGVVS**LNNAQYYVI*ITKPRSFRFFCMMQTTRIVDSNITFASI
QTSSSFHRATTRYATVLIEPIKDRTIISDIKLDTFSFKHF*IIWSNPR*KINVFISMELT
HFLFRCRLSSVNFHLLVQAIIHNKGMCHSYSMRLHRVTCSICIVPNVCIVKICNASFIAW
LDRDRIKRCCFIYHLHGYRVVATNVLYGAIVL*TFMVITSNFYYV*STTSIFSVFPFR*I
L*AGEGK*IKR*ISRQNMGHIFTNLPIRSELILLKHLQN*LSPLHNDSVQPATHLG*AAL
VLSRSLPFLRQP*YPLLSQSYQTSDV*KYSLPSIRYAEKLFFLPCVQFLTWR*ALHLSRE
HKNLPRCN*MDIALPTQ*ALRRCRARICESEPLKYSIVWYPYPECLNITIYRIVLVLVVL
RPISLVCLLLR*QIHRQRRYSYHLTLLVTVKRYDP*HHPNHLDYHVWVLLNRFHRKI*HK
V*PLSPFETLCAH*LHSHQCTYSTVQGL*H*KNLKKNLLQWP*PLEFYLYPVDHKKEYRF
SFSYLR*IIQDVLAACLLCPIFHL*QNQYHLYHPKLR*GFVGHQSKPRIRS*LSK*LLIN
PPE*SKLIAEAIHTSLILGKNAQ*PSFVPFPQLI*CLKELNQQNMKRVMKMKYYPCKILE
PFVEHLCLVHVKISTTERYAVSVLQTERVRESQISYVI*SWKARYLCYLRSQQM*FLGI*
T*NRPEV*TFRSL*IFVI*LPLDLD*RLRQAKLNPNEPKKSQQVMRTVGHFHI*P*CNQ*
S*MLNPVVLNLK*AKGNLSPVDVYQDILKQISPL*PCPHCL*WNEVTQRHLG*FPFENN*
RKFLIC*PIVLHRGRYANHSKKFQQNRNISEDWIYSRVMVFC**Y*LLLASSDWDQ**NE
NYL*RSNRALRL*QRTIQGNRSCSTALAHLRHQTHHFPLLY*DQPYLNQKRLGLNHFDKE
SFCSR*KTFSRLLE*YFESISEIEASLQLLR*KLD*QWEYLYGLYWTLILSRRCSLESLL
LFWEVRILFFF*SRWGVVKQTA*LA*RNPYLTLL*TIHL*HPGAVEFQRL*RHILNYHH*
CEVQVAKDLLKLCRGEIQDQLIKQNLSLF*VMHILHLR*HILEHLVSAQYHLLISIGFL*
NQQGPAGKVSSLKFGKDQMLKYLENEPRFPWS*CYICNAKIVFVASLAVGPLVLSTIVH*
SETLRYPVQVLHCLIWVQNSKNP*WAVSA*TQKVWKVQQCYRRAVNHPGHNVQFYQACNL
DRTEAI*LSHINIQLFYRRIRDIYP*KCYRGRIFRRD*T*AMPSY*CYYNRFLLEGMQTH
ICSPLLFFVLILMTCLKVSDGRTFPEVLTIIAVYYVV*GSVAIGYMIYKVLLSLS**NTS
FENFFRLIYLGRHVGTPSSVWVVTNHSLPVLFFQ*FFIQVINLSGGDIQDEQGFGLCHSR
CKASLVLV*SIFQFFVYQ*AFELKCIAVARRRVFYANVI*FCNS*RGQGLVDGPCIETRL
DT*SNHCHAQTNYYRQNHAGISYSLWLYCVLSGS*QRIRLLLFFSRLYLRFRNCYSQ*AF
TSCNNNNQRISYKTKNDVERGSNAITKINSVWDVGYVVSLPKKKKHKKEKAKKNSAKDLI
LNEVPPWRIISQ*IYA*NGTIHN*YSLCWFL**PL**PL**NGSCWLYYFPNSDALAPRR
EEKQQADKGLIY*HFRLTLPKRYSSFYE*DAGLMLRIRFSTSFLMWLVFFLFVHNSTNIK
AEYILADLKLVSLDSNFLMVFFQ*NQHKQA*YKTLQ*INYCYI*YESFRYSA*QTLSHKR
NRF*KIFK*QIVIPKQKNVRIQIIGS**KGNCLFQREVSKI*HSKYQMLSAHSLKNPSA*
NIILTVLPRYHAQINRRTISPFLFQKRVQKI*LLHLTSLHSLHQMLNPKLQNQKASFTVS
IQKILCLMTLLITSLKILLL*QQMVVYTKLIIPPGLPLTYQ*ERSEIPFI*LLRHLPPQI
TYSILR*LSLRLSLPLILLTNLLMLSHIQLFMTTPQKMKLDVYLILQSAVGYTSV*LISQ
RSYLPRPYQILSN*HIPMKVHLSDF*EREILQPP*PQNYILSQLLTLIPPPVMTQLALML
L*HQHTQIQRFLLILRNHPLSLKLRLLHH*VAGSFLLQLTVLAPRRTLPCPLSLRFLLAV
NKLLLQVFLYRLQVLQTQPLLLLHLLCLLLKHIVLSVQLVYLSHRLPTLIILQLPLLPNL
LLL*QFHLLKNCQALYHTPVTSQYQYHQLPNILLLLHMLVTPLHSHPHLFLNL*LALHTW
QTLLFQELHLQVNLLIRHMSPTPQHHPQLN*PPLLRSRLT*QEQVFLLVSLILLQLVLLR
PVYHPAHLFQTQRLPLGLIF*PLLQSLHNLLK*GV*YQSRLLLLVPPLLVPIKLVVIRWP
LQLK*RNLS*TTVHFRCQQSTLTLRQQLLMPEMLLSLMQPILVRFNPHIIAAHYYRPQLT
PR*LLLLQAPVETVVRVWLSPLGSINP*LPVQIKVIPIV*FHPQNQPRLRSTTAYFQFPP
*SLQSLQVQVETVPLVWCPPPN*PKLLQRIKVMRIV*FHLHSRLKLLNMEVCFQFLRWKH
QQSL*VPMKAAILL*LHVLSLGKLQNMVV*FQFPH*MVQLYIHLLAKV*WWVTVPQWVPP
NMHNIQV*SQYLPSRVPKLLFQPRKA*WLATVLQWVPPNMHNIQV*SRYLPLRVPKLLFQ
PRKA*WLATVPQ*ILPNTPSTQI*LP*IH*KLAHSKKQQQLRFVSHVPPFLPLILQL*MQ
VLLFHCQQVPAHLYLQ*LPGIPHLLLSLLQFLHTRAPLVN*PSVLAVCC*G*SHFCCKNY
FIK*KVINKN*EFFWYNA*IIFLYNVCNCNDKFLSSWIIFVLS*HSFVLVL*LICIDNFY
RRPIGF**GSWCYSSQ*LIF*TSTT*QSVLYLRSYIKI*TFFILCVFRLFVLEGLNRKYP
L*PRCTHYILPVGH*RTQVKYIL*MLICSIAVIEDFKIPSIPSHSVYLDSSLVFTNLINA
ETGKC*NRNENSNRQ*GHP**MKIYQFTVETTGVKPRPKLIASIN*D*ERV*CCVH*ELN
KKFLIPKTSAFSEPRAMMIHFQYANIA**TMMTAIGLPNMAYLAHPKSSIMF*GQTPF*H
ILRRKFKSIFRCL*IVD*QIREI*RRTGTSSNNLIISV*SHCQCRNYC*REKPPRYLMNP
CQCYVCSPNIQTCGQTPGKQTCQRKPVIHLRKRFYRIPRSASLSCIWYDLVI*VFFFFLD
AIT*KCNISH*TKLEKLDN*RKSLH****RGRYKMRLITLKNIKFLIHSMKQGNFQF*I*
VEIAFST*K*KNIKTPTCC*TSFPEN*PNI*ISI*ESYKFIENQVVYL*KSTNPCKAANC
RA*CV*QQNSHQEQVYNHRH*GLFRKIFRQQTHDQEQ*EVLLLSSRHSHRRHHHHHRIHQ
*NLLQYQLVVLLLLFSLVESHYFHD**KLDILNTKMNSFSLPTFGFCQILCAGNVHTILI
LALEMYLCLNR*SQLPYLQPFLNSYWM*SSLAYYSANFAS*K*TAT*PCLVWTKHYDIFL
LNSYYMQRDRESKLLILADNIHSSNCQRHQDNLLRFL*FSLLSHHYLLQ*VLH*SILLHF
*CCNHSTNEYSSF*AY*DYKHYASRNRYSFPIKREILLSRSSDPGIN*SHLAFVHQRMNY
CRIFLYFRSYPLNGSSTDLFFYMSPWC*PNANRHIVMQ*YLPDHETIQLVC*RYQSRTLN
NYYR*FLKI*AGNQVLSCQ*RIGRRWSYQDSQYNYFDIFLPGSL*KQSLDHYEIFLSS*Q
CLPRTSLRIQ*HLDHLV*KPCSYPKRCNLISLVLVKIHSDNLYIVQIPRVT*FLLASFLW
F*LSSVFEWFRHHIFETSYQNATQPEKKMDLPH*FL*VALWLNWTHPGSSIRGLSHDAVQ
KKCIDHYQKIHFPVDGMESKSYLLQSVQFRLR*QHDLYC*HHALESVHQQNGGIFLRLK*
YIWTYPKLKH*PGQ*IHV*CIGTNQKQCQYKQK*EIINCYSKQTFRYSRLSRKVL*YHIG
QPLLISLAIYWFVKYL*YRRYN*NKRFLLGLNP*IYSIALPHLNFFQVFYSCS**E*YQY
HQCDKYHDRQSLQLGYTW*PLLNSTNR*I**IPEDRIL*FSYVDHLQLLLLNLLVHS*FH
FW*RRHYPPTQLILHGVQ*DQFLEYETWFPFYCFQQYTFDLWFRITYIYPLQT*RSFSA*
TQMW*VYLHQGYAPLHHCSSLSCFFFALRYVTTFQN*LISNNITAFTFQ*CSAK*MRTIV
KRPIEELENFTRNIYMYILYIYV*CNCKRY*QIRRTSK*TCCNKPKWRNECSAP**PPQD
SASN*CTSVAKCK*AFW*YVSNVVVSTLSAVLVAFDS*FSNDYYYARN*RKGILYDDKIN
RSN*IISTDQKTIKCPFRNTRGW*NIEEW*ISIWAKLVKYSVERTKEL*CPETTQKKKKT
SMLLSLKRMK*SLCVQRTEDPKRMHSLNKD*RL*TRC*RRGQFCLFIC*LLLYLLL*EGA
Y*HRTPKWMK*PYITRTV*LTQPHHGATSLLNIGNLYFTNIKHIILHHNGGLWMMNQMTS
QNKEVHAKSGSLLQVI*KITYI*IMCWKNLLPITEDMYYLLAKIRYVGRTPLMRRCMMQP
V*IVSHYLRTPMVKYTIHVA*LRTQCSTTRSPCS*QM*GIRLTTIH*QIKESIGNLIKKG
TKKPNTIIHR*HLHHIGKRCIQMDTTRRIFLIFRIGKSSKTG*GQVLLIKLQN*SESIKT
ILCQRVNTSWISVCIGQYWSLMVRREST*LTVLTLAVEIHF*V*FT*LEAVFVLPWH*YY
*RFGSSAVERLLMHQVCHGI*NRKGVMVFFIFNPVKFFYFFIFTLIYVYVCVYF*IKIYK
NQIKTVNSPPKIEVNELIPRCWASLCETVFFIADLITPTVPVKVPIPIDPTEGEATVTYW
EEKRWTKVVCTVIVLPCLTTVTHMDVGARVVV*VEVVPSVMVMYESIDRLVTADTGGSVK
SVEGSGLVPVSATALPVDVVVFTLEDEPDEDTDEDTDEEADEVALVLECVNV*VNVTVVP
KSFVVVTVDKYSPEDNDEVAVGTVVVVLPVDEVEVVVVGSIVALLTV*VRVTVVPTSLVV
VNTVVKKPV*AVVVAAAAAVAGSHIVVSVTRAPATFVTTVT*VVTAAMTAADHNDKESSS
VANECNSVRRIIFFLIVLQKLKRSLL*HIQVLNS*FLFSFFHNTRYRKSPILSL*KNAIS
PYTLR*GDTR*RMYAIRRSIWHN*AVKVLKYSDIYI*NTRVPTIMIF*CPLSVEIFIIVT
VTELSLYTVRGLFSS*FILDKEDNKHEGCCK*K*NNC*LEER*AAMAKNNHISASGNSTS
GDHRLKEEVLTPTTSASTPHRIFSVDDDPKEIQNDIRYLEGLHEGLKFALHANKSKRSVS
SQSPIVHSSNNTLHHHEHQQHLPPTLESLSSKSHSVPDLNTATPSSPKRMHSSIRELPHD
DNDDEDANDDSRFIIHDSHGHDLLIDEINCQSPSHLENNDQASNASSTESFTLRERQDAI
NETHPFGIRIWKPALYKKHRSVQRTAAQDIHETQLKTITWEVTCSNVLWFILFGFPIAIL
FYSAAIVVFLLGGGGLVTNSAKEYSKCLYKLANYFLWPFGKMVYLLQDEQYLQEDKDEGI
SMQQFYNWVTSYSNRLVFHQSQAKFQQREDHPAPATESSSLMPPANTTATPLNSNHPSYN
SIRHEIPHAAAQRRYFGRGKWSWGRVLFYTIFHLVLQPILAVLSLCLWLLVFTIPMSNVL
WQIMYHCRRHPLALGFKYVENSSQSHENEITQQQLNKNILLCTFRAAGWHYYKYTVDGTN
VIVVNLISIVFFTIFDFYVLKNFLHWKTWFTYESSIFILCLTSTIPLAFYIGQAVASISA
QTSMGVGAVINAFFSTIVEIFLYCVALQQKKGLLVEGSMIGSILGAVLLLPGLSMCGGAL
NRKTQRYNPASAGVSSALLIFSMIVMFVPTVLYEIYGGYSVNCADGANDRDCTFSHPPLK
FNRLFTHVIQPMSISCAIVLFCAYIIGLWFTLRTHAKMIWQLPIADPTSTAPEQQEQNSH
DAPNWSRSKSTCILLMSTLLYAIIAEILVSCVDAVLEDIPSLNPKFLGLTIFALIPNTTE
FLNAISFAIHGNVALSMEIGSAYALQVCLLQIPSLVIYSIFYTWNVKKSMINIRTQMFPL
VFPRWDIFGAMTSVFMFTYLYAEGKSNYFKGSMLILLYIIIVVGFYFQGALSE*KATVPA
FHLDTYQFFFFLYLCIVCLSYYFLFYIVFS*LITRNDH*HLLN*STHNWVVLILREVRSS
K*LESSPHLLPFLFLRQLHCRILFWSHVVESF*DVLGWLGSANNNIGCDPLSLPKSPSLP
IMGSRRQESC*HS*FPWNPL*KANPNYTRPH*TRGMGYQE*KLNKYCVDLMSQCR*YWIL
YTNN*HFLSSVWNECIYLFVSWLW*LRRFTQRKGFEIGR*LCHIAFVNGFFPFKEKTSIV
W*ISRWC*CSLHCFKISGSMRWRYTGEYIFEYSKSYPIYFPPFETLYAFMSRNLEFRRPY
GKL*FRDAILVFKWIKR*NRSTLPHEETVRNMS*FEQKDFRISTWFTQ*YYYSRWVLGYN
KRFSNREGFYLKVIIKIFDRFIYFTVCKENVVSPHGHLVTDGYLLWKKKLHFATSSIYIM
*YLLRFKYFIDLLLILFPRFRN*YPTEYYQR**ASSKYVS*FEINFGYNHWC*K*Y*EIE
HPIDKCANSH*YGPRS*REQFGH*YKCNWAQCYCKPKNKTTSHDN*NNI*EVRFSSKCPH
SSICHHIK**IC*TI**TCLVAPFLHVIYA*YRRKEVNT*QYD*SNIRILNPDTFENRRS
VIKEIIYSGQLLKCHYHHTNNQSQP*LWLSHNKFKCVSFN*ALLF*FVVSFLIIIVIFQQ
IIDEFNYHAIRRRDAIHPRKRVFSRGHIIFDFCQVLWRFRNVNK*HSNYNCPNVSQEQWQ
LPGYILCRIFITSFAYEI*NVSH*YAKCYNQLIRRYHGASDF*WRILGEKHWHQDSGYSH
TDSRYGSSQCQKIPPSIGENLNGYTDAVHY*GKPYTTFPTNPITDF*QS*SPYATTDVKN
TDN*AYLQISKFLSRYKNCFIVMDNISCAKFFLKANHICHSTDGSNVPSKNKATKRDYQA
Q*NGNMQTRIVTNLCCLAFYIFFFII*ILNGYIIIPSPACIKLIIVKMRDVSRAMLIRNL
SSHF*Q*LKYFTS*EYVNKFFVSISN*KWLIVLLNSIQCCYLNLCHH*NY*HFYFLFFFL
FFFLFF*GPTYRFVKGSIIKESTDIQVAG*ILRSST*TRYGRA*SEPVPESESNSAVTTT
TSEEICDTETIGRREFSVY*PILQQTTWITEPSGRARNFIHNRYNAA*CLQRSRSSHKFA
QQIYAFKLE*SETCDTRHPMDPRRQKTCSSNL*RRIFSMERIFVYV*NPHAST*FGCDYN
EIFSRQ*LDD*WGRRWND*DMATKL*YG*RN*CCTHGKY*GYGIQ**RLEICYLFR**YL
EDLELQQWQTRKSIIGAPLGREKL*LASRDGVNCLRI*GQFSKTVGSAFRKLHIINSEVQ
TYCLEDAISTHQGKSINGDFKR*IVSCVRH*IQYEGTNVCKR*NGLYDTRMAPNK*IYVH
SGVL*RLAKAF*SFTKSKRTYFDYSIRP**VYHLVII*SSRTYICHSS*G*NHKILD*SE
AN*S*CI**SNL*Q*EDKWMVFWHQ*RHQCCEREE*IRCGPATTSYT*TTCVTKHEWIHQ
QETASRNPRHRFKHQEFHIARFKHIKVRFDEILGYINKKTI*HIICDNISHFWGMYPTGT
TVYFCR*YLHRIFLYSLGYSSRCNIQ*KINIASFYHVRPNGMV*SL*NTC*VNGFLVCSK
HLPKNQGHLDE**R*VG*PVVIQCLLLHCRLRSPFSSILKILLYFLAYHLSNVQ*CTPYA
IGQLFH*QWLNAECCRNRPLMTECIGSLIQMWKNNPIL*R*PAEIFLPWTLSNIQPGPIL
ADVSVL*LLQNFQGMQYHLVVGLG*LDNG*WVHIAPL*LLYLV*FY*YLLEQVRIGLF*S
SYHARDHRKKLLVHWWNFPTVPLNNLY*CRSPIG*NIGG*RLLGGTQHQMLIEIVVMQLD
GNTYLWDPEKEPSKSCWP*LKDECGNIMKLLFVLF*PVLSAYYIHLLKFLFSFFIMKIQE
SC**LCKETVRLSQMM*YVFYLQVSLIYIYIYIYVYGSNSSLIFHGL**RNQFLDGESRR
GLREIS*QLHSLFSNWSFFTHCTIKPLHV*Q*QLCILYIHVCIRFNMAIHKNNSLILDQI
RMELQGSMWPCKFLV*FVFC*GSHHTMCCLGSDKLPLDVV*FHSLFFVRFCILRLNLSRK
WQHEYRVIPGICHHLIINGDRNHSA*CIIFLCPSCSPKKLYFLFR*VLQFSNIQKRVQCF
EGNFRSTWIERTS*FRHQMLGVVIFHLSFLLVIL*FFQGVDFIKFPLLRLYSLFQMIFQL
FYAVKTLFLSLFQKFLSILLLWAGRIKTKNRNCSNCLVKNGRQLIRNMDSSADFSG*SPH
SYS*ISFVLYFQVLISSSHPSITASK*ALFPFG*VEPLITTWFNDTLKGLGGANHNG*IG
GSCGAASTTTDTAQTSSETICLQTR*LAKGAR*VQQTDWVKI*TIKDVKNQISSTEGPLQ
RRSSPILSFPVEADGSTLGRSTRTSKTKN*IRK*IIFILIIIFFH*KSSGA*SVSTIIIR
*TSE*PQLRR*AFRLTTAAPGFNNDWNSAYSSHNPHDSV*G*RRRESHQKP*DKQGYK*V
QRDSTASTNGC*AIVVGL*YGIGNMSRLSSQRTRGDKEKARRF*V*SFKQAQHN*GSPFT
DETTQPRR*NIKTSIRYA*FMSICIYLYKHYVIYTDYT*KVLFIFGFLLPLAYPNQESHP
ICLCLYSLEL***IYICISSLCKPDCLAHIYLPFHQVIHRQPPNLHKHPLYHSKPFLQLL
NQDCEKWPYKPSRGILGRPMVSSSKVLLLRPVANILHWL*LPEVKCYR*TQYSSFENKII
AAAPLDIH*SLIVLLVFQ*LVSRWNLRQICPS*Y*LIVYMQLRHPPTHST*QQQACNSPK
FSSSFERHMKWLFSNNYKLLSIYPFSYMQRSNLTMKEHDKGLMKHIW*MPPQLSAFYHIV
IQRNHKNTTFQSLMGIALTSHLNVSR*QSNLVVLQTLEED*SNTLQGNFLR*RIFQSPNF
FPIGMDPVLYHPKWSKPWHPNHFHLFFEEGFLLPFFHLQQRHNIMQSRMPYQVFHKFPQR
TSKYPATYIFQLRWHPIAT*G*TAAGGCMTAC*QH*FRLNLEPIYS*SSNPILLRGIAFV
KVLFQ*F*PLLSQ*LTFPIMIGRK*TNFCHRFDIIF*KAKQ*VLLPQEDPWPELCSLWCK
DVTATGCCRNQIG*VDR*GSNPATTLEYFLDVVPMAIVYLLHNLHLGLPFVFYYKFARLE
VHQQWTQNEASPIIDRTLKQMFLV*QMSFSKQNFEM*RIWQE*SNRHEPFADI*F**RVH
PSLQIQNLLSFSLWSRMAGTNVLC*WPMNI*HSLDSTLHKVLF*NLREYSPVIP*LSHMQ
GQQTDILQMQH*LGTQKVLESVTIASKELLPTTNKLQLIIQE*TQQR**VAEFLDPG*HQ
ISFFGRLSFQVIIVIKPNTMDHP*IRRQAGP*WLMSGKGLY*LLLFQFQFCQTNLRLLST
*LLGRCSYFE*RSVRGQ*PKIASHFLGPF*KPQR*ESHLEQQ*H*MWIFLPKY*FFP*IC
PQIAVLAGMIHH**YVQPFSHMSGRKNHFSEILLLQTAIILHAITSP*FCNH*FTFCLV*
*LLFSNSFGLDELPFSIFIFFFTMRSFLDNYRHIRNALGNAFFPL**AILYQLKVEVMWQ
NR*RLSRTG*FKHIHNGKYVLVLGIGGFALFCIIFFIFIGEC*NY*QWMGFQYSLSTI*R
IFISNGRWL*EL*VPPR*WGVGN*H*S*HLDTCDDQTNSRVQTGYSGRPLRFA*PRTSSR
LFCRCGEKHYRPYCKYFFNY*GWNWSNRSEKMERRCK*LGCR*R*LFW*RLWFASRPTI*
NWRLRKSFWCFERVWW*EKYTVCGD*AHRFIQ*SVDASLGSHQMSFHSQWNDETTFGECI
QQQWAIIICQG**RYIFRLQSVTKNSRIL*EAM*GQRR*FIRCSHSIDLAILEFG*NYRQ
KLLYDLD*PGFYLPNF**Q*LLCPMKIYRLFF*HFLVFVCVFLLGKYQNLPEIEWKMEPV
PRRGKMHEY*VGCINMLYKVHYKKSFIFARKNKERIRPYL*LQWEHLHAVRASIIVPSRI
WF*VYIMKNVSAFLF*QL*ILTNFSGNTRG*YLEYL*NSLDLGNH*KNFPMSHFVRTPPH
LNLYIRWFGSSI*LNYLLGNALQSCSNSKCGECLIQGSLLYLNLELH*HLVCYLLWNYFR
NRLMFLDRSRRQHPHLSHQH**LFLLDVPKTIEGIKDTHW*RGY*LR**KYFYLEVSPKV
SGNNGRKNEIQGFFVVENFVAVPQLTWRAFCYCLVMGYLKHHFL*F*KYSSDLRTIQLKM
SAEE*LSSNLMALQIMFLSWNCSHQNHLLYPNFAVGNNMIRRLPVR**NICYYNQLLDWI
TMGNNCITISRIYC*SSVRIDV*PF*SKSETNVIFHFQELHHMNLK*VQ**ETVNCTVHY
LRSLEIVVRIPLEYLAIRCLSLHFLV*VH*LCRNSRINSVLVRAFGDGVDD*RFFVFYY*
L*FPVFSTLAENNTWIRIL*QIFWIVGKSSNLRL*WIAGP*LFS*KNL*IHR*IQSTIKE
F*NSVPHHSESLWSGSVDSL*YQALAQYKYNGSSCFPIYQAV*FVLKL*WESHRLV*CYS
VFLRLYHTNRVYKIQQ**NLGHSYYRTYCILTTSLGTEDF*IRWILRGTLHFVI*IVCYN
HRCV*QCSTCGTRSVSKH*TLTTKVLSPK*RFGKGTHS*SNCRTSN*LGIVLLMY*SPKF
AVLTVELLLANT*GTIYR*SVVISI*YHGSYYVEGFWHQHSPLPLLLPPSQHWRPARNIL
IYQTIATVS*FGWFERLKMRFNFSYLAVAHLYVL*S*IFCWLSQKNM*CAGFWQ*S*LSL
WKNVLFNGYISIYVHACA*ALHSFLGRVRELGCIF*VVLGIFSQDVL*RIWDVFKLQVAH
VLANLFSVSFH*LFHGNMMIMEYFQMVCYQMSHFAVRTRDQDSTFLVRLLGHCV*RSGVT
FLAGESYHHLRLVYLKRPQMNLLIVLFHFIMCDDIGMQRCCG*STAHVVAYARRPTSGKV
PGNWYFTLQ*CSSPRNHVQSLDIPVAPVLL*YR*SLEANMTLFHLSSHNFDITRKCKKKK
LQL*SAEGTKNIIERRST*SVTIFNQCSHCAYKKCLNPRCPLKKSKNWPPRFCIELSWLR
*RVN*SLV*VMSHQQNENRTLQQRKEAERMPKMLMRTTKLFWKPYRLRKSLSTMIQIK*L
LYRP*NL*RSQILPQVHANEKPKTAHSRSSLGRRTLHLLRGLLLHL*SYHTLRHTTSAPM
IRIS*RQNVIITTAVTIAITIIISRRRQQALRMLHRTATTLRALIS*CI*PQVHIISHHI
MEHRWP*GCPLLHALIITRRN*V*TVIQQAHQTMQ*DSLISNLQRLLRSPLSNLICYRIF
RTNLSWILHHYT*AIITVVSRRHYRHSREESPPQTHCIHLVTYLPRLQEN*TVPILTYSG
RPTSTWETICIIFSALHQGSPPSRERQTRQLQFLLFQRWCPDHLPTLLR*QQLLYQATPQ
TIF*I*TQTGSRSL*DPAPTV*AKGSPLMTNSLIDR*RPYQLMIPYFLKWTTQRDKNDKC
*NYKITY*YVK*HSFLGKFGDRLSLCKLMYRNIQGRYFT*FTFSGGLYVYDCAPSCVCF*
RLSLQVSVWCPHPSPLPLLRLELTHFRS*KFSSSTLLIFLPSSLSFYPSLLVPWNDKVQI
SSNQ*IHLNQYHRRRKSLLRSNRNSQEKLHGNETSNLAPLLYGFYSFFLLLLFQPPLLVL
VCFVPKHFPLIHLPFSFLSSFAVSLLSCSSFFLDLLPRLLLFVLFPLHLLLFGHHHRRLH
KSHPLFRHPRSR*AFPLVDKILH*IIQLPRYPTLLL*NRSSIGCQ*FFSPCRH*FQHHIP
LLVALKCQSIYSIF*SSFSEELSPSLLLFAL*FFFFPLFFFCVKSHRIFLV*LDYVHKI*
FQLRLGPRT*NCRHSQIFLQHLQILHRPLHYC*GQEKSPCPPS*ESRPVDSQILPRNFLH
LRLDPVNFFLPSS*KVPFSSKTHRLHLR*TLHFLHR*RHS*FHLKAEFSLHVVARRKIAF
RQQLHVRILRHPPLRHHQKVCSYGDNLLGK*VYASPHDWPVWQQQIRDPRRI*L*DLVVC
PSYCF*WHLALD*YRFPLHQ*SIHRNHLPPLLPLRLLPHLH*ERTICLLRLQA*LSSQRF
QKFLW*QYPLQVRPLLFLLVL*LF*RQTFFLALNLGYITLLLKTMSILLSEEMVLLTR*D
EIDIFEKF*PMTLRLLRVILFSHINIKK*RRYFNNTFI*VMITCEAIYYKPRRPN*NYKL
TLK***YFRLIKEQEIGKR*KKIRNIK*KIKKKLKE*LDKRSV**YQMEI*IYFIPKNFF
SFPSEI*TADQR*KKS*YFVH*IFRGEREQINRKLLFSNFRRFNFISKFTQNL*LKIIKI
KQIW*LDWFSETSW*ESVIIP*FIKELMGKDSSWRQSLLWFVDQYFHQKIDTIWTGMAKI
LLKPLLRRAREQWFGK*RAIVGRIRKENESFIGRT*QFSNFP*L*KGFLTLKYGFADKHL
AHDTTKPPYIDLGGILGTTNDQFRRSIKS*TDVTN*RLVMFQFFGRPKIADFQDTGFRVY
KNIGWFDITMTNAKTV*IKHPAGNLISV*PDMF*WHF*LVCHITINLDL*SFW*AFHGKV
LINFIILRGQMSKEILQFNDIWMVGNPQNL*FPGLVLGMSRDFFNCKGAQPVFLILG*IC
LYNSPKGTSTDFPVLFHQHPPRVVRFIRGYIVCNEFRSPLQRNTILLFRRHMY*NVMEWG
FRKIKRKLKDEAKNSVVLGLTPINKHVTGLPTLLTRHNGTHLRNLCRFPLEVTPALFRI*
RSLFSVLFVGH*TVITYELSGSKNAAFESHYSYV*SYNSCIIWLHAF***LQL***SLSY
*YSIIQPKIGTFYSSGECLFRTS*LFGIITMNWERGKTK*E*IRWKAVVLLKRKSDSVNC
YSYV*CCYNLFGKAADGRSLSGLSEDGILPARIEEFLFHLRIFQIRRISRISRILRPLTQ
F*QSQMVVVRFTSPKRK*LSTFYMASLLKITRI*HFQALWRTRTFIRIRDLRIMIQCCTI
*TYPRK*RFRYLQVV*GLGRQQEGSMKLHFKPVVECLN*LRKRTC*TKISKW*WTTLGRA
ELLLFPLLLVRKGPVW*KRL*RSAMPPN*SLVV*DHQR*EDYDQLPLCMNYKLCKRRRNI
YIFV*IIRFFPFFNCRR*SWPKSLK*TKTN*RCPGKASWRI*LLHQDTLS*KSVAYR*KD
TR*IKWHQASRKAD*TWKSGYSSRKARP*DPFRS*SIDPSLTNSILTLRNSARSRISLIV
RSRKRRLRRWW*SAEPKVLYPYRTLRLPATDSKPRKE*KWRAA*AFACTRTRRTKADAFA
LVPALRCCP*ATVREHWPRSLRDEDLLPAKCTILAIPPCRCRRGRYAT**SSAKKWKR*P
SSRTTNWPVTGMTAESKPCA*TAGE*WVRTR*PPWNI*SLPG*KRFHPGCSQAGRKDVSF
ALRKEVEDLTY*LDSISFYLLLLLKYCQE*DECYS*FFSLSRKDPYYSLKRGAAGYPGCV
AAPICHRPTHKSLEMNYSWANAAITKIINILIN**QVGLTYRFSREGSGRERRKERMQLP
LAAAHRHSWPLRAAAETRQMLCT*RKC*YVTI**YKAFISLGTGTCISISYIRYIIKSIC
PRESDTH*TSSRPRRYRHRHPVHRYGLTNPIGKLLRQRVLHLHFSRMFIMVARF*ILGWA
**GHLR*TSLVRLAGPAAVVPVQ**NRPT*SCC*LEMQT*GRQL*F*AIAGNC*HERKCH
DRRD*GTSSSNSIKT*D*RKLW*TID*A*KRKENGTALTILKRSSKILIILQTKQAISET
RTSVMITTTKWRILMRLSSKPEVLSE*TSRRTWST*ITGFLMSYCGTLRDKNGTKTQSFH
HCTRRLMR*Y*LTI*QMRSPSKAVWSGG*FRRWKTFLPRIC*KQDFFWWVTRLTFIRKGR
*PIMMWCKWFRKCN*NMVLKFRETLK*AVNGSTWWREP*I**Y*TWLRTDVSKTMILVCR
LQHLTTSRDMSKNSTIQ*KSLSISLGNVNTNLKKITQWILQNLMTTLQIINQFVAFSLRQ
IIQQDSQAAIVQYANVIICTNIDALYNPTIYIIVKLFTTTYSSMVFLMFCRGKLKSCHFY
SDRNPWFDTFYLKKTKSIYFGFGYIDDDECTYKMAKFK*INYLKSILFELNDNTIV***Y
**KS*LFIFNNSLIRLLPKFERQYDPNLFDRFQRFFYHPLERFRQYRFFPKLARPFC**N
RKHQCACMV*HLCSWHHRTICSTYQHRLAFSCKCV*QRRQHACRTNLQRLVVAFHYQKRS
*QCQRNLGLLIYLVFARKKRKH**NLELQRL*LKKCTIEMLLLVKSFLVKIEYGMLSEMF
IETTSWCGSIVVSGCCLN*RHKNRFSLLLHYHGYRFPSNLNVLVQVLLFH*KTSHLVKTS
YQSIPINK*LPLRLRTSFCIVGSKYSLHNYSNYIIIV*LIRSVNAQ*R*TSIYQVMGNSA
LNPFSQSHMFSSRCFPPNIHSFSKYSFNE*KLYVPNGNTCHLYYLWFYTFVVNIHKNPTL
KFH*SILTIVSSLMFAY*NGHTNRVTGGSQGAVNWRSQYSRKNSNVQNLTKHQGLSLELR
PAGLKRA*FIQGERTDVDAIFLSKHKKLTSGRKSIVHQRYMVWVAKMFGCKVVLKKNGKS
V*MIVCRFMHRAE*LT*Y*TDRFRL*SYYTCIYCSQSYGMEKSLFPNLIYTETRKKEQRR
KIVRFQTILDYTLKPLDLLLPLALSNFLPVDKILGALPLCGPIPKCLTASLEFLGPLKIK
VF*PLGALTAN*SKVIHSPPALTILALAPAVNLKAATVVFGNSKILASSVTVPTTTTVLL
AAPSCFKALAILETETGGLLILDKNKAFKTTLLNGASVRPVIKTRKTKVFTLC**RDKGF
VGILDRQLLISSIN*SQKECKTKKYQFVFLFEEKRFCSVNSWSALEGRIVLPLVLAEFPE
NYRFLF*WKSLTQKRTNSTFV*EIRRTQRY*D*SH*KIAGTRS**YHRILLS*RKLGGRF
QYIRARKVYSLTNNFK*TLSDFGAVL*PDLLCCLEV*SIPILFFVFF*LIFSFYFLW*NR
*FCSKEIIQWFK*KQEV*KFFYFFFRILS*LS*NNEVG*RVWCTEVFFKRSSSKKEFCVM
ANEVSIAFGKQPDFLGVNMKFFFCYFII*SMNENIKRAETTTVQCKIKKIYRSQDVVPFF
FTLNFVSSVTWLECNPTFAKRLLQERSNCPVLVHS*VKRKPYRARWFVSHRNRTRHFLNT
SQGKRQGLRF*WECRGESSLEVSLFLKKNIGHPLRN*QRRQKLVYVFKTARHEKAGSTKK
*RENDGIYSH*QSPKGEDPDTKCSRVTTLILILYFRIRHRQINSV*FWRLLV*SCNERW*
FSRKIKFVINTCMCIYKALYMALKLCYYAYSIFIGTYII*KSSP*KTNCIPSLSLPSANF
KPTFYLPLISISKYNEILYSLHRCCHCRICFRRFHL*WCHLRRCYHHPTKYYIYGLHREN
YFHSIHYKYHCHSIH*IYQ*PS*HHHP*DQHIRRRCR*RLRCGYGCHHGCCCLCFVISCM
DNLN*EGYSASFH*FHIFLST*YVFSLSYQIR*LRSKDSLVILNKGTSASFS*SSFR*GR
RRHLTRPLYKLITTY*FNDMLHLFSCGYPPQISRHLISSQLKKKKL*KGNKAILDESKHL
**QFTRLSWFVSLAYHFLFFK*TNEGGVYWVVMTRLKAKYSPTKGKRKEDKHTKRMRKSS
FTRTQKMLEVFNDNRSHFNKYESLAIDVEDDDTFGNLVLMENDKSDVDIPVIEEVTSSED
EQRAESSKRNNSLEDNQDFIAFSDSSEDETEQIKEDDDERSSFLLTDEHEVSKLTSQQSL
NTESACNVEYPWIRNHCHSKQRRIADWLTSEIKDFVHYISPSKNEIKCRNRTIDKLRRAV
KELWSDADLHVFGSFATDLYLPGSDIDCVVNSRNRDKEDRNYIYELARHLKNKGLAIRME
VIVKTRVPIIKFIEPQSQLHIDVSFERTNGLEAAKLIREWLRDSPGLRELVLIIKQFLHS
RRLNNVHTGGLGGFTVICLVYSFLNMHPRIKSNDIDVLDNLGVLLIDFFELYGKNFGYDD
VAISISDGYASYIPKSCWRTLEPSRSKFSLAIQDPGDPNNNISRGSFNMKDIKKAFAGAF
ELLVNKCWELNSATFKDRVGKSILGNVIKYRGQKRDFNDERDLVQNKAIIENERYHKRRT
RIVQEDLFINDTEDLPVEEIYKLDEPAKKKQKAKKDKREGEIKKSAIPSPPPDFGVSRSK
LKRKVKKTDQGSLLHQNNLSIDDLMGLSENDQESDQDQKGRDTPSGQDEKSPLETKTVDA
QTRRDYWLSKGQAL*HNIDSYRLFTIYTRIPHRCPSETIS**YQTRGYFPFPEI*SHQKR
IVSRYGNFLEPVR*RNFSSLA**KHSMERAGESDSRHII*KNLLA*ALYMY*RCQLFASA
ANKIKTLSPLFRSNVLRY*KPLHLLLSFIPGGFFGVINRTVKLKHKRNSAKYVSFSCSE*
DI*QRFPKYRTGT*TSQFK*PGPYLL*SNATYNQTYESTGFNISVPFRYKYLQKKKRVGV
LQR*RYTFIYMAKEIPDATRFVCSPLQER*TK*RCDLEDTTN*YYKCKQDTVETILF*VG
ALQ*PKFCIIRILVLFECIIRQ*LQKINIHCYKDRKRFA*LVRRHFC*MSIIKWCIFSNK
LHT*SSRWF*SRNR*FCWYAHQLGKIIKALQNYRRRLEQ*FCGCHSSVAVLSRV*WSRKS
HKYFRQASKW*NFLLSKIAAKQL***QTQK*FSKFKVIFRRFFKYGITEENLTTTKYQIA
CFSRKRLTATNKYKIAH*SVKYSKTLTKCSQPTIS*DEKRTLPNQWPIS*GTYASKQFST
IFAAAAAAAAATKTTASTISIPPSRTISISIPISVSIKPL*ATSQYDKSLFQTTSIAIKF
TVDPKPSNSTLCTKLKSYSRTLSTSKNSSKATNISSKGAIPIKSKCY**HTCTACCT*E*
PVNPTNNEAGPKETGCRCRTTGWCGQTEEASKAYHVNCRNNE*AEESHRKCGSISML*SD
REGRSRCKWVRLPCREDAYSDRK*YDRTHKQ*Y**AARRR*SCYQANGLI*TTS*RTHSE
*NFGYEGFTS*KYRQFSRGLFENRR*PMGCDGVYGRRFTNRHYRE*SHQR*FTFTTNRTP
NCIYRTRNLPRLEISTRQAYHS*GY*IR*CLAGH*S*GENYRFWVLRQIN**KKQKSHYG
WDTLLDGT*SCQTT*IR*KD*RMVFGYHDH*NAGG*TTIFK*RSTKGVVLNCN*WYTKAQ
ASRKFVFRN*TLSKRLPLRRC*I*GINRRAFTPRFFQYGM*SKGFDITVGVEGMKHTTIS
ISISYILQSYVFLFF*LCIPMA*YINTFTLKVFFLK*IKKDLQRYNNQSNVV*YYYLSYV
IFKNIRPCFSF*SSFVNPSDNSKTLSWRPSIL*DTGMVLKINGLNVCRFSTPICLLPRVE
F*SRTPLKITHSPFNRVASSVLRNFGIGARPIKYSSEIYLLRARAILAER*GAVNFLNFS
FVFNIKLTKSCKHSKEHLYFV*KRGFVVDPNIHEKSNEDSF*DNSENVPQSCIKAFSNSS
NSYKNEQSQTA*MKVSNCLSLKRSMILFSSNISLYLEYSFKSSISVKLSSSGLILCNVTT
ITFINKSQKLSFNGFSASSWSDLKILFDKSQKQLEARTHMGISSLSDPVISDFRLMISAK
FFNILKICFAFSVDIPN*SIFAILFLRLEHDI*LIASKVGNLLSDAFGSFGPSFFVIFSL
VSKANIDIVLNWRRIKISVSLESFVINISSPDNMAFCIEDGLVLSWTNSGKRGYFMAELN
KRRTFSTNSSVIASYFDINW*RGGNPVISSYIQSYSVLLDAFVERSLYVIL*SVNISQHF
FNISDGTSSIVMISFSRV**FNITAFLVLLEVEDNNLFKKSNNIDHSLAQVVLFLKSLKC
SG*SLINPCNVTFIKSVSFSSSSVDHSLVSSGSITSKKIRSHGGKQTEWESMILKKVCTA
PFLTSTLSSLVQLIKFFKRYIHNPL*SSQS*DELDVMISINF*LLIFSERLLRFSSLKFN
VSGLKRTLR*SPTNQN*LIEEKEILRFRF*LTKLTSVSITNLMTLIGKLCKKSSEISLKT
SYDTWIMFLCF*TIPSNKDESSISSFTEKSVSSTVHSNGELMMLKILVQEFINSSPNSFR
ISFKVSSN*KRISDSTLIVPLYISCLPISNCFIEFIVAIKLSMTKFSNVPNCFTLLSCSS
ELPTSLVAFLMISVNTLTVYKRKESLSISRFDINLII*VEIKLQSSLPFFPKRNFLQL*V
ASSPILLTKNALL*MHGIISSFASKG**PMSLFRLRFVCSKVRVFFESKINLVNTK*KVE
QE*LLVLSKNFVRELSIDVTSDLVSIGGGGISSE*KLSLKSADGPYM**VIHCQVKKVYL
QLSESKIGPSDIDNDINALSKLTCLELIFLGCKRLFISLFCAESAIDLLGFFVDSTGLVV
TLDVDIFLVC*FFADLLVSLKEY*LDDVTLFVIKIENNFMHALNLSFSDRTPAL*ANF*K
ALTTKWNIDVSKEVEYKKSLFSSNRPENRPL*TFTTVESFPVPSSRSLSSIFFSRGELSR
ADLFNPSHKWLQMVRINDIM*VILMDGAFDLSNKCINFVLTVEFSVVIKGESIFSTTFDG
AKKVIYSGEFNKTIHSFKRYLNTCFLSG*LS*SI*SVLTISGSCDKSLKSSRDSTLCHPL
KLDSTDMPWINSDKMTSNSNSSMLRYSFLINNFKQRQLLTAVEKCLEEDMQRRSNGIALT
LSRYCKSWHSKRFF*LFFKIDSRISRP*SIGMSPMSNSISSSLTAPFELISFNEQILSNN
LLASYL*TLTLIDSLLLMRTSYCLSSTTDSMESLSNISSISCCKVALAVPTTTGALLGTC
SRFEQHSNNFLQSGP*MNFPYVLKKMGTTCKTFN*ISIAR*VASMKASKISDSRLRGIDG
TVDSPCRHCIARVVILAFLDWQANTKGSAKSGCLSSSSKLCTLFNISMDLSLAWRMVEFL
LFDSEDKERNSASSCLCMESNPPVFMAI*MVCNRSSWFTFFENHLYCIQSTGFI*LGLGH
LNY*HGRFKGHPRRPAGFIRKWDNEDFAMTL*RIRAGGLRKSATRSEESIC*LLGQYWYT
PLVCSIFGESRPYH*IIAEVVRFSRTLRHGTPSTSKACTVLPQFHPTWCS*AKYD*SEL*
TYVRQGWRER*ER*LQ*RKGFFQRFGEGTVEDETSI*W*NSY*RGRFAC*VASAAGKAAH
RPRI*QQIEDIWF*FAFIGS*SCVYRLYFE*RGSHGGPVCRLSTLVSGELRFSV*CKKG*
KLS*VRRRSSQYTGSGRFRERWQTQCAGDY*GLTKNKFERKHS*YGTVTIFAQT*TRNTV
GRIYKWHGL**HAFQICAQKYYSENEAI*TFAY*EKKSSEECKKAYYDKTSVSQSKNQ*H
PRVSEFIP**IPFARVTLQYKTPSRIWIFKCKYK*KTENVKSKKRL*T*TEKLCIQTHIY
QK*SGTVPQ*TN*VK*DTC*RIQKIDKAIHT**VQERTLAPGRLCEQIKGHKETV*KITE
DENHGPHIPSLYHDIVNFNKFQRL*EI*KQNQGVY*KNHSAVIR*STIHIFFPRWRRLYY
STKSDS*FQENALVKIHQEAQYLLGEDYT*GRSSQLQ*QVCCY*ERREVYEVSH*FEYTI
IGNCI*RMGLL*VILH*VLIHCSIM*HIRNSCKYYAYAS*ACMEYINM*VCCNTVSAVSF
KYGLYGRW*KWQSYCYCLHCQLHIHRHLHLPRSHRHLHLN*KRHPLSNKCICLVCLIPTV
S*PWPFSVWFFHFSSCCYYCGLRFSGRFGL*SIKFYHAHSLISSALHLYKFPYH*NAFDQ
CFCPLISDLLGRSVIWSVNHILPNYLTYRADPLMRPEIPSWLKRFEPLRRTWQTDSLVAL
PRR*VFPKCFALPLFFPKHLIYPATPM*SRSK*HSMSC*TLHPVPISISSTHRQGRNPVI
EAPQE*SIA*VNPFD*I*TTIFFSARCDK*RLMHMTWRWQYGKGKQMAAESASHFCVL*Y
G*QTVELPIKYLRLLLISPQ*KKLFSFPELFEIA**QCRLGKIGTLK*PRNPRQQMSYHR
KRCA*WNEPERHHRHCALFPISATPS**KSLSSTRLTTRLSSVVVEFSYMRAR*YLYSIS
QSGTL**QN*KLSTKSQHKSHTQQNRRHNRLLE*IFASH*SPHQDTYMGKSFLAP*IHKR
ALFHSRNS*K*YLLHILPNCHKEAIVSAPLNLASLDDSYCKQPILLDYVSTSSCLQNRLF
IECLPPYVLLKTIV*ND*LSAHRKEENR*RTPNL*YQSFVFLVTKRCGLLF*STYLYSPI
QRVPSSLSIAAIFLFGQYQN*QDQTSFMSRRKKVAKNS*RDI*KLCRSQRVAHPEPL*LA
CRTINRGSPCKIGRYWRIHTKG*EGHLR*NHRLFLTFMIKCIQIIVLATQLW*TEALERM
IIALWNQVVWAKHPPLNMMGI*ALLTCMETKWNPNVPKERMMMIIMAIMVTKIWRKCTVM
TSIWFLMMTTVSV*NWRVPLVPQVRIPMESTIPILIDTVSKNRIITYLKQNTISGG*NIR
STAFAVSTNGNCCWRKVGCQ*PMILLHDFHQRVNG*KGMSERAFQRNGEEMHGGISLEGK
RS*TRIKASIHNFYER*SRSRNKTLMKNKFKTWILLNVT*IEHFRTIYISKVACITKRDL
RL*NLYAGCLLRSLSTIRRLAIVNL*TFLQACYCYF*TRKGPFGC**LLLQDTYRGCIIS
I*KVLTSTKGY*CYVSKNIFQKFGRTLSLPLTTTKKITKLFLRQIKKFYSICKRMSSCTD
FRPLLCARRAGS*VALSV*CR*RPRLEYGIVCFTRNHIFYSKFRWLS*N*ASMTFRK*NL
VTIR*IILGALT*TREADQWAKKIAIWKFFRSYRHSLRHY*TQMRSLRKSFSKGDLI*IG
*IRMK*TGVENLLPLSVSNLRHMVNFLEIQHQRQICQLMIIQIIKVST*QVMQSMKHYLQ
RYMGLKRA*LEFIGIIASRRK*SR*GRKKTRVTNFCFLFLFLHKQICDN*LAYKTYTYTQ
TYFFLSIYISENFVWRFFSGIDLAIFHDIF*QRGEKFVKDELSL*IV*VRASHKKKTQSR
GT*MEYLLLRSLAVLHPISLC*SCNML*LKVKYSRRKFKGQQRKESSNMKNRQVRRPARG
NFVKSQR*RWDTEALWIRWPLVSW*LGLERAPKNLQIIFQAPLKSMKVKPCLVFPLLQEM
*KVRFCPRTPLNI*ISMI*RLWRKNLLDN*SRRRQYTQL*RWMANPCMNMLEKESLYLEP
LSPDKLLFMT*RCFQTLLNVIMTIPY*GPLQKKLLIP*KI*MQTC*TMFYTFQKNIQRST
ALILRWQR*KNHFR*VNKKSKKSKKKEILIGLQNCTSKLMCLLEHT*GP**ATSVNL*GA
HVIW*N*YVCNSRTGLLKKIMCSN*RILLKETRRCGVRYWRRF*TREQLLML*KS*RKQK
RKYQRT*RNV*FRVINLVMRLRLKQLKLLTPKNILIH*KEKSNRCKKEEVRTIFFFGLVK
TTLSFYLFFYVYI*FKKNRCTYAFKSFNFFVIVRSLLRIVQWMNYHQG*VTYIITG*VVS
VHIEIVTLIKKIFRSKIIRTGKLKIAWAISY*CIAHVNTR*NFVIVIQRFNKFIQIIITV
VTFISVDVVLGRRRGASRN*YCTYPITISFGTIVTSHDRRISCVFVCVTGY*L*SFAKIC
I*CLCNVVICLRHESFITHRK*GCRNRVSDVTAEVQTKDQRADIGTSCGKINM*K*NAAH
T*QPITITDFLCQVRYISC*GIQSCHVKHFCHATTIFCNFFLNRQVSTL*RICTI*RNCC
I*CILGRH*IWSIFHSTKR*IIVLV*LNRIFVRVNIQIVQGWIIY*IIVINFGVCGDIPR
***CRIHISVQDLYPRPYIPLKNQIVLRDTQSIFPIFRGVGTGQRLLRSGIH*LSDHIKI
*IRGGSVRARRLHWTDG*CLDVAILKNCTLTYIWVL*NRFIKRVVYC*IHI*SIHGHLAY
IAANKH*HFIRGSKPITGGFCVNGKYKTVFFARCYVR*DRGPFINAIRIDDCLLTSSHNV
FLPSI*AGKL*GNILICERIEVLE*TVNRSGK*AVNHE*CLPHYHP*K*YCRWTEIVVLR
VLLQFSMAVKPVKYLRNSQNGTSAGRNY*GNFPQPMAQFQ*PVLEKTTRLLVELLLRSDG
SETISLLYYVWLLNFDLFFFWSVRDFERNGKKL*RAQDKYLFKA*IIL*KV*EQARHTRM
STSTEKRSKENLPWVEKYRPETLDEVYGQNEVITTVRKFVDEGKLPHLLFYGPPGTGKTS
TIVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQIFSKGFKLIILDEADA
MTNAAQNALRRVIERYTKNTRFCVLANYAHKLTPALLSRCTRFRFQPLPQEAIERRIANV
LVHEKLKLSPNAEKALIELSNGDMRRVLNVLQSCKATLDNPDEDEISDDVIYECCGAPRP
SDLKAVLKSILEDDWGTAHYTLNKVRSAKGLALIDLIEGIVKILEDYELQNEETRVHLLT
KLADIEYSISKGGNDQIQGSAVIGAIKASFENETVKANV*STQICIDTICTEQLHCAI*Q
HNTTPRTK*KK*KK*MKAFSICIPETVNQLASS*QLRMRIAKLLQKVAFRYVICTLTSWT
*RMAELWL*CSANARSGNISQKGNSGTNKNFVLKIASGAKFFAEACDAKATRNVGSQMRL
QGCGQILALLWRIKGMVASI*R*ENIYKVNRPTW*WD**ACP*LLCLGITIAYISNHPLS
RTKTITKTINYTNNSKVIKCVNTARLFIFCSSRQ*RMT**NS*QTQH*GLFLQATTPRLP
VLQERNTSQGCHR**LLSLDWSDTPTSTHPLCSPLRAI*TN*SVFCPGTLLVSPRPSIAF
SWPV*Y*VLSFTMTLLL*TSTGLGTPMVSLH*RISTLWKGSCYSC*TGTSG*TQKI*S*I
CSLY*SPSSKTWQDPATKGRELT**CP*TEGLVLARVLSDQTTDSNSTKNRETCR*HPI*
VLLL*STVVMI*EG*KM*PT*RTTQSLTRITSGR*RNGTTMSTGKVGIWNRS*VNMGFNV
VNKMALTGLLVGERFLIEHN*RIHNIL*I*IIKDT****QSTEHNIKNGICYCMLSPK*L
CRYNFHSGDTCNMRKKKDKFFLLKV*KADIFDLNAEVFSQWFMFYI**KK*SNSKVS*CE
PVS*L**VYQRR*HFVS**YLNT*RR*KLNMNSRKNGK*REKSCAPV*TWMPQVLRCPMK
H*VYPNF*SIFLYFLFFFSLTSVTVL*ANCLR*TESICKLNLLKYVGQCLYRSVK*IIEC
TPFFWA*NRSEILLGCHWSISVLLIQSIMYLHAWSGLFYVLTAFARRDIVLSDMARSRLN
MLLIVFLAYTIVL*FLHTLMFKIETTKQNNKKNKQNLKINKRRSKPSAFIECFWECK*QY
YCKSTTISLYHTLLLLFLT*SEMLTECIRERRKPYYAHLSILDYCPYLYHHCKT*APH*T
*ILA*VLLAGEEKLHPHTSTC*EFCCEQQEAKSKFKVIYA*KTL*RDCKDVEYAS*KPFI
F*NSQVLTNLRVCVFLLILTRLNFVPEATTTATEHPLNKLICFPLKSQYMAMEQA*TWVV
VVLQLIIQDLCPCLGFQLQWVQA*INKFQVEAPC*WAILRIIIIAMKMARTTAITAITAV
TMLTQLETIPTWSIIEAQCML*MIPMYTTGFVN*PTALKRNKHCLN*VAKENSLMTLPLC
FGLPLV**PHC*TKSFPYIPCCNLRCSLTIYQIVYATL*FFYSVLHLTQRQNISFYRPIF
LSFFSPS*ILPPGKELLST*D*LH*V**AHWSKMTHKT**RFC*EPISCRYA*GSWNLLL
SFPRQSPFSFYRKSY*MTLDCNTSVPPWKGSTP*LMS*KIWLST*P*AHHRDDY*NISLD
AT*D*ATISKHAGY*K*SYLPN*EITLLRKY*ETTSGPRDVWHNCY*H*TKKPHDASP*I
YYCFSLSIFLYCFNLAFLF*FHFLTSPNFV*LYLYA*NV*SPLIFQNGLS*VPEGSSVLL
LLPIFHPITRNVPLVSFTTTPRTTILFFSKSKGFVKINEIYIGVFLDTSCIVENTILYK*
VQGRNCVCSLPTYFFSYSAKPVFLFLASSR*ARKHYRTTYNTK*LNKYG*DKSQEAILNH
RANQHVCTYLQKV*KLDLGRFT**NDHLSGLYEHV*RITCQFQEMSFIDFSLAETLGPGR
NLPTE*SNCIIFLYLQIISTPERSFKAGCLFGNQGIEWHFGGCVDGNLFNHEGRSKRFRF
D*A*RY*IADLCLG*IYCFFR*KVIKKCRGK*TSFNILSSIMYFLSFAAHFRSHYQKIHQ
*NSRSCFGFETISKSTR**RILSKLHLYFSISCSWVALSTEEN**NGVTKIG*TFL*KQF
YEKSIGQGRIGQDCQRFDL*GSSII*SIQATFV*LAIQQVRICSVGNGEIDYFFRYSQFP
LSGSRVICGSYQCFTVLTDRSSCFF*IRCIENLK*NIHGFTRKDCCL*S*TRIFN**F**
KHFYLCNHHFIEDRNFQKYFISDFDYY*FYP*CQ**L*DHYY*RRSYVVFELPTGMEVNF
ELLNRCFEK**RWIQI*KQYCRSINRYCFICSTV*RTRLRKLV*FHRGL*IQRNTSENTT
SFG*RRSICPKSIIIC*TYL*QSGVGKFYY*ICCRCSFI*VCFDEERSYLI*VNHKFVKE
NR***RR*SQRQSHHCTRIH*FG*E*R*CYSTKSNRIQIFLRYSIIRVKIKFLHFLKY*F
ICNCI*CESSS*VY*G*NEGNKSEEKARTNFQSKV*NHFGYYTRGRECSRKKS*R*FICW
SKLGRPPRRSTSY*VR*RIAIH*TN*TIWSISK*F*GYLIN*ARSRIRCTWCQTSLQRQC
CFTI*YYEYSDGYCPRQCFCSLYP*NF**S*IRRAIHPTSGQIITIRGSSLLRCIQKT**
NCNGRFLEQLNIHYKRNKP*H**AI*W**RFPR*I*N*LDFLECW*LC*EFFHW*LLRYI
**VAMRRSCCFQHSRRFIHTRSSR*DYFEQ*LLTGGKYPICSK*FKLPHLEIIW*ECFNW
I*SSPTD*DDQEFERSCFESSW*R*RQLIML*SGEWSNAVSCEILFQLIPSFVINSIKRN
ASALASVHANKGMNSKNNNKPKKSRIEYDGSSPHEE*IM*SLYKQNF*RKIL**FDKRKR
NGRNRTTGQKKVDIMQLMKEEEEKKQKKSTSLTRHIVKGCRPLNALHFSLYSVTNITV*Q
RWMLMNWN*KVI*KN*KKKNCLEGNS*KRVIFRKESLNIIMPQKILQYIFLVFPQTKQRK
KDSLSSFASME**EPIEMGNPFASYM*MIKALSKGMP*SLIPRKKVLH*QSK**TSRSSW
ENRSGSKEPNFKTRKVTICTGKKMI*RSSTDLSLQ*RG*KKRSLKGRGK**ITMTMKA*Q
KLIER*YLPTYSIFTNHTQMMI*MIFRKIFWKAVKR*VK*TVYLYLPIRGKRRSSLRTIK
LHCNVAKS*PDVILMGKSCLLSFLEMRTLQAQVTRMRTAKWKMTLYRTAVKKCITPISLV
LK*NK*TQCNKQNGLGLYDFPVQNKCRYNT*KCKQCHQKI*AVRESNPCPHLGRVG**PL
H*PPMCWMV*L**RGNK*WRLYHHRNTAIT*KGNHYCDSNCWNKPNLFR*CWNESN***H
VLLW*QSNAYIVY*CTPRIRLSVIAPIAEGMLNEKLRQY*SCV*EMGEC*DNCWDSIVDK
GYNIRYTEYTRSSPRGYRNPQNGIYISTY*YYDYSSFRFICFIILLHYQSLHFSFL*PR*
QLLITYVIILTPYMIIY**YNY*LIDDSGFLFQHTTHNVIDLMNPFVC**FECFYRKRFG
HYVCNILFGFDIAYVQMIS*YFISQSHCFSTKKSVPKFLFIIGYNYTDCRFTVG**SFGN
WFLVKFLYQVT*II**WDRFTYRVYFCFRS*STC**SLGGLSSNYLSIK*IYVANL*FII
RLVAIRGIAYNN*FICWLNRFAFVPY*LLISRIPYELYQFICHI*HLLGRK*YMLCKCVD
VV**VKSKFISNI*C*TYQLLHFMYLHFVIIFF*L*FLLVYI*TWLTWSTKFPSFWV*RY
V*FGYFFS**VFHTQFHVFTSLVFDFQAKNVILNFLITFA*IYNLGVVLHLKLLYNSFV*
I*IFAKQYHIIYE*TNCHLTVFKYA*PSTNFFHTTLLYQV*FDSFVPVRTTLFQSIKRFL
QTY*LIIHS*MWWRSYV*FFFDVCIQICRRYV*LCNIVVIV*CK*QGCH*CIVMYGIGLH
A*VVSVRMLNITSRNKSSFMSTVTFPVKDKH*IYYSFGVYFFSVIISVSVPSFHLQQLVD
FFVVCFDIFFFFFNIFIIGDCLIVS*GCSYWFD*FYCFYSCNQVNSFLRSRRF*TTHILS
IPCVS*YLNFSFIIF**SFLTVDSSIGIRVTNTTQTGISLTRIDRWKFFKGV**FGRRFW
RQIGKWKISNYRFLCILLRTGI*RFDRNDVV**ITF**GSIDRR*TVYNPFLSLLFACLR
NSFIIGTTRTGYWYVCMISLIVTVRV*VSEIFRFTGVRRFMCVILGHGSK*RNI*SMHTT
RTSTLDIGNLGGARSLL*WKDIRFRYVGINFSGCANIGFRNTFRIFSMS*RRCGIGWTHS
F*KDISRLLRM*FDVRLEVMVRFYVKIIGLLDLI*RNERLI*SS*TV*VFIESECVVIEL
I*SGFLALKNNIVSCIYCLL*GWKIDDISIRVSRRM*SVAWDATRMYFGVRVVIIDDNRL
TER*QSTDIKSCQASMLSCRFFAFR*S**ISHNSRKFDCREP*MVR*TTTLQLSTAVI**
GTVEPFSDSMCSGIRCGCIAWSYTIFFKEFMESSVSILRTTVHLYNQDTGLKLVLNKS*Y
RSKNIEDRVLATVV*WINPTEFCCLISK*DEIGWCTFW*VVNWTKYVSM*VLKGFV*ILV
F*S*TFDMSVFGAFAD*TIRTLIVNSTRPVDI*FVKIRDGVIFK*VSNCLCIGMCKHSMN
ERIRIFACTFTCMDIIDGGYGDI*WKQVLFRYPVKVSIFYDRCKYSAVRSF*DVFGKACC
DIYCSQFIQTE*VIGYVRSVQYLY*CFGVVLEVKL*VTNSVNWYISFLSINYVYARIR*C
*VYVVSRSYKGS*CS*IEKEVSREFIIRMISVIYRRFSKFLA*GEGRVYSSIESVQ*LIL
L*DRYQGRKSY*MWIRYEPWLFLIVNYLVFGNSELWIWVWLYSCRCESLSSHHSDFSYK*
IYYVLIPVVLHT*NVCLKTDQQLSYVYIDDVRSVKICTRQIDLS**IGMLPCY**ECHCC
LVCQECL*LLLQMHLQVCFHYNAKLLGS*CHLPLEYQIAFC*CFWKEFS*YLYNQQIRCL
*PRWVRIEMEQIVERCDIRR*VRHQSSDVRLFLLLSE*YHRDSNFVKI*CMF*PNLESH*
VRLTLVVV*HIF*WMSYQSPLRMNQ*MYYLTQVMECSEAFQLMMDTAETVNVAQVEST*A
TFDKVYTES*MGVRKMTNQMDWLGFGSSCTAVGTAHSVVNVTEQFEERHDGGSLEQLMKQ
VLLSVES*P*WKPYHILEFWKLKRLTDLDLCGLP*K*PKHRRYHEKWVNVEIIVGIPLLI
KAIILGIQNILEVLLEDIGILKMESIFLHTNITIIPHSVLYVSLSYYIINPCTSASSNLD
DSFS*LMSSS*HRI**YIDNITIS**TIVDFYSNSVKDLLVDHVGIKIHYRLSKQFSQNS
PNSQNSPISHTYVF*ERLG*GIVILTYLILRYNKSYIIRLHGQVG*GVRLLIARS*VQPS
LGSFIFFVFVLIY*ITISPCYNNA*KKNVVFLFSFNCFTSPEKARCNLLICLSLLKVYSQ
KRK*KLKISENQDLIR*LVIN*LKNRIISDTK*IINKTIS*GMYK*EYYLYIKRLTIF*W
SKALMFMTLELDTTGTQSFSGDSSSSSISNELFFTFCFKKCLEPLF*ASLISCKSLSFSI
TR*PLFSSLL*KSISLLFVGLACSGTLPLFSRNHWGLRCALRPNGV**RAVNLPPAFSIA
AIALADALEASKAIGRL*WNFPLARILTPYFMGPVTRPSFLILFMSKTSPGCK*SLFLS*
NH*MRFKFNSFNGLAPTLVNPILGNSL*IGV*PPSNHDFTLPRAF*PF*PRPDVLPKPLE
GPRPSLLKDFVEPSDGFNCPKIET*R*L*NANTGDLNKPRKKISLPATLVNIMDGTKVFI
SLRPITVVKLFLNPVCLSAFINF*RS*ALILRTAFSAVTWSFSRVRKLYDCQIEKRI*R*
*L*IVALYST*RYLI*HCLRRRIRKIYCLIAIRSLLRYLV*SELILSYVHRDQ*THNKMD
TWNALPKI*AAFVL*KTKSN*VVLQKCE*LGDAIWFLSSD*LKLISAQ*PNDWLGNFSMH
P*SPKDEMVFITS*RHHMSSRRTSSIVFINNGIPTIIKLFTKYTQILILTKVRRLGFPYS
FC*VALVYPVFSSSELLWPSW*GATLVMWRSSVQIRLEAYYFYSTVNMPDGDLRQTPLPQ
ICEE*KMCTFILINYTYT*LFNMINQY*YGRYCSLYLYFFSFVQ*SSALIILYIQRENEG
KKYERMNKSLI*ICSVGI*T*SAQRTIIGILCIIVIIITI*DITPNI*THIIGVDNV*LS
FFHHIGQRSSTEPLVPVIDRRRLLVHYRGKVTSFADIMCITSNNRISAARRPCRQIISGK
SRRCILGQCCIIPRGYVPVSARSRRWNNRVSVSITQ*VRLVLLCLFQVHMLRRLATFFPY
EKE*RQSQQGNCTTNHTYYDTCDGATTQAFALGRARFPV*ERTSRGGRRRYCCINRGPGG
KDRACLLVSLRNHGLRHHTGSVMRGSTY*SR*GGRSDRCCRS*G*GRCGG*RSCLRRGRF
*TGRGRSARGSGGRRRRSRSSTRGSRSSRSSRRRRGRG*RRGGSSCL*RGSGSGGCRRGR
G*VRSRRTS*SFRVQFRGRF*TNTCA**RCCRC*GSSR*S*VRGRSSVIDINVHGRRTTT
ILVGPASTRNITFARIYLRQRL*LSYGTTTVATCTVEKSNDSLTRAFILTVGN*LILVNT
LVSQPQFSYITS*IASFICELVSQRGSYIYEPH*DEGLVYEI*VHIPLL*CCWSKRNSKK
KQLETRKSVKIQKSVSYNRTAMFVFTRFVFFWRKTKVEMKVKKEQ*W*IKG*PRFEL*LV
VLSNSKELKKRVDDLKTAYMFYVEGFSSLFLRRTEDRYKAVAGTLFPDNLKKKDRNRVL*
NETKNLL*MHFWEKC*ITTYKHMQIHSKRR*GPDDQIKNGSLLKHSA*CRNSP*TNTFPQ
NTAPRKKKKTGKNAKCP*LYPVIVT**RCIGLAGCSGQRDSRVHTFSRTKIGGNAMHSLT
AIMHILLPGRIFDVVLRYVFPDLYRSHSSIFSDFLVRAISKK*HLRA*VKFFRL*VI*R*
GL*QEGR*GNQDGK*HVRVVKISRQENS*KKAGV*ARARQSVHKRSTYVAARA*SAIDLA
AAAILYHK*VDSHSIEGELPLGAVYRFQ*NCAVFERRSRKQRPSMSICVQ*GP*CTACAL
AANPAIMLYGAHDG*TGAVAQECHGYLQVGF*IWNAAAAVRR*GRQEIRIADPEER*SAS
VSLVKCYQVSAHICQAVENYSANCLEEEAKVDKITRAGLFF*KTEEKSGQRKRGKKEIHM
KKKKAEI*ANTFWTKSSNYY*SLKRSESYNTFTIKYGCLESK*LALGG*KHLTLV*GLLE
R*INEFVHCFL*WEEQN*VNPGE*HHR*LQRISKEGQADLLL*LTVVDERQSDKFGY**G
RRG**RHTCGRETRNSRVYA*RV*YSDFVARV*CF*WIG*V*ICP*SSGNATKIPR*LD*
RTLKGYTSLMCSCNEKGSVA*IDHRPF*FFQRFQLLFFFFLILTQYITCIHTYIDNEENS
SGRKT**TYGMIL*GTFLSYSSQFSPYFRRHLCSSRC*RCNNNVAKYNE**YVKGVWNQV
AKHQLNEISQSPK*LICCDLAHHPSHNNFVPRFV*ILFRFSNLPCLNSDFCLFAEWKMWK
PKNIMANIPTTFTHPNSTGETLK*RACNE*VNGTKLKSPNASMKPNPSVVISIMVNTPSS
FSTPSKM*NPCKKLTKTNASLILPVFR*W*CRQERLISNHNNMPGLNSENILISNGPRRG
FSSLPINQS*MMFPEFPPSAKIFSLLPLPFFLKINGMKLAT*QYVAKKNENKIDIMHKLT
*FSYRYCNSGNCPSVNFHLIAKTKTKVVDMAIPLILYESFEPSLN*TPFMTLPGKMTSKT
ASIPYHRQ*TVHNSRLPR**RNGLIPFQSSTISKFWKNPLIK*SGLII*FKMIVKTGSPM
LMPKAPISPPNSNSVVLGFKADTILLFSTPNLSLLLCCLQGLSDKQLRKKIVE*KLIIKN
KRKLKPHLMLRRST*KTSVMQNPLYAQPSHNANFR*CLHTKERKAI*IFFTGFSFR*K*N
ERQSMQSPGNTYVSILFQYCFRSASHINFNL*LACCWQEVYIYDECDQHKSLR*SRNIWL
G*FPFEFVNVDDMSGFKCYLQLGDRLSQIWLNKYTLVLLLAMLKLLFFSKSIQHAIEVSE
TYILSNCYSIDSLYSKMTDNTPHYLGIMGNYLIEKGMEETVKATLETLSLIVYASEGLVN
FAIDLYLGTYACLIVSAVDGTVDVATNITEKLISLVNDTVSSVANELDTGLNDISKIINK
VIKAASKVENFFTGDDDDSNMTSSIKSVNLTISALHNLYIPSSINDKLEELSAKTPDFAQ
VKNTTKNLISVPFNEVRKNIKAVNASNIIGDTSVLYVPPVSLDNSTGICSSNQSEILAFY
SILGHVLKIATVVCITVLICFAVGAMAPVAWNEIKLWRRLCGMRDHYMLSRQDSYTSFSS
ENTHELKDPFRDPPIQNGQYDVIASYQQCFQTWNTRIAGWMTNLVTFGKSPENIDPKTKQ
KIEWVVAYMTSERALCVLGIGLLGILVCICQFVMIALLKHKISHSLTSNDGDGVQNLLKS
STAVDIENQMSLWSVQTNKYINTTETNINQEVFGWINTTTLSVNNTVATMISDIDTTLAD
VFNGTLLYNPMKTVVGCAIENKLYTIEKAMTWIHDKAQLHIPRINGTQIKQALAKQTDNS
TIPTASSTSAATENLLENLVNDMREGLLKILRAYHRITLGELTVALVILAVWLVQLPIAL
VILRLRLRKATFD*LIS**TFSVITLFNNDDQKEARSNHFALNLKFAEEKHAKRIGNLIV
KSLHLAMVGNDTSSQ*QYSYIRIVNKITFQLAYTIKDITFCIVSCNILFL*TLTGDITFV
TSVSPHKEHVTWQIQLLCEFFQVTTR*LIPSPLTLD**VHRILAVTSVHD*K*M*HQKRN
LTTHHQLLPWKVHQFHLSWCLF*HC*MHIHIEDIMKACF*FYKTLTTMALMQQGNGRTYM
GYCWVLN*PFGTPRN*QNSLIRLVRSLKRN*RKLLPNPLISI*QMLH*ELWITPIIS*WS
VEKTSLMHWWFLLR*KTDISYNSVTKSLSTHGILLYDYVYTNVLRYKRLTQAHLFQVEAQ
N*VISEFSLRIENMITRIGSASDSEQVCRGSAAMR*SLNLAVRKRVILVK*IFMKMTRK*
RKTMQWLLL*RQRRFMLFTRPPLN**IPLQSLKS*VL*NLKKRSLLRKRMSLLCPRSIKL
YQVMTL**GF*YRLWILLNYMEDQRNYCQARTTHIHFCLVCQFCHIYTTWKWRIYFH*LI
LYQAYTGRITNGRNISVIFYKGK*HKATVGVILLPILLLLYLLLSLVQQTYLKGPMVFYH
RNFLTGLNLLRITARRTVCQRESV*NCHLLLNRTLITLIVHLLNVKVLH**YLKVHTKST
HLLMHPSEQE*QKVHLMRSKDIPSRLRHL*TIHHQTEPSRGQFLTIITTGKRPLLRNLKE
EKPLVVRTWTKVWKRSGI*S*KFPSPILTSS*QTKICCLWILNALMRRSSLWNQICLQST
KNTPMVPLVTLRVLTDLLMKLTFVFNGRQFIQRATTIQENPLHQVTFLMAMRKNMPFYKN
*IV*PKELMN*AWKV*IQTPIRTE*TGHIHKWILVTITTRTI*TCSTQILWHKTNCVLKK
ETTTRMIEHP*LRSLRPFNQLDWA*PPMTISRDNT*RNTDHDMKCQSGLPRNPPTRWK*V
THTRNLAQG*IPLTPTAKLIVALPLRGASQSHQASRFPPTCSQQTLIVLTKCMVQTTRQW
VRPGIQRRERHQVHTIRDGITAPRLQIFTNVLIPQIHNHKHIISPETHTQRGTGQTCKRN
ITRSRCPCLSCSSPIARTNLMR*IRTWALLADMLGQHHHFSQLTSTTILGLSSHGLHLTH
HPHTTVRPLT*TSLKTVVLVTIVRRHHNCKTPKPVHKRRTDSHSSCHLQLRRTHMPSNST
DWL*FYKKRDN*EKKQAPGFRIPVFHLTFWARL**YFMIITKLYK*CLIRKYTFRQILVF
SPGNF*LFFC*GT*HLPIMDSQ*RCAIYCPLYALCQY*WEKKN*KKKNRRLLIIT*YFFS
LSS*SC*KHTIE*ASEQYKLYFKALVMKNAYISSVCQGYAITCTYFLLLLVAPHIDVFSR
DAPHCGRRHTLPAKNCGCTHLIVN*VMLIVWIWHTPTNIHITYIYIFKIQLRPIDELPLR
CTTYLLSCSRIFLAFNKQK*L*NSQVFDNFFSHRVRLKFLFIWNNRKERKKRSIKGMSHT
LKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNFPIAYKTWGTLNEAG
DNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFFIICLNSMGSPYGSFSPLTINEETG
VRYGPEFPLCTVRDDVRAHRIVLDSLGVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMV
ALATSARHSAWCISWSEAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNS
FENKFSRRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQKGQSV
VSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQGTKFINRFDANCYIA
ITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQSDGLFTYSEQEFLAEHIPKSQLEKI
ESPEGHDAFLLEFKLINKLIVQFLKTNCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVT
NW*G*IPHIPQA*HR*TSTCISISIFIYRQTALINYNKVSSNTNGSSRFLFFVLVVKKRK
KNEKKKKKQKSNS*CFRAFHILTALVDSHSCVATRHYMNNCSSPCSLSLLQTFFV*RGKY
ITEVIFRSLVA*K*AYRNNHTHILYHPKSSNSAGKACRMRAHELPLVAVVQPPTSVRKHW
NGQTMS*TENHRYQKVEVMKRATRSYPDVDSRR*V*AYGSI*RTEYRITSQIG*MRLITE
LFPLLLTPTLITCYLQ*PLRKICLIGLIIPMV*TKYFYPVQWLELFLEFLVDSPYV*WVL
LAPSLFLIIRSTKL*SL*IPAILASCFGFVCGL*FFI*F*HLRTPFASCNT*LRSHVTYL
DYLLMWSTFKKEYKF*QDSSVLNQGRNQYKTDLLVSWWRWL*LRLVFSLNYFIITPSFLI
GSEHSYLIIQLRFQCYSGHHLHILVATCMMSNLKNCLLRKLFFLLPKSIGLKILGWHMNR
FLLKTSLLPYHLVYF*QSCFTLIITYRR*WHKGISIS*KNHPLFITISHYWDLPLASAGF
*ESRRPMV*FLKHHCTQRHC*LGIQTKRLSVA*SKDLQIRFRA**F*GQ*QDRYWYA*EK
SLRQYFPDCFSLWASMA**QIVLYNGWFSCFQTLTEEIILHL**KYPRSQC*YFFPLA*R
GLLVNLLSQIL*RPSAFP*YCF*VC*FLSRLLIFSRLKN*RFSILMWHKNLPLKICYWKI
FVMQSSVISMKTKRS*DVQKSTTCNI*KLIAYIRSIIILSHFERKNKTMDLVVKLMA*IH
WASLHFVIPEQ*SRLSRSISHSLHFQRPVLPFSFLFLHYVCPYEAVLRLGTSIITLWIFL
AHIRKRPNQHF*SFQNAKHQSWLVRLSRHHALC*Q*LHHLSFFQ*SLH*LDGEYCGSVGR
LQILYQNASKTPRILHIHNHALLRKEAGVCYDI*NSRTQTASISLKYNDQSYLDPVYQLF
SLQGRIQRENHMRVLPPASFPRSTFCYQYRSFLGHPIAKIHAYQR*HC*LNQEHWQPGCA
FS*MAQHQFGHNQHQYDIQPLRRRAKQEQALHQIYRCFSHSLLF***LVLGRAYFVGLLP
PAKTVL*WWIQGW*LHPQSFPIPPRLGHQRHPFLISKQLVSYSYSLLLFLLVYVLLILRY
CRAIIM*KDFPNVTTRPIEFTFYMLEISEKWDKIALLSPPPAKTFADFKSALGPT**MPG
EALELIASSFRNSEDHSNAIRWRNHIMKPSEVYTELYVLFIHPRSVSPFITLVFTATSHI
KSAK*PVVVLYIGIPTVCFRKLFCVTITTG*CPV*IASLWKWPFHYATLTRLLPHYAFTM
KN*NEY*GFFK*DMVRKSPHI**YHLACGV*CIFNIGGRTLCLLICNKALQMRLISL*RY
LEQELLYWQLPSVGRIILPR*THPLISLAMTVWRA*KI*KDGLN*WMTSRKDGMWQWQ*L
NIAS*RMICYLF**IGKTNVLLQQSLQRTTQTMKSLETKLITIKLR*IVYNYWSL*LGL*
L*LNSLHQIKLLSMVS*RSINWYTRKRFCLWKVVKC*ELPLDWLWMLSKSTDYQELLGTI
WFSNWF*IFSEMSLL*NPVNLLSILRKACLRKVSHLSILCHQTSLWMTSL*IRLFPHSIK
TRYSVSS*R*PAPYQKSLTRTLSISHCWRLCSTSLKMLTKNCYSLDSSKPGHIQRW*IKM
RAPLLITLLQVQVLNYRSYYKRNTK*EKTLSSIHLQDTPDLVVFYLYKHQIKLG*LFLVA
KLS*MKK*RSKN*MTAKNGIKE*LKSINLSQLRAYRIVS*IHKPVKLFFSPNQMVNISKN
SSTTL*IPALTSCCIV*RTTSQLSRIGW*LWSKSNIYFSLHGLLNTSC*GPKSTIPQI*S
KFQKP*KR*LSF*CLLF*EAHMT*KIGQ*HMLV*LHLMNC*TSFPVQRPLKKRIRPI*NS
L*VGFSVTREYNYCQICRRLVPNTPSNS*KVALN*HTRY*KY*SNTLTIKH*LLKANQDG
KKSLIFQKVILLN**KKKM*IEMKRLIF*PLL*EV*KSIFKRCKPTI*QNR**KRTLISL
KDFVSLRTIPLKKYFPFSIEYLFRQKNRHCYLDLI**YY*EKCFHLTD*IECLVQGNM*V
NFQTTSSPG*RKG*RNHLLGLLDYFSRHYTIVK*DFTKDMVNIMYLIMNQCMPLLHHSSN
QFPMKKPYHLRFCWI*NMVF*FPHYLMMEKLNYWTNCSSI*PTH*IFLSRG*P*MLMLGK
KQLIHPMNISH*QVYSTTTLFLKIRTTGLYCC**DTPFHVKSMNLVFYRGLLKFLT*LFL
VN**KNTYQHHLKLQTDCLLLPIFYEFVQKRIVFLTMNKMDGKETMIMITTIPTLFQMIK
FYRKATQHTSRI*ITMHQINLKVPNSVKGLRDPKKKIRGSVGKEKPRLICQCLATRMMND
LRPLENAMAYSVKSLLVIQKMTRI**TLYFLKTKHI*DGY*IKTMVS*PRIDISSLPNLP
RKG*IMGVL*QEIIRACLVDPYQVLKA*ELQKVVPLRQIKASFL*QATWHLKCLFSM*II
TIIINSLMTMSTRNQEIVWAHHSHQIRKICSNLRCIAEKNLQSVLWKRVQPMKAMKMKRP
SAFLAKSLELF*AKVIVMIENEYVVINPFNTCNFRTTSLLCF*VQSIDIILKQYMRFILY
HYLYFSKLLNILRNSNVH*DT*N*ILYNLLLFLGIIEIVIIA*RRMQSATRTIFPYLFLG
FVAYRQVCL*SFFIIILLRVLVSRRCPLRGYILFYIRLSVFKFSLINCAFFSKLLF*IIQ
ILE*LLLLYLALRSLFLYYRTTFFISAIAVFFIIICRLNATFVIFRYRVITFTVVYTLW*
TRICATCSRIC*RRFIF**TICG*IICGRPI*RGFIT*RFTRNFIFHISTFKVKSVALLT
FFCAR*RKRSFCVLLPKSFVLQANRYSIVLILIAVILN*RSNF*RN*IIHCPYANMSPMK
YTTQFTQLQPCSLNISGRLSWLCICFRRKNLHLWLIFC*RIDTKSCHKT*TFGFFVLRRN
PAVSFGMLRYFREFFQIFLGNVLRR*LF*MPCAYLQ*SQESKDFTCLPQL*QTPMTQGIR
IRNLFFTVVSLVQRFQYIHPCVFDNVISRFSTKGTCGVHCNWR*I*GKLEHFWHIRSGLL
CRAT*VVANLVGCINAA*GFHDHQTIYNQGK*GFFNQPADA*SIINLKYRLDFIIYQSSY
*L*FG*SCLYVFTTG*CSDKF*KFIVKAYIITNR*NAWRVHNSAINILGSKRI*SWNFIQ
RSARRSC*ITQYCGISVRIICDCAFII*TMHHFFQILEL*GQSIQ*CVLFTQLFSESLI*
DFDSIFLLSSISNHIISLIKEGSSQILNFFI*FIRFLFSFSSKLIFFGYIFTQSFHFVIS
V*QFSF*SVVIFFQLIIVFNCCLLAGYCF*GFIKLFF*V*LFIHALDQLRRQGCNLY*YS
FCFLRSIHIETFIKHS**RKIYPSELKVKIFYNFWMEINVATAASDK*YYCTNHCACHLG
KREPCFKGASANAKYKFRVVTWKQWHIIKGIISKMQ**RSFE*R*M*SVS*VIYKH*NYI
YICDLMIRDYFFVLVLVWMFVLVLLLS*FFGLIFYLKLSLLPVLASPMDLSLRALNFSRC
SSSMEFCFTGVSEPLSSFNNILALSLISS*SSSADVLDGDGKSSEVFITPLVASGVGDSA
*ITVSAVGSIASGE*RIDPSSVSKSLSNCGALSFSERYFFLTRALFLAEDGSLLAGPAFF
NCSNSLSITARLSSASSSSFPSDEGELLFSFCFSFSCALFCCSSTIFLCFI*SLSSSSAA
RFCA*AFLYSFIKSANFLKNEIFANLSPESSPYVCIRLSNSMIVSLTSSSNKSPFFLASG
NTGNVFIKTLSNG*NFEESLKLPISTERSTFTIDWLKSLQSLTNCSMETFTTSNTGSNSL
RKSLKLG*FNLTIFST*FRKVMLLVVSLINVNLCKVESLKPCACLEVSFMKLPTAKITLK
TLRKLSDS*SALTALSTFLNFANNSLYSLSYEVTTVRALIREPQYDSRLTINCK*IWSAL
CKSFGSFSGGLASSRFLTPSQSVEYGA*FLAKLTETSIISDFDKNSTTLGVCKKSLSQFR
IFFTRSATESDEYICKLIPNC*EISLDKNVIFCRSSLRLLANDLISLAAKAFSKSARTPF
SYKSSANFSALPVPQIELSVQSNFSQCSCFNFLCGRGYFSNNEGD*GSNGDVTADLICDA
GIIGGAGGMTPSVDEDNTDGSGGGGGVSPLGLPNNAMGGGGGGGGGGGGAGESPVVSCLT
VSSSDFFSFSNDSPNNLAGTGGGGGGGGGGCEESTDD*VERSSAPSVLFSLLTALKSAVL
SSS*FTTRPCFPFSTCCLMSFSALSKAEAALAVLFSGKDFLSRPSSSFCSYGSTLFTFCV
NSSKYGAEDTVDFLSLFIKVFSTLLCRGPIPEPLLFSPKAADAVTF*PVPYF*DKASRKD
PGPDPEDSSECSLLSS*VGDASWYISSLSSSELEEERSLSPSSSTCISCSV*V*ISNNWS
VILLISSNFF*YVLGSRLA*LASSSVSTSPVFFFGLSIISSTLKSIPNPLYFVSSSFSLF
KARDFFSLNSSLTRSSTLNLEISLLSIWISAKARLRSFSLFTSAS*GLTKGFLSLFFIFF
TLGFLICIGGSRRSFSNSAKFVISSCLASFSIFSICILNIFNLLLG*SVMPNFFESSL*S
FFALDNPSCNTFWIFAFSEEFRLEFIPLVPSFLLKLSSGLEFNIVNIFLNSTSC*CFSKR
CFFFNSSNSASSCCITL*FLAKIRSLSCNSSSNCPTSPCSALLNFSLKESLSA*ISSNFF
VRALLSNIARRATSSVCMAS*SRWIAIFILVSSSEVEATLTLVTKESISFNCLVSLEEFW
FSSINFELERKRC*TKDTKSFSFSVPLHISQRFFNNDSGSCKSTLKALLLASNLTLKSSS
LLLSYNSIWSITLS*SSSFILFIIRKIPQFSSFVLNSIL*FMLSEQEHK*LIKTIVHWQY
SRIAFSPPPFLNSSDAPTKEPIFPLPSKVCSTANNQA*IIFK*LSKVK*EKYWGIFLKF*
II*RFCPILNFLSSEVRTASNLLLFFFSSIQTKISVAIFLVASFVENKPSATVSVINLCV
LNSYKPCESIDKTLKHLKNEFSFSNNSLVKFSRGAVL*IEFISTLAIAM*P*WSIKASTQ
SNCSVLKVTHKSFISSLVSLSARIRCT*CIGGLFVLSPGRVDALVLFSAPPL*ILFRDGC
FFKLPLTNFFPFEVDVPTDERVVE*FKLLLYTVEVGEEALVIKTDLGDERDELAVRIG*W
SDAIEVLEAVEEDVVFARIFFSSFCKSCLTISHFFSML*PIRASCLSSDKD*KIFLLYII
SSNKTSTSYGSDGISK*ILPSGVVNLLKLVSEP*ERRLDAE*LCPVCCLVSLLDACEEFL
LEYEYFDCIECDLACCEDTGTSPLNLPFIY*DKFCVFNVDFLFNGLASVDVDLEGAFSFL
KDDEDAGEVDTSFPTGECCCWDA*VGEPVLLFVAFELAKRFKFWNIPELEFE*LSFEFEC
LEPEFFNISFPSLPFLLLVC*KGSGAFFMWRVFRI*LGLS*NVSPQYRR*IQMAKKKVKN
GPTV*DV*KT*RVKKRMPLSNFMLNTKIINTQPSVSSYL*EGSVLLFLKGILVFHICFFF
LSLFHVKNFL*PMSGKPWKLRAMTFGG*QRNN*GVII*SQEKS*ARIWQIYIYIHTYIHT
YICVCVVWSIILKL*KDIPNSLPPCFTFWLYPYQLLYLPAVRIDIDILQLPE*AALKPNL
E**PYGQK*EY*YICSDKVYRLKSRCESGEALDQNN*SDEKRCIICQKRHHLSFIR*VIP
RYTTFPYGLHETDMRK*NQKPGKETGHTSYVQ*PVKGLAAACRNL*ESQKSEHGCR*NRK
VWNTTSGHVRQEPWRQAIFRQTIQYS*ANVHIRVTCGKNGD*HDRVKYIWENFCA*ILNA
YHKGR*RDKYTVTIQLWVIIWDQKANEK**KNVKD*NPHYNFLYCPRESFSWVSRFTSGY
PNQFSTLVRKCSINQRGNPSEKTALIFITGDNARPPGSWISPVPETDGSIRLSRTTHNTE
*ENDKTEQRDDLYGGNTKLKFSVILYGKHVH*S*QAPKDHDPSR*RHCFCPVLNNFPQNG
*FQCEGETPRQPVHISVSRSQRWRQKSLGEDRK*RCNRDKSDHLS*RLCNGVNHCPHK*I
RYQGTNRAGVCQWRTNTNYEARPNGAAESNHPYMPLL*LPLHLSSFLW*ALCFLSSIILD
FSLCGDGLRNVLPRILFIYKLLLFYYRARIDFILTFLGHLYVHSFIHGNNRNTTILPLIY
VYCATEE*QKKQKLHNKQVLYNTHYKNFYSGVPSSHCHWRKPLCGVELPTGCFQERHGYK
KDDIRPTYHSLEPLFMPSP*TPRLKNIHTVPHGSFWRYDTLFPKKIAY*QQITHATQEKK
NSHYIRSALSLTTTFLCNFWYTATRIESAKDYSSSSRENSHRWATT*NMSKL*KHPRVHT
TFQHYRGKKSLHLVPRNIRRSDCASDRLLFPLEKETTFFRKSTRNPRNFANSR*SQLLGD
YLTRTARRTEKKATYPASSSYTNKTKKLHCL*R*QKTSYIYIYMGRFSNIITSNKWDEKQ
NNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYSIDEKQYNTKKKHGSLQGGAIADVNSIT
NSLTRLQVVSHETDINEDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLS
NAGPVGSLIAYIFMGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWF
NWAITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKV
LAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAF
TYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLSASSA
VIASSPFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFG
YVTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFM
QALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLIL
LAVVFIGCQIYYKCRFIWKLEDIDIDSDRREIEAIIWEDDEPKNLWEKFWAAVA*SQNLL
HAFKIEKNKKIDVSLIKIACRDFEGLPQTLCIISPLIIHYS*YVTS*GHCHLRPAIVLKS
IINFPYYPLRT**RV*QGHYSRYVQLLSFSCYCTETKEPYQKIR*RKTKSTRSYTEDPSF
FRPNFYIKKIPGPC*KFSISLSFFFIASVRFH*AFVLFTMHKASSSKKSFDDTIELKKNE
QLLKLINSSEFTLHNCVELLCKHSENIGIHYYLCQKLATFPHSELQFYIPQLVQVLVTME
TESMALEDLLLRLRAENPHFALLTFWQLQALLTDLSTDPASYGFQVARRVLNNLQTNLFN
TSSGSDKNVKIHENVAPALVLSSMIMSAIAFPQLSEVTKPLVESQGRRQKAFVFKLARSA
MKDFTKNMTLKNTLLNKKTSRSKRVSSNRSSTPTSPIDLIDPIKTKEDASFRKSRHSEVK
LDFDIVDDIGNQVFEERISSSIKLPKRKPKYLDNSYVHRTYDGKNINRDGSISNTAKALD
GNKGDYISPKGRNDENNEIGNNEDETGGETEEDADALNSDHFTSSMPDLHNIQPRTSSAS
SASLEGTPKLNRTNSQPLSRQAFKNSKKANSSLSQEIDLSQLSTTSKIKMLKANYFRCET
QFAIALETISQRLARVPTEARLSALRAELFLLNRDLPAEVDIPTLLPPNKKGKLHKLVTI
TANEAQVLNSAEKVPYLLLIEYLRDEFDFDPTSETNERLLKKISGNQGGLIFDLNYMNRK
ENNENRNESTLTSNNTRSSVYDSNSFNNGASRNEGLSSTSRSDSASTAHVRTEVNKEEDL
GDMSMVKVRNRTDDEAYRNALVIQSAANVPILPDDSQDRSPELNFGSNLDEVLIENGINS
KNIHSQTDALADQMRVSAVMLAQLDKSPQQLSESTKQIRAQIISSMKEVQDKFGYHDLEA
LHGMAGERKLENDLMTGGIDTSYLGEDWATKKERIRKTSEYGHFENWDLCSVIAKTGDDL
RQEAFAYQMIQAMANIWVKEKVDVWVKRMKILITSANTGLVETITNAMSVHSIKKALTKK
MIEDAELDDKGGIASLNDHFLRAFGNPNGFKYRRAQDNFASSLAAYSVICYLLQVKDRHN
GNIMIDNEGHVSHIDFGFMLSNSPGSVGFEAAPFKLTYEYIELLGGVEGEAFKKFVELTK
SSFKALRKYADQIVSMCEIMQKDNMQPCFDAGEQTSVQLRQRFQLDLSEKEVDDFVENFL
IGKSLGSIYTRIYDQFQLITQGIYS*EGK*L*QNWKNNLQMSGEQKNWNFSKRNIHIFIY
CRE**SS*LRKSKVKE*E*NKYVVN*PYI*IIILFSA*SVKPFLQLI*FIIFLLLLSLSF
CSFLF*LFLFDHFLFDIFRNLELVLDIFTILPRLFNSDRVFSICIVIIVII*G*NRLFFV
IILDISRGVTKV*RNVRRRRR*GILQLTIWHIVCFRDFLQIKIN*FFFWN*GRAFFYNLF
RDIDMICYYSINKLNVYFPGHQIFQLAKFFDFINEKNRID*GSDSFVNTIIHMLFDKLFL
GGDIVYYLHSSQ**FTI*FQYL**LNMNIVMN*RLHTIMRLLFFICQ*QLCNLSSRLLCN
RLLLFLSIS*PLNTHFQACFKLDL*Q*FG**FYPSSVSTS*IFCILKLFKNYYKI*TYSE
RNH*RSHF*LSYSLIYLLC*LVLID*LELIVYIIFTPFGIQKAFFFS*NKTIECG*PIQL
ILKVYKMR*AHKQPL*TYI*V*IYTFV*RETLKKKILIIVYQMTISTGYFNSSCWPLVSY
SLNPTMPPNFKNLSKRFNRKSSTFLTISGQ*TSCLYLKSNRPLYRASS*DGSMWFSNGSS
KIAFALVAGSRNGYIIFKKAHANHGILIRTHLANLSG**SCMTFKHILAIEMGGALSVII
PGSL*LLKSTKTVIFSTPWGATVVAVSIM*TNSWTCLKEDSVF*RPFFM*YRGLLALSKP
KITCLPVSFSTATLSAVKGSLSSLPCVSPISLLHTKVLVRPFMAFAVFHLLALRYLRKHS
LESQNFSQSLKGLSLACVPLSRSLRFSGNFRSSS*KCRKTALYFSF*SSEMGSSRGALPY
LAGGSKNILSHGISFSLGTAGVWSRFLEKRPIFVLLLVLSLCDFSGSFFLNNDVN*IYLK
SVIFPTNFNPSIVLFPLHIE*KEK*EK*IENL*RRNKSI*VFNKLTVDNNNAHEIKSSL*
SLQSRSTH*PH*NILPNEAIDE*EVIALLDGRFADGNVYIIVFSTGAA**IELDGS**EY
AKGNK*VKFYQNIQVKWHGHVGQKLGENQWNKFVADIAQQFDQTEAWNLRIDQKIQAKLQ
NQQI*THKRQSRRQFVVQVFGVE*TLQTLLRIPDENIGN*SHNRHVHVWGVHVIPWWQKV
ARVHNSLPVLGSVKKRN*DEFQFIDDITGADLKIR*NLLRAGSVCSGFIDRFLKLVKVIL
TNKIRKCALP*LECHRTTRILEWKTTATAIYVCIHIRITLAIHGRVPRNLHWSLLLWSVG
KAIVNAILLTCCICVRIIRHLGMGLWFSFSAIDTQ*RGLTIEKSKR*VVV*NNSSGVQYG
S*YRVSDMLF*H*EKVIVTLSVFVKGPSLLSFELSEWFIFR*GNQNA*VSCIFYHFNWKR
TYQKEHMMMKEHILSR*HSQGTSI*CLARKKTTEDLPLQDIQLATSTTHSQIIMRLARNS
S*MLVRSMTSIR*WDLKDTYRRNTMAGLMRRI*IRFQAA*GG*RTCTQRWSLRKPYPVVV
MAAAIRMTENV*RPTKVFPELTSTF*MKRVGASSRQLSMTHTSLLRVTMNQE*MMWRN**
KNIWNLVSKAYKSLERKILPWTITF*GCRRHLLSYHL*IPISYSRPGNS*GQSCRIMPII
MCKEIYITLLQMARKKLTPNI*SKISGNMMCRIMSEYL*TRTLESVNGIR*LNRDSLKIL
GKLHLPTLW*WHLI*KPRSRL*NSRIPP*IK***FRI*SMGKVF**QIGR*SLRILKTLS
IHRNRSILVFSPYLTKTMKWRFYKGFLNI*EMYDPLLYPPSMVTFSIGLLYITEVRFTAW
TCSMKLVSLQMLKVSTSPHTALTWIVSVG*SVILIYHKVPRV*KLLLNLS*VITQLNWIP
N**RRMHLKSHSTFPNILFPMQSLRITFT*NMFILLSFPFVLLFL*TRMKH*ERVPVLCV
KCC*WFKLINIIFFYQISIQIPLRGSMMDIF*NPRLTWVDMWSH*KLVFLGVI*RMNSR*
ILLPLMNYYKNYQKL*NLVWKLKISPV*IK*RILRK*KTR*RRNY*S*RKTI*ETNYL*S
IM*MSPLCTQTS*LQIDYNQIVSKQSAIVLVAILIDPEKPVQES*NGLGEENSFPVRWMS
IT*SSVHYKMRLFPTKTSFLKRKF*HLMN*VTQTKLST*KNV*LNIQGKFIIGLKYQKLS
NEKPLSAKEKIHSTSIP*NPFVIGVTNSKV*PRLGREICPKLTHLISMRETRPKR*LCFM
THYN*LTKLF*IRFMGML*GKALVGIPWKWRGLRV*QVPRSFKWREL**KG*EDH*N*IL
MVFGVSYQNLSLKLTFLH*KMVKSFISPTHVPC*ITEFTKSLRITNTKN*KTH*TIYMRR
TVKTRFFSKLTDHIRP*FCLVPRKKEKV*RKDMLSSMKTAHLLN*KVLN*RGVVNYN**K
IFKVIFSRSFWKVIH*KDVTVL*QAYVTVG*MFLIHMVLC*KMKTWSV*FVKIEVCQKL*
RNMKGKNLLLLRRQGDWGIFWVKIW*KIKVYNVNILLVQNLSMHLLLNEPFQSQYFQRTF
PSKGLF*GDGH*IHLWKIWISEP*SIGVIIEKDLDLLYKR*LLFQQHYKGFPILFQGLNI
QIG*KEKSLQRRISLSRLH*PNFFRRQRMYQQWAR*KISRICLNQL*KKITPKLKLQELL
KRKPYPRGKEISLQMKKIH*YCPRRFLPWTRTMLGG*IIKKLNGKSKQEIESVETNYLVI
QTAPVKEVH*EV*LGSKLNHMRTPLGRSYNTRIPVSQGFWKYL*QLMAKSRTSPSIYQKL
FI*NSNLKQCRYKRLRIALLKNLLHRYQIIPKRLIQQAVSYSKLLYRNLSFWKKRKTALV
SSTMKMYLVYLRALSLLIKERSWIWELR*RSAQKQWVR*AREYSRVLK*RIFQWRKMKGI
*VDFQWTLAIYYISQHQLGMNFFHYSSHGEILLLY*F*NHPTRLRK*MPHH*DKYTNKCL
KKRKVK*KHILTWLILKKISILSLYILQISQNCTEDYHRKLLN*KKKEVCSFYSCYNLRL
SLSS*AQSGF*TRCPLLSFP*MKFFYPN*TGNRHY*RNLLTTFYPVVRGFLT*SSYPSIV
TFQSVI*GWIVWIILLMFFMQEN*KKRTSCFGGMRKLHFQIMEAFKMILI*IHHG**MIQ
NFPKLITQVCMTM*FSMLVLII*Q*TQF*HQH*SMMLKAVI*LTIIWV*MTKMPLLTRHL
NSCTTPFLMTL*MF*EVC*RSGGMRP*KKIQPQICW*IPWQVGFKTRMRNYSTDY*DITF
IT*QKKPYFN**MNLVHLAQLLYMQTGIKF**RQTSTHLKTVTPTANI**RQLEQIQCLV
IWT*ISNVIGIC*YGWISLILVD*HVLK*RKRKIRIIPLFRNGN*RSFCHQYISPNLRIG
**SYWIVC*RQSRAI*N*IQGRKDLPK*LM*KNKIRKIVLKTR*TDFLTFFPNH**KESK
SFLKTSKSSF*ILSMRQTMLFLFFLVPI*M*KIPF*NLSNHSAMSCYFQRVQF*KSGP*E
KNC*RYLNCVSLLK*RNSKIQV*VSWCRIFYVNTVFSFLILTFVRQLLNLFFHASDVTKP
LIKYCCKNT*FKNYVLISNPI*FKI*DAPDVIK*NVTI*VPTVHVPARGKELSPEKALFK
S*MCLSK*PSITVLIYY*VVLLI*PYE*AVYNARFNGLFTMKKKKKKKKR*GKRVFSIRF
*TYKYK*PKN*PLNIINTLL*YLNHKYFSFIFFLILLEIK*M*PLRKLLLGNIKPTVSHR
IFLLIQT*LLQI*SCKVIVEQEKPTL*RSILMRIQICMQYGWNLLSWFLGSPYCRR*HVL
YNIN*KPYIQTFPPQITILYRLKSHFFW*RRCTIFLSNMNLCKKRLACS*YWMVSIVYKI
*TPHCLTNISN*MNYFQKILKLI*NSFTRC*RHHFCKDILHIAFQLLCFRGIMWTKFLLY
**CLDVANSWKILVYVSVSLKSR*RTVQTINFKM*LRTSFT*LCRLFILILETTYSH*MT
**TSNGPSMYLALLRKTYLNHWLFTKVPSNYF*AQMII*VKMDKVKAR*PQIVMTLRTVK
LTTYQ*FRSICS*PHIFVHIWNLDTMRVFSLGKHVSYKVELLMDEERRKKLTLDIYSLLY
LLLKDFWLFSKLYSLFKVRRRVVPYLHFVRNP**KRISRFFKIYPNCIH*N**LQP*TRI
STI*VLKSGGK*TFPGKLLKKYQNLFISISAITSAIFTNDYLPGRYPEGRIRSKQQLRYI
NIYT*WDRMNNYQVNLVFFVPTLYALFLGYGNQRLIRITVINSVH*KLLKAPYCMEKQ*M
RRLNGAKLLV*LLFLAAGDNVLHLVFLPGLSLILFCLILCDVFIFYKTSNFSGNGP*NVF
KDFKCHGGGSFIFN*SMKSY*NGSKLIFQFY*HPLKFHHTFIIVIHFQTFH*STNGMYIL
F*CWTMQSIRFYNITQTFHLSQERKSLESHL*TILFTF*KALLYILILALQKTFLVILFF
*V**IIKIHFYLSSDLYFPFTLQI**VI*FKQVFFHFSYKTISHHD*DFYISKIILKRQM
AT*PTKNKTIKQ*KKTFFFVSILLRILIIYLSSYNTK*SKKLFLFTFIHNCLPDLTSFPV
FLIFSKIKS*GSVVYTSTNCFSRDISILETSGSNFVKTLLTAPEHPEQVMTTLN**CFIS
AIFCASSLLCRWKSHPAMF*DDSSHLRSSKMHYKMCQLCTPKKNYRIT*NLLEN*KKDNL
RIRNTRCTSIAMIM*PILRLIIF*SSRAVPLIS*ISSMAFLRRGVSANNNSIHWISSSVA
KR*KSPL*NISIISFKCNGRNLPIVANFSLIFL*LGSFANNCISVLFTNKDTSSPKFSEL
TSEIICHFNISFVTQSLYKKFKKDNK*REPSSPLIFCSGRTISFKI*GSSFSMVASHDGF
LSFSRNSVN*CLIS*QTIRYFMFSLVSSRFLVNSFILYSFSSRSIRYLISTYNWHQL*EK
LAVHMAIYDVCKRLYLYAKYCSSTWLSAKLLLKFCEIAKNNFGNCVTSMWSLSSDPTS*A
FKCSFPFSREASSIFSSIAQASSQAFSSSSGSFSFS*FVFSSSSSIFTSISSPHASASSS
STSQFQSSSLDTALWSSFSFCTSESFFPIFSLIVLVLLVVSSTTSKFCQLFFGSSNILLI
SLICDSRTLSSNKL*YNCLFINKS*ISLPECVQLVTSDLATSLVSLLFMTETRFFSGESS
DSKIIDALFFTNLVNSVLNKGPSS*LKVFLSLKANPSNMKSHTASKLVNTVDTQCWPCEE
DLEKTSMFFSFSYEISLPDIKIEFLIMLTILERFIYSFMIVFNFALTCS*ESALVISKMN
QA*LSKLPLGKYCWATKSINVSYSI*TLSLPHSTVGVNWMLFSVIFQNPLVRILYNVLTS
SKCSVST*VEMDCWKLKLCLR*AALLRIFFRNDCNE**QFSSSSMFKLVLTSFMRFKNVF
KLSRMFSSLARIASRCSRSLESSSNSLPLDLLLSFFNIKGSFSNSRIISPLLGKRDSISN
RETS*FVKVMRIKPLFY*QI*RNPLRL*TML*NIS*FNMSPNCISLLTKEKYLS*GQ**R
SMVNEHYNHKQIMTLIII**LYSLKLLVVLTSRVLRYK*NSNFAIECH*TKDQSSL*TPS
SIYLLLPARIFRSRHALIVSPCLGVF*VQLAIHFSS*PTVFSFRYTDSPY*NCPR*TSQK
WGYLTALTVDYLASPNHLCKWLFAL*TYLIQDGRGTVFQLSLLTSRALMLFLIKVCLS**
MLIIRPPSFD*SVRTFQHIIIEYR*VF*RIQTSNSLLCKPLV**TLGKG*YKNT*CHIAY
FHSLWSCHFFQ*QVLHFCC*EHLIYHIV**L**LFRVCQSFPSSTVTPFLSVGIHYEQIS
RPMFGILFQPKIAFLLFCQFYYQYILVCIGHEAMNCSPSYSTLFQDGYLHHMTQL*QI*L
KASINDKMAL*RKKDLNRLHNICYQQF*LSSV*QKSF*IPYLYDIYQYLKNYRSYPIEMV
SFELIVISR*CLCFYTKNVSRVLPHLFLLKTGILEKHSIYLQIVCGLVLY*IFHIHDCK*
SSTLSEVF*VCLIK*MHHRTSPKMSHVI**FWIRWWPYDQRSFLVLSYIILLVFFLEILF
PSVQTLLKSLRYYLGFL*PCFLTDIAT*MQ*AYSQKIKRLLSFVDRWHRKVLRSSLMICR
LLQKRFQTS*SL*DR*IP*NSCSNKCSLLCKSR*LRTSAFC*DTTMLQT*KVKALPVASP
TFGPEKILMT*TVDQALSTH*NNIEDI*WSFLLEAFCHRSLIKRRVSFPFLAI*YIHSNR
SCPIYSQEQH*GTSYLL*GN*TE*PVVSFL*ILVLLAFGTETPSPLLKSKYHIQRLSSSA
FHTRTRFLCQML*LIDLWRWLY*RQIQKTWEKIF*TPAHIQDYHVVYS*HTFLSLQKLLT
MISNLDNLKFERPT*YPLTCYHVPLLLYYQIFLLQNKIFDLPLGHSAH**GRHQTYQFPP
RRSSMATKGTYQKLHFSESTIFSPIFPW*AFQPVFSYKATQTFRAILEALAYPLIAASRN
VLILYCNHLCHLTA*FVSRYTYMLAFLHY*YQNPILSILRWNFLPILRNCLNTH*CKEIN
LFSFQNLSL*KCFLTLILSLTLV*IYLSLILLLIWHL*GLGRP*GSFFALQIIVRHHF**
KMALNWFLKFL*PGRMPAYCHIYLGKNRNFFSRFCRVQLQ*S*VLIARLSG*SHHPLQFA
VIS*KSHNSPC*NYQSAWE*TIGY*QNRCSARLEEVTIGIGEFPLLFENLQMTPYISDRK
SRQSSLSNPLMHPPLFGRNLRMHERKESQLMLL*MQPILALTASFWDPSRERTYFK**YI
SAICQLINRSTHAAMF*LHLVV*NFTCTFPVLNALAIALVSLRKFIIKGKFEKLMINCKV
IENRRTRFFPLVNAKLVKVIASSLINKFQSLPLAMSKLFSTVNSARHSVPLGGMRDYVHI
KKLEMNTVLGPDSWNQLMPQKCLLSLDMGTDFSKSAATDDLKYSLNYAVISRDLTNFVSK
KKNWGSVSNLAKSVSQFVMDKYSGVECLNLEVQADTTHIRSDHISCIIQQERGNPESQEF
DVVRISELKMLTLIGVFTFERLKKQYVTLDIKLPWPKKAELPPPVQSIIDNVVKFVEESN
FKTVEALVESVSAVIAHNEYFQKFPDSPLVVKVLKLNAITATEGVGVSCIREPREIAMVN
IPYLSSIHESSDIKFQLSSSQNTPIEGKNTWKRAFLAFGSNIGDRFKHIQMALQLLSREK
TVKLRNISSIFESEPMYFKDQTPFMNGCVEVETLLTPSELLKLCKKIEYEELQRVKHFDN
GPRTIDLDIVMFLNSAGEDIIVNEPDLNIPHPRMLERTFVLEPLCELISPVHLHPVTAEP
IVDHLKQLYDKQHDEDTLWKLVPLPYRSGVEPRFLKFKTATKLDEFTGETNRITVSPTYI
MAIFNATPDSFSDGGEHFADIESQLNDIIKLCKDALYLHESVIIDVGGCSTRPNSIQASE
EEEIRRSIPLIKAIRESTELPQDKVILSIDTYRSNVAKEAIKVGVDIINDISGGLFDSNM
FAVIAENPEICYILSHTRGDISTMNRLAHYENFALGDSIQQEFVHNTDIQQLDDLKDKTV
LIRNVGQEIGERYIKAIDNGVKRWQILIDPGLGFAKTWKQNLQIIRHIPILKNYSFTMNS
NNSQVYVNLRNMPVLLGPSRKKFIGHITKDVDAKQRDFATGAVVASCIGFGSDMVRVHDV
KNCSKSIKLADAIYKGLE*RLVI*IKYVILFCNNFFSCFIIKNR*K*PREETSEMKYRKD
IENKLKYSVYLCFFFPLYEI*HDK*LFLCFFQWMFHLSLWTILGNMASFVTVVTKPVILT
VPGHVASLTTSVTFQSTNSVLFHTVLSHMVWTTTFIT*NFGESAGLLWFRAFSGDVAGLV
TVETTLHSTFTSNVTGFTTIVTLLEFNCSWHGTIRLNVTGFVTVVT*SFRITVFCQMANL
TANVTSFLRHLFRILFFFPDF*RESLKIIQSSSAPKAERAFLIHR*PYYNSCQKRKGTKR
KFFQHFVYHDTTAVLTIKLKSLSHKGNKRQYTTCLIVRIQSPSPAGIVMNIEFQFPQTVF
LYGSFPLLNWIRVGYYDTVFNCILE*VIG*HP*FGIVVIFLLV*LLLWMFIRCLRRARFI
REI*LVNTKRRKGFWSQNVVTEICYPPPF*GCGLIVRECPFISLSDFFANPQLPFQAVKS
SSKFV*IQLSKLIYGQVSLL*VFECIFCFKIVYRRYLSLQYVHYNGHEGFYFSE*LIRKQ
HGW*FELAHVFFPYLKFFDYLLFRTQTTL*R*LFILGK*RGEDLVIFNCR*FCLQE*FFT
V*KIIVPAFDRLDIFIFQILY*WDRNDLLFFFFFSSECCILCGLYF*IWK*PRKFIKCGH
SGKLFYFNLIFCDTVYFAALF*GGKGIMA**VVTFSIMYVMFSLSFH*Q*VITTSLFCGI
NTFSPHSINSQTRPNHLCLRRSKICAKVSRAHTVPF*CDLIATFFKASHFSDAIYI*EKK
KV*DAIYHNN*DAAQIGVSLPPNFQGSFQRITIPYLFNYWSCLQYHKGFWIFNRIAIFFL
LTFDR*PNAVYIYVCRLEGILTVPMFLWKVSNIAKHNLEG*HYFLEIHLSHWI**RKKQN
VKLLYRCIKQ*PSMDNSFLHPNDATNHV*VSCLTYHYS**N*EN*KPCTTGYVHKILC*I
YISSVFLRTKLHSLRFDWCTATYIKRIK*TIRHVDNWSC*YS*SKDHNF*SGCLSDFKIS
TKYVF*R*YKSYRR*KVHSCQFAFSFKIHLDSHNSK*NSFPKISRIRFIDGV**NGWVID
RLVY*RCKF*QICRSLYSRLLWFR*IGY*FVLEPYFFKSNSCREQFIRDILTLNQRKIAN
GIQIKDLVIGKQD*GQHMSL*SIRKLVISCHQI*ENLLV*CEKGSQLCLFFEHQRYKPRG
**RCVFLSMEQWWKSYIYWL*EWLFGHFKSKTWHIGGLYQN*STYWSYNRDQNGPMGKKL
HYWEYRWELLRMEYEVTML*INN*RFELCGNNTRRLSFG*NTRNLYRR*NGIFL*S**W*
FTPL*IFSQLQNRSRFEVLS**IMVYHVRQE*HTIKSFC*KRKKSNNLLERHVR*HDD*K
T*EKQRWRQQPQ*KDE*EY**DWQG*AE*IQLKKISYLMEGMR*KMHILFLSFNDIYM*L
TTT*YINIYARIYFVYVTLKTHLFL*FQLSAKRNSVLLK*SFGTYSLISPFVSQAKSSNA
SFFDATKSNFPAKMCDFTINSAVLFLSSCKTPMGVAETDQVYI*SPLNNFNSFSACTCNG
LDSSERSKLGNFQVPLLSLTKRYKVLLNCLSRLFISFDLSASVILSLGITGLLTSSLLCS
F*LLLNATVLSSESLTSCLVLLSLPCLMSGMPLGNQMPFFLEIGPFCRDRNLCSATVPFL
K*KYAGNVHISLFSSSDWYS*YFFSSSFNSDLIIGILDSSTPTLILGGAELAVAVAVASP
LFNIKFTFMVLDKRL*LRRI*SLLIV*LFSFLFFFSFSFSSKP*KKTRNTVKKENKE*DN
ATFETQ*LCEYIRMSI*QKKKRNIGKNRNYI*R*ISFMYYEQIKGGVKILALLLLLLLLV
KHIHQRIQLSSGVKLLLRYRGSRCGRSLRR*WLVGGITIRLLHHRLHILLWWRRCQWCIA
VGYWRYRRYATRFVRFTRTWPISARISRHLLRYCLGRNTFTNDNIRFFENNTGNERLTRS
ATPLRTY*PFFISVREPVHRNNTVTVLIVTTISWTKTNSPPSSQWQGSIFIEVLQNIFGL
MS*INFHKSVFSGVIQNDALYFSKRF*NVSKVPFLHV*WYPTDEKSTAVDFNMIWWQCRV
VTYWFWSIMRIIGNIKLIGV*VVIVCAKCRIGGAYAVLVLGHRWIAVLPACRWLRKWCRR
RS*SIPS*VISFSFTFTFTSATIFGNCMGLGRCDCTHGCM*RQSFKMFLQSRYYLEKSCL
LFGWICGSQISWKTYVQV*RRTFL*I*QDLFRPLLGIQ**LL*SGVRGVIRYVHSKAF*P
DGVQVTLLKQAGPVPNV*KHTNFFLVVLITFCNSIG*QFLNYFAQRVYGMGTSTGFVAAA
V*I*SCFIQVSSTY*IDDI*RT*FMRIGTKS*VVYYQRYDFRFNINVIKCVSG*FLNTRT
*NTRFQIFE*FQGSYKILKIVVLLHYGMFSMFVAFRFLSCNSCLEKSTRKNV*SEKTTIQ
KNRQ*YIFLLLEIIGCSNGYGNVTNCKKSLDW*VSCVQYDNTMRYDTKTIQ*GCRVLTFD
MLKA*NS*REGAGSHANEEWNMEEGRNTCPFILFLFHLLRSDRWQKKKSKMYRM**PINH
QRRNIYFCRRLSNEFAQFQVSGHKDI*QAIKSIMFLSTR*NYVLRTLVE*ETMRYTCAVA
HFDHKLIVDFLRFWCYSLKQETDSTSTYNTNTCGNVTILHLLFSENNNHASCNTFTALPC
LVR**LQ*NPPI*QCKY*SNLVKKKKCLHLVCLHLR*GSGFHLVPVCCLCSCLIASKAAF
KL*SLNGNL*F*EVVATIERQKQGNDGKQA*ALSINYLFRAYGLLTPMIGKLLNLASL*L
**SA*MVQVKRLSSNV*STLPQVIYRPTAREEYSFMTRR*LVKRTLELRSNWRLRVPMDS
I*LSPEIFSC**KRLLLHLRL*KASWSL*IIVVTAVLCPPGLWN*THKYPCIWEFQKRSW
NT*YSVTKKTACGH*VNHPILKRSLMKFSKR*NLQRL*TI*NP*RKTCPWISSY*SNQ*N
T*SWIKTDRKQ*SSISTNCKLR*ISIMKKCLKLNLN*MKSLRNPINCLNLIKISKKYYPK
*RT*KIQNSQLVIK*KDCQTQLIFSIYRSQICKTYWQTSLKS*WIRIIS*EIWKPIFQV*
KTVSHPCRAFLIPSSGGRVS*KLVRRHTKRTEITFHR*KKPSNISSKAFQILKTVIWLK*
ITKCHSSRLSSLRI*LTL*INLQRIFN*RKQIYPT**NQ*PSIHRIWNIIKRTDLN*SMT
LKSLLRN*NHLKVCLLKIASIMNWKT*KHTKKSCNLGKVRILYQN*TRK*KRKIMR*LS*
RIKLRNFKIA**KRINKRTYTPN*D**RSPLILN*TSYKRLRKNYRMILE*GKYFPSPRN
FKELI*KWIFRNYSSICKRI*RSTTKRCTNWIEDIQTLCTI*TPLKRIYRIIRSRKKK*Y
NY*AKTYQRIVLLMNIMMSWKKRSSPIRLRWKT*KCIKLL*NLIEKH*RSLNVTAAVICV
LESLKMNRLKVSCYKN*KQKQTQILKKL*KTLSKTKRNIFIV*GYWRNILLH*IL*MKRL
IIHRSALKKLRRKQKLPNQN*MNWK*IPQN*KMRKS*LSLKFVL*LRSLLT*KRNLRILK
TVLKRYLRSYRFIIPVKMVFKLLMN*GTNKGR*MILYVN*GKPFQICKWKKMKR*EKIQE
*LT*LKKRN*QFLKLNHL*HRNKILMIL*GQKGKTSTISILE*RS*KHVLFH*KTKRMKR
KVF*TK*KMNVIFKYATNKKPLQILIG**IDFRPFITKWLILKLRASMNCKQQ*KN*N*T
KLKCWN*RSSLISSQMKLTKKRENLLTQIMRRKT*SRT*N*LN*NHNFSTLNLR*VD*TF
KMQKLKGTNIKRNH*D*EQDLKS*ALKTQVN*VK*NNYRIK*IH*LINCGLITKISRKIT
IKNGLNYRQDPLLLTT*MSIQKH*IVLL*NIMD*KCKI*TG*LMNYGSVRIVVLI*TPSK
LDQMKLVVQLRENHTTIVL*CTSRMLNWI*EDDVPRVKKFLHRLLSG*LYLKHLAQIVA*
LH*TNLPPI*MKKTSKV*QNLYTI*LI*EDIKRISS*S*SLMMRNFWVI*MQRHLLITSS
KSREMIGKNHKLSGSILTESLIEKTP*YLRRDRL*LIN*RC*NTSSTSL**RFCCLAISK
CI*YLTQSNFLSNMLSFPSRYSARDSNFSLSLLISLSVITSASCFFSFADLAST*APLIP
IISTFSLGLIIATPLLTKEINDNSLSFFA*LPDILNSLICIFEFSF*NVSIINFV*NDKN
SKIQIYLYVRFNIDVSVDSPMKEPFIRGSAKGVLFPS*SP*KNISFVRI*IERPLFFSMS
RMVCSST**ISAPSFRIFLAHG*LSNKCSINLPVHDWPAA*TEKSPLLSSIVSKGPHTPG
ILVSEMVVPYM*QLEVPAIINNDVSK*GEATANQLA*LSIQLRTTVVEMCLLATRLVVPM
LTLDGKFIMFL*NEDDQPDTSPSLPIPLRFSLPKSPSMFHSYKRLSS*AMY**RSKI*KC
LSRK*EYSSKKYFNLGTPISGTNFPPK*SKSCCGHCIFSH*HSFTAEESIQNMTLSSFGY
GISMLLVRSLSKIANEHVAETPHDFTSYSLMFSF*RHF*RALIISVDFCQNFHDFFEESW
*YGTGSCAISNSASL**LYTPILALDEPTSIPMPTCRLLFMISPI*HVGFSFKVTFIEKN
KLIHF*ISAY*GARKPNYAMN*Y*IYCEV*NYCKISICTYVSSQKK*RISM*LFLFFSSS
HQEDRLIFCCFIEPSSKKKNQSKPNAQYIPLGNSNVLDLFLFLSFQVA*MELS*WQFYKK
LQYFLECQKPQLEPLWHL*Q*HQVP*TN*QLWKVSSSIRVLRV*FQQ*SYPNAL*LPRCS
IRFYLHFVGQ*NRSDPLIFQTVQALSR*ICLRYHLPRFQEDCSTFLTTSSCYSRVYFRIR
PVIVISSIVAVIWSFVKVVSKSPISLPHTWNCFGMGTIPTSFPYPLLSELMKRE*TVIPS
LVLYFQLGKFVLHQWHRYWLME*VYRWK*FHPIEPELVNP*MQFSRNPQCQ*QNQSTYQS
QYGFFLDLQ*LF*PF*YQTLHPTHFSKQMDEYHSYFLFLDPLDSCLTWIQLWKQVREPCR
VEYFSFLD*IGPQHTGSKLGKKNQYNLRILVSRFHRVIRIRPFQTSFFCISRT*CHWEHG
SP*RNFPRQQRVDLEHFQFRFQKQTFSRTLLDKVQKVDNDCNSGSNLKSPPNIISVHARI
LTIKNEMENFSSSQ*KIFSAGDRKHFSSRRVKRHYQLKRTVLLIGVGD*VSGQVLILCMN
IFIKALRRYTIMSTPKIVQPKWKVPTPQAKETVLKLYNSLTRSKVEFIPQSGNRGVTWYS
CGPTVYDASHMGHARNYVSIDINRRIIQDYFGYDVQFVQNVTDIDDKIILRARQNYLFDN
FVKENDTKFNATVVDKVKTALFQYINKNFTIQGSEIKTIEEFETWLSNADTETLKLENPK
FPMHVTAVQNAIESITKGDSMDAEVAFEKVKDVTVPLLDKELGSTISNPEIFRQLPAYWE
QKFNDDMLSLNVLPPTVTTRVSEYVPEIIDFVQKIIDNGYAYATSDGSVYFDTLKFDKSP
NHDYAKCQPWNKGQLDLINDGEGSLSNFADNGKKSNNDFALWKASKAGEPEWESPWGKGR
PGWHIECSVMASDILGSNIDIHSGGIDLAFPHHDNELAQSEARFDNQQWINYFLHTGHLH
IEGQKMSKSLKNFITIQEALKKFSPRQLRLAFASVQWNNQLDFKESLIHEVKSFENSMNN
FFKTIRALKNDAASAGHISKKFSPLEKELLADFVESESKVHSAFCDNLSTPVALKTLSEL
VTKSNTYITTAGAALKIEPLIAICSYITKILRIIGFPSRPDNLGWAAQAGSNDGSLGSLE
DTVMPYVKCLSTFRDDVRSLAIKKAEPKEFLQLTDKIRNEDLLNLNVALDDRNGQSALIK
FLTNDEKLEIVKLNEEKHANELAKKQKKLEQQKLREQKENERKQKAQIKPQDMFKDVTLY
SAWDEQGLPTKDKDGNDITKSMTKKLKKQWEQQKKLHEEYFGEDK*NTRGFVMCATIQKY
VYMYIPSFFTLK**KRKGGKKKLI*LIVLYMYFSFWNVKKFQAEKIEKIKHCACEKREEK
HPND*ALDVDDKHFEA*HCQ**VTKKTRTSSM*D*ALQGMKWKNKATHYTNNMHLASAVD
GQCKSILRIG*MRRRSGRY*T*GRIIQIEQNEACL*KEGRVY*RNCRVLENCAFTTR*FC
ELHKGFRF*IH*HYR*DQSRMAGIGV*NVRH*RF*YNIPFPWN*GRLQRAASHQGVPNQK
RQR*PRRRDTD**ARSN*VAPELRLDKPGLDQRQTQSRG*KKVQTGNENHIWLVQMDRPK
TREGVPARRLIGVIVQ*RDLPFLCEVLC*GPEGLGRRRRRIRVKRRWRQRG*RWQSR*GG
LATIRRGTKL*EKESLVV*VRSGLGQRFPSLRHCSFFC*VWSSSLLFSYLKLTHWIIFKQ
F*LLLLRTYGCCGTRSGNSSGRPYRRCCRLV*YR*I*FFLT**IVFLFVTQFCILIHPFQ
ARLLQSQVILESLRLILARFVQQFI*FSFFFNFFQSRVKLLLFGN*ILFGLPYFFSIFHK
LGIP*FQQIQIARPHDNVLSIWPFFPVLKTERSSLLRSCMLRTTCSYISVCKPAAGEEEK
EIKKDEMLYYIL*CKYALGLK*LNSYVLYRITTLRKKASSE*ATRRKP*T*NP*ILMFFF
CNPSWEIINSQTFALWSPCN*IISPISGSLTMLPLHAKSFFRTLRILFKSYSSGTPCTVV
KVFLPFLCWIRI*I*FEVAVSSSPVSAKGSNDFRFSMDIRFASAILIYSLSFLKKNRKEK
TPSTKRKQQVALLLFCPFAVCFYPCDEKKKN*NFLPAHRKNLLPDPLLVIIPIFNAITYH
KLQ*EGRLQ*L*YRTKRLEPCTHDPFTGTFYCNVGRCVLYDDAAAARIK*RGRAPFDVL*
ENAKKGVLLENIHI*IYIKNSETIEILVIQP*Q****Y*QLEQDVQNRFRSAESA*KGVF
R*GDRT*EKARTRMHSVHMGPSVFQSCFYNP*DAASGQ*RSATVQDAYCTA*DHTRGTSV
SAS*GHPG*GLDQISG*GTFWRFVVQQTDSGVCAVPGFEAGLSCAP*RV*QRDV*VRGVC
VTGFSFRPGRRVRDDLRFDVVTGFS*RVLADHLCVDSVREEKY*VQNFGADPVDCGVIWY
L*IHHLDAESYAQAIE*CGG*RCSAALERTVRVATCKAV*VLRGLLFCEVLDHVSNHSKT
TRGRSRRIFNQRCGRVKRD*VQKKRALCNSSADAGTDSNTNTTCCC*AGYFPTSGISKDY
FDAYGLLANYADGCHHWDDDPHCHWCS*RHFSTGDGTNAAGLLGQSTSPVCERAKPSRAR
ACATVATTAGTAGTVSTAVTKSTTGYDEYAASTTKPTSKRFNCPHQSI*KGPGFIAAI*P
KSAAAGK*NHNDGFYSFQTIG**GRATNCIAGSIGCLGKKI*VFSQAILPVASRASKSFT
SF*KTAVKGE*CAGIHSEKGTVRTQIEAKGFANGRVG*GP*QGKVRIRKIH**CRGGQCS
GDSSSRNNDSG*NEPYSGCHIGKRYQHHPGIGL*SRFSFELVGSADSTHFPFVLIGKYF*
KRH*VCHQFQ*FDSRRPCTRRPNRGHTLR**FQYFDGYTGDQFKGVRRYYITSRTV*SNF
DPGEEMCQRGPIFLRGFDV*KS*PGR**GEN*YRHQCQRGHAREVARAIFGYRTVIEHTI
CQIK*RNEPTF*IGCHC*QNCQILRTLTC*RS*TIVVIGINDY*CCCGFGKGCYSVPK*N
CHHDKYSSEPILLEKQQMDRRFDLRGKGCGRCNQCFNHYC**VNHF*RQ*KHIT*TIYRR
LQRSGRIHNTIGSSIESENFHPLEGPR*IGTLFQRCYRCMQKFG*PRHGYD*R*SFDFAT
AATIGLHIRTHIEDCRNGTASGNFEVRTILEQCQEEIGRDKKACLL*PG**LIMNCTFYI
*R*TLI*IYLFEDVFYVFLYLIGICVLVRGHFFFFWCGEWK*SR**ICKEQRTDTPPLLS
YHISVGVYHFASIVIFATLFQLTIHTKFLLPFKIRKA*RLKQIKRNPFFF*FRYNGILVT
SKYTKAAASLRPSANFAVLQYRFI*LGRFYRV*VTFLVP*CESVT**SQHSKRANKRRHS
*RACVKINSFWRCGNRWVWFKIYHDTFIFQWLTGTSLRFFG*KHPRSYEFDVTI**SIDH
I**VQRR*H*LFRQ***SQL*YRSFKTSRKWFLYSSKYAEQGP*CSLSEIENSIKGRYHT
FHSE**RSFR*HCGGSSRKHTTYYYRRKFTTYKH*KYHHFLNTKTSCTRLSCASFQ**RS
VTKRLFIKNGGYFTLYERHGRAIK*RPQ*TPSYTRRTRE**VQGIFNGNK*FEHSF*GFI
IGQ*SQNV*YCY*YSGCSFSDTQNCRNQKLHFEEYYRYHCYTFGCQ*KLFLPGFPKSFT*
QAGTISSFFC*YQMYILKLRPRYHSNFEEL*IRAKGK*FIGIFFRLILF*FESIDN*P*N
*AIAHWRTNPSKHRIKYGRRTRYYYQS*WHCAFL*NLSVCFKMYVLLSE*VKRDDASNSI
GY*KDRTTYLKSSEVVA*VSIFFIMFPGFTLHLRL*P*VVH*ACRRI*KTTFSVHENIDN
VEHYDLELAIPSTTGFI*RYFERSANL*FCPCNHQRSDI*RRIFWNSTISRRYFCVWKTF
HGFKEQ*MYRKV*KQERLLFAEKCQST*FFQVRLQAEFIR*FFSQDRFHEVKSIRNYRAA
IWFCGSITIK*FLCDYG*LSNCIFYKELKGRKKDTVIIRATRNHVSSFE*SS*RTCTICS
*KGEWKVKSHF*QHSHTLLCKVVRNTKEKHRPG*CQFKR*TCFTKA**KTTDFRISLGTQ
MSGLLSNSAPFQIKKCNGHCT*QSNNWWKFIYSAGKASFKGEYTLPNR*LSEFQNSKR*E
LA*FDKFLCWSRFLCNR*NRYFEFFNKQIRWCPFIGL*NRTSWSFIMRGFFSNFLSALY*
FKISSDVS**GKI*NAVEKSYRCIQRHRL*SFQFCLHPGEQSSK*LRLSAFGRQFSRQNS
RVQQWCQK*TILSRFI*NGQFLWNCHRWYFTSP*ELSRLCSAKRRRYSTNRLKRARKGCG
YKG*YRCRKSCYKTIRWV*LEIYAEIYR*YC*KTG*RAQ*SGSKQFEIKCTPIRGKYF*L
YLYIC*QKQCHRFEKKS*W*DPGGSEFLL*CL*S*FATF*ALQSPDSIEQSTCQFEELSS
R*TR*V*L**FHRCFEPMCSFHLRI*NYR*CSHVHLE*ICNFAKARTVATQFSDVSSGPG
IYPADRLFASSGISHAIKCCAFTPSRGSRHFRVSNKVLRVQR*KI*IN**VSRYCIYSKI
*H*FN*VKIRL*AEKS*LCGFKIGPNF*IDEFFYP*WIQDYFEKRSPVWIKWIR*IK**T
ESHLDAGYYQKAAAWRFGRTGSCQIVYGDWVRGEDPSHSTNVRIQARRAFGKESEKGWQC
LLENDNGRFCEIGS*INFRDTGDIGEHRGTIRWCWFQWQGVRCIEIWLR*WCRQ*YCSCI
RLGYFIRGGSVSW**IFQDKRS*AHGSSHRYVFTGRSQRTHNSESVRRSAPRPAHGFEGG
V*FIRKAYAYCVRCGMEGKGTDEG**TGRAERRSSLCC*SCTCGNYSAVNWGH*GSV*DF
TGNS*SSG*DA*RANQ**VQVQSD*FVKIFADIFDIYSIHILSLFFFFFSDVEWWESQNV
TDRG*KLKNT*DDILLCIYIYTCIQTNTHASREELVGGRCHYRGEKNKESELAR*NHSKK
KISVT*PINECACIFLIILRIFWLSHGPSVRVLFGHNILVFLHIFLQSLWTS*SVGVNFR
CWTVRTLYVLQ*WGEYAPTDIQFVISDKVGMVTQ*GVSYQHLVSLWNPKVLVPACVS*IQ
ICDLGSI*QTRGLSIKL*VHSGIGLHSDDQFVIWNVFEDTRCDRFVLQSDLHLGLIQSLT
GTHHDGDALPTLVFDVESHCCKSDTFRVLVYSVIIHVGGLRPVLRFTVLAQEDVVRVDGG
HGL*NLNLFVTNRFRVKRHRSFHSQESHDL*QMVLHHVSDYAYRVEIAATAFGAEPLFKR
NLNALNVVSIPRGIQKLVTEPQD*KILDQLFTQVMVNSVQLFFFKEGPQVFLQLPGRGQV
VAERFLYDYTGDAILCVHTTLDLLGHRQKNAWRQGQIEETVWDIDVGTFLEFLDLRS*FV
EAFICVVISRNVADHLEELFDLRVIGFTVRFFQVG*DTGLQVLLHGQFGPGITEDLGRWI
KVTFSEKPK*GGKSLLLCQIT*RTKDRYDGIFFEFDGAFTHLALCGFLFYWIYSFCLYSQ
LERGKGEKEG*VEKRERGAGGSHFRCYVSVYR*THSLLIYGIALASFPYIEEFATLRKGA
TTP*AKNPTLIIFHFFFSHFFFFRLSSSSGRAETGLLAPLEACISA*DRRSMHLIAVFPV
LFHYYVVLPVALLLLLFLLLFKCHYVLDTHSLW*FHAYVHGCKTTPYLPGAPNRDEILFD
GLLDGREDVL*RKRAGCRLF*LGSQG*RIYHC*LLSVTLIQCLNQLLPLETVLLAIE*AT
TVHACTRTRVYLDVVRVVGIGRGGRGGRHLA*VRLWTCSSLPQSGDVPLAL*PGARGQFT
HQILDVSKPGKLAGGGYYAIIVQQSVLDNVAVSTLQNYHLTSWV*SLDSRYVLVGIATTS
ASQIRRPVDSRVPSRR**PPI*TCVLSKKRLEV*IQLL*HCHYFTWRNDTVNPIVKRFWP
*RF*FLVKTWHQRQMVKGLTRDSETLERSSDQRARNLLRRLDIEQHRHQLRFGLFRVYKK
SRTHSR**RLAVRTGIFFLFLMRNDLLYGFANRYDSAHLRSNHILALEMLLEKIHQTQIG
RLQC*AVVLRKR*SALWRDTHNEEFVLLLRKLPPVFQENRVTLATQQDFFTRRYTTRTRE
AV**GNRDLLQLVWFRAHLVFSVHVNVILLAPAHLGRFDARKGGTDKIV*VRLGQ*STHA
FLYTYLVTQEKEAPSLIFPADKTSFLVITIKRFYHFFLHAMSRENW*KKKIGSGKEKTSG
KAGNMLYKQANFVS*SCEEASYIQCFLKFRK*SLY*LCYICYFALVCVK*HAIAG**VTH
PFFPSHQKVTCSLNQWGCMW*SIDNAG*QVADGHP*INDK*PLLFCYMLPTSVSRSLYLK
TFRSHLLRAPQIVLKRMSSSIDISKINSWNKEFQSDLTHQLATTVLKNYNADDALLNKTR
LQKQDNRVFNTVVSTDSTPVTNQKSSGRCWLFAATNQLRLNVLSELNLKEFELSQAYLFF
YDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGGQYSMFLNLVKKYGLIPKDLYG
DLPYSTTASRKWNSLLTTKLREFAETLRTALKERSADDSIIVTLREQMQREIFRLMSLFM
DIPPVQPNEQFTWEYVDKDKKIHTIKSTPLEFASKYAKLDPSTPVSLINDPRHPYGKLIK
IDRLGNVLGGDAVIYLNVDNETLSKLVVKRLQNNKAVFFGSHTPKFMDKKTGVMDIELWN
YPAIGYNLPQQKASRIRYHESLMTHAMLITGCHVDETSKLPLRYRVENSWGKDSGKDGLY
VMTQKYFEEYCFQIVVDINELPKELASKFTSGKEEPIVLPIWDPMGALAK*IVSAALM*I
HVSRHVLFLLYIHKRNKK**RVYYYSYNQ*GSFSETQKTVNGKKIKIEKENKQRKG*HIK
*LS*YFNSIAEENSIETETFSKGKQGTPYLLDVFFLSFHMHNSVISLFFFLA*TSRFVKE
KSIPHISFIRLPY*G*TNPVVFWPRHIIINY*PIIR*K*GNILLYAFGGPFQHPLLYHHN
KFH*RTIRHDSILL*KAMKHYPAWRKCIQIGNMNMMFEGYQTIMFFQKSC*NWAKDHH*K
SYRGITTTTYYLSMIYSRVTTYLRDYRCLLHQWTQACYR*KKLRINSA*MIRFLRGSGTW
SIQVFLAVI*MFLICGTIILQAQGSWLPLLMMALTTKMKT*RIIFALKVLGISTTIPIYL
NQDYLMTTMVRDVQVK*LPKKVTIFAVSG*VTTLKSQA*ESYPVISLRKMKLRP*FMV*T
*TIYIHAHGVPLMTEDIYKALVTW*KRL**KVLLREEIPKERFTFLPVEMVELVVIIAIT
TAILIPYILLLLGLLITKIYILLIPKVVPPSWQSRILQVQANIFIRVISTADAVIATVER
LRLLH*LPVFTLCY*KPTQT*LGETYSIYQSCLR*G*KRTLTEIGEIAPWGRNTLIAMAL
VKSMPIS*LKCPRPGRMLTHKPGFTCQHCMFPSPQTPRKRH*NPS*PYQKKVFKMLTSRE
LSTSR*L*ILIQKLGELRLSI*YHQRG*FQTLAL*DQEMFHQRDSKTGHSCL*HIGVRTA
*VIGKSRLRQQKMDTGLTSTVGG*SSLGNPLIHLKQKLSSLETIKRRLNQLLQKVPYHNI
LPVQLLFPSALLLHLLSQLVWKRRPFPKRLLRVPILILIQTLLKNFPLLGKPCIIF*QYF
*LAPHFWCYTSCFL*NQGEGSEGQERKRMNSISLIQTLSTILLWTMELPELLSPKRLRTS
ILICPMKTILQVCLHQKTVMLNIQLIVY*QTKIHLVTL*SKSSQMTPTQNLLPINYKNYS
LMFLHLPDDRDSICTESFKLQNSIFFL*IIILSHTYTYMCI*YINKH*YPIPSV*NPYDV
LCIVCTRE*NENSEPIYQAHKRGGSN*CIFKTTAE*L*NGRQNKK*VE*TLPA*KE*QQL
IRILSSDFPDPLAQFY*YAFSLKKSAVIWSMIWAWMILRDTRGQKLCRLGRNLSTGSALW
DSCCFYHPW*RAFRSLAGYIQLPSYNALVPFTLS*KLPY*DFKTMMG*KIELQGEPHGFW
WDLLG*PYSLVD*LEELVS**KARGCKRSYQMQVRKGCHISIVVYPF*LF*QVGLKSVWH
LLRSLGFVERHTQGNASLMVSWDPRLCCTGSFMYWFWLYHGFAVPKPHIHRITSTVGLCA
YGAL*ILLLNTGGDVKDGVFTIINTRLWELSGGLVEYSGFSFPEMAEEHLYQV*LLFSPD
GPCLSTPST**LAQKSIICLG*F*CVEAL*ELSKYLFYYVIKERWTKYIHSNTLLPFV*Y
VQVSYLWAQTKNNSF*CCGWEATIVRTF*LSYQAHFWSTSG*LHVWNSTYIYLKRENKDS
FRNHTNLKRKTIT*ALS*ITYRTKMWMKIPLPLTFE*WATNVI*DI*KSDPTPSLLEAL*
LYFFL*YSKCGTVYTLHSLYSNCLHKYIKIATNTFRFLR*SPLYIAVCRLMMINLAISVK
KKKASFELFKRSIISFQK*GPKKRN*QT*PSVGKY*YDAWRAFNELV*DWYYCIQ*LTVL
KCQYLPHIFRIHKWNKLAISYAAKICITPAIARSSIPRK**YSKHSLDNNFCQWINYSRG
WKHSKLRRQQQQVSSTVLL*YIFHSLEQLV*FTR*HVGCM*RIR*HDHVNYWTTS*SGHY
IRKVNDGISR*CLQNL*PRYAFKACRQAKAHEH*KETNKERIQYIHLGISLAHLFKIRNR
FSILRI***F*YI*KQSTASASIWCVPSTLYKICVLGNKEKRSNRFLVPIFKLKGS*KNN
VTAAGHFKSKIQGSSMA*IC*NYTYE**SVYVDNHIFKII*KYLFLQTTR*LEP*CDQTK
RPK*PIVENTIYIKHYFRSNG**RACVEVREPACCV*IIN*ERSLPRNFSFV*CLRYIKI
IGEKI*TSSNTTFS*VFGDIETRFKYRSK*FYESNIPIAPLQPSSPQ*YRSRQKSHLDNF
*DVRCICFILL*RWYHRILQSK*LEVGD*TTYKSEPIRKIQKYYCIPTKRRI*LWEAPFT
SIG*VDEGFTIYVWGYR*TV**KMATVLCCCSKKLRRS*EGFYKCYSFGIWIREKFT*AN
ICRRLDHRCEDAHTQNFILG*KKGQRIYYDFVEKPILVFQHFS*CA*RDYG*NNNK*ATS
KNYAIAAGTWQLFFARKY*RNGESYTLLEKCFVCVQWCGEKFSFCD*TNK**F*PTTKPE
VVPDYIFKTGSHSFIDSCC*MVCQIYHLFDPRNFNFNK*SHKQGIHTSSRNIWSQNVQDF
DIVYS*RNQESHPNSGEISRNIIPNFKRVINFFETSLI*ITSGFRKI*NVFS*CKQQIYR
AMRTTAITGT*VFVVGES*NPPRICQSGRFPPAVC**CSDFPCECGCSIFCRYKWLENI*
FRVFQSRNISFIATIRRGINY*YR*TTHKK*NLQIF*QITVRRCNL*QTECIRNIRWET*
EMQ*VRFRHKSRKYNIE**DNCTH*HPNQKMANHVYKTVHMFRYAF*DGRLIISTIA*FC
IELF*TFHFST**KEMRVTVSGISFF*NTKGTHFSPTEFSVQMSRSTWQIVKTP*AKGAS
EKPLQKKRFLGSNEPEQ*CSFEK*QSLCNHFI*VCPSRDSPPDRCSCLHSSTYKLVVYDR
RKNTSFAVVNQQRHV*RECPPYETDDVQRNPAFLQQQ*YRSSR*FENKRETWLS*SFHEK
*NVIQKLRKRFYATIYFTFRR*CLPGQDRSW*LPEYRRIRL*S*CKRSAVTSNVLGYPPQ
GVFNT*RIKSFSSTSVFQ*TYYFNRKTLFEYCS*RYDFQNY*PYCQAT*NKTKGQ**QG*
YCTILFTVL*QFDCNGSLVRRIFSIIKTSSSFVL*GP*FCY*QP*KRSCPR*LYCEIRKT
PFQNSRHQNRWFRSNGKSIYDYIAGQVWIFSHTGTQKSMGTTLLIFGKLYDYCREGPNGK
DSTRFFV*W*LCGFKFFHSQTCDA*YKYS*QATNGEN*KRYYTS*YNTSTDK*NSYRNTL
RQFFYSNKKRP*IDASNLTKGLWKYKTKHR*QYRRGK*YQEK*L**KNPFIAKNCSAEEL
LDYVTTTVPLSV*VSQVILYIL*ITACSLLPAS*SLSYIGASAETRQVNFSLLSSRV*KI
ISDSKKSDWLYIFFRTRRVIFSHLELTPSSSLISTGFDFANKQQEKRLK*IDKEISTTRV
QKPYEQRFY**RYITTYSTEYVG*YFRFKVLRTFKFYFLFVDVDKYT*SC*NLSKFSDIE
GDIRSKSKFINKAMRIRP**GC*KLSSAAVVWRK*CPRLRSTNGKYDNFPLIKCIG*YSE
RKIQIC*PKN*KGTKY*VFHNRRRRRGRRAKQLDQLSRGYNWIQAVCTRGSK*KLGDDLS
KPY*H*RIQ*YSSCPFEFTVFRRT*LFVHS*SKT*FSGTSEQS*YTTYYSRTRQQFTS*A
GGKYYH*FRN*KHNT*RTIFKRGSETLASFE*IIQPKSSFKQSRSAKVY*FFCPKDYFSR
LGT*RHFYA*KEKEYIFISEEERTETSYW***CNE*KK*DVFIEHFLNEYSNLFKNA*KT
KEEVSQ*Q*HFQFLPKGKN*NIRLTSKGTNEAKKKNPKIQGQKARY*TNN*RRISVIH*I
TSTTKKPRRYSRENRSRNEIN*SEKTYSFKHGSHIGR**TDKYPATRTRKRR**CQK*SS
ITNQG*FFITGLRSTLTSIFQTRYR*GSFPKIFG*S*SRLDRFFRKNKIYKV*QEKFNEL
AKKVIDRYAIDQSAK*GNVHH*GIFCCIIYSRLDEVSC*QHFKEWKVRILR*FLQRTLLR
RYHE*GLFRYQGR*WSTKKR*HIFRVY*TKI*PASDGL**RKN*S*KGCTKTKRRTSEEG
F*KAKRFCR***RVNF*YNGVCKFY*LR***SQSRPRLGRYNGLICNRNP*TCWK**SKS
LWYF*YTK*QRG*LQRKRNSILFRCWSYYIRR*ASRSITYI*TRRK*NK*QRI*E*RFQQ
THRTAHRSYSKK*CIFTRIRTQ*TCFNVL*RTKSPKNEYFFY*LHDA*FSRKIRLNKSR*
GVCKQ***PGCPVFVPDNTLRHLWRIRI**TSRNFHL*PAYSTTGSNDQIGIK*VKERNG
STR*FAMLHTFLLEQKTGRNGNESNHTYQDILVFINL*FIARILGVMCCICGIISKYRLH
YPSPSREVKISKKY*KKKEK*DPEFTDDELMVRHD*LRICILKIL*FFPEH*IPQSISVL
*WHAIFSFQK*LIQVN*YAHSTVRKIKMAKI*FSIMCPVPELN*FNMNTTDEL*KL*LLH
*LGQ*GVRKKKKLIRKKSVKALINLQRKKNQ*MHHLMMSQEEL*KIFWFQCFLGQKRVVK
PTNMLIMILPITYRRKVILC*PG*QGFRCNEPMSKF*LWKINHLQLIVASAVMDRE*SLL
VAVLEQLRSLFLKHHQI*VRHSEV*SGLRMYGLQTEIV*K**NVSSREILLGRKFYH*VT
EPTTI*PLQGMTLGSCSPELLMVLVD*CMLQTGK**LHRLQALQKSANVPNLFDM*QLIY
SAYRRVYI*KRVFASSSLDCIL*WLGKRSGNVIKLFILFYLLYIIVHYHYLSKFAFTRYC
FPILLGKEVFHEYLLNQPHLNLQYHRSFETS*NNDLFFHARFPPELANKHHDCT*ISDHH
HTTNLVRS*GHI*QMVHQKLAFHGSVGQ*KGELTSRKSMLTKEYSSKVLFLVFLDNEFVE
YAALLSLHQ*VGFYYCQVL*EHQGNL*SLLAKLESLDQLA*NR*LFPT*RPSAVPVCEKS
LYFVCPVSNIR*V*HRFRNPKSPAYLIRSRRPPSQQLFYHHALHLND*YRILFSTLESW*
FYRYSLLAPI**PLGNVKNILLSTMPFLLPLRV*DHPPTYFFHLYKPSSQGY*NVLALRH
TFFVAHL*VVFLLE*LSKQEVL**AYQY*SNFLGLLEPPSFC*IS*TFFAFVIFFI*SGF
VLFVGWREGNS*KQNKD*NIFLTKKWY*SI*N*YIYIHIYI*IYIYSDNEHNIVHVQEWD
AHIVHEPIAIKIWQYIERYIACLHSNRVGWNEKNHKNY*DGRQKDDAQRENRL*AGMPLL
PVAFFLRGMTGPVGNRRGCDGLRSWVTAISVAHRYTDG**GRLRSRAENYLRQIRHFVRK
FRISSSCGPLLRDLR*HLILKLQHLCGDKDEK*YGDRW*SLLYGVENLQRLSSE*A*IAQ
VFYD*ERLTVIRIFSSSPA*WAA*HLSSLL*HYPFDDLP*QAPV*WTMGLSWGKTIVRPL
GHQRPHVAHAFLQC*IRRL*NALVWTRDLSTISCIIANGVRCATL*SSWCFSF*SKQCGQ
PLWFAFFLFLAATSAFPALISLRFPLVSFPLLVGTLSITFCMVFGTCCFGCL*RLIDARK
TSINPDSNGTVLYRFP*RNQSNICK*CLS*RQIVRVH*SGNLALKILTIVHHRQISIVRC
FSQVLIVVVFLLSAVSSLISDRGHYSQIVCLNDFSSMRFHIVFVNFSYLDINRFIHSLER
ISMNKNRLHVSYICI*SS*LNKSLLRKY*IFEIFYCDLS*AHRGKCREKYAIVPALLKAP
DIQ*QHPEYS*EIYSISIIT*NKILEFCGWGNKE*IEATEISKLLYTSMTFLFIFALNFP
FCLPIYIPL*PSFPPSSFFLVFKAAFIHHAMP**PRVFSSYASSICKLLEIQF*Y*CQFY
PRHYSMGQRPNLL*LIYLLQAIRDNQRNDFVTLVLYQLSMQPHFPCLIPSPALLYVQPRP
SPLHRKLF*PHPYIFLQHLLSFVNGSI*NVKLVQSLAHALTFGRTTMR*FVIGQLNHRTR
VMDYQSLCNIYLPNVIKSPLIPK*TSCPYHDRLKLELLH*GSQTQIRGPYVRQD*NLGRL
CYNEIQVHLVL*QL*IH*AQTCERKGYIPPVVVLEKIL*FWNTPRDSYPKMPVVVVDVVL
RYS*YYSRYHYFGYHCGRCYCFEHYCYYYCYCYYYYYLHLLKIQNLYYFDRWLYYCSCFL
CLLDGAHWRDSTLGCRCYSSFGVQLNLQLKTI*LITKNEKLKIKKFVRGIFIPLRFNSVL
*TIPNELFEKERFLLFFSTSSKEAFVFV*LLFWPSRKENYMLKPLFLKNSIVAAHQSSYS
ARIEKKIPGCVTRINVVIPDNSRYSFSTLTTVKLNSTQLY**FLFRRSMVWCHYILLVLT
FFLFTTFFTAACPAIFTWLNSLFRLSNDSPHVVHTSIAEVGDIEDGRVDKDGVLFVDLEF
FLGCLPFFFFALVDQSSSSSVCKPLSPSDAKRSSNSLLRLSLVSSNDSDSSVSVSTFAFF
FFFLFFLFFVFTCTFSSELTSSTSISISMLRLSSSLSSSEDDSASFLSISASSACNACRS
ISSFSLTLSSAESNFSRSERLSNPSVMFSSSISFRISSIFFLCSLVFMWFFNCFSDLNVL
LQIKHS*INTSPSLSFLEFSNSPKLSYTFSSSSQFSSFTVCQLCK*NFSSSLLSFPNFLL
LFNSFFLCCSFSLRCSSAIFAPSFILLSSFFMKTTNLFTVLLYSFRACCLAFSFLLLTSL
LVLLS*FLEYMYSSFQLKLFKVLNADQVL*KCFKYS*SVGEYPNKGYKSLSVLLIKLSQA
FK*PILLISCSNTSS*YSENFPSRLPLKISSLANLANIFPAI*YIPAAELSILV*RAELK
NKSNSSVVTPVTVASTS*S**SSVLGGVSFKICSLCESYHALSWGSDSTS*AARITANFC
VASSTLSGFLSG*YCRAFLR*AFFNSRSEACVSTPKSS**QVFIRYF*SSRISLY*Y*LL
AGQTFTM*KELLCDDFKFFSRIFFFYS*NKKKCKHKMLAA*ALQFYNK*IFYTYFLEYNL
ILYLNF*LQLQQFIY*LR**KLLHHLLQDMIIQMVQTPLQMVIYGIHPAR*HKIIVCLIR
KFL*IHFLTIYLSMQTLSKIGQHDVFIFQFDSQQRNLSP*LWIRNTNSQNNFFDSIL*SR
QIC*INLFNHKEITFFCRNIGP*L*DIFYCNPFRSISL*VSKSRPQIIQFL**SVCFLFS
IC*HFFFILQ*CFVFFFAFFP*S*SFIQPFQLNFYFLITSFQNFLLIDCQLVKFIT*YFV
LFGKGFICTN*SIIFFSHGLDFNFFIL*LISEILSFCFCIFKSLRNAAQLFLL*CT*KPF
NIRIFFL*YVI*F*RIFLRVIQIEKQYTNRYFKQLGLS*GVSET**CSVFCLNSIIGFFQ
HFFIQRKVLC*VFNQYCLFFNFFFVI*GFVV*LRSCFELLL*RVCSFLLS*IISTQFNNF
FLIPQYHIF*HSKILFR*GVL*KNFGTVTVFYRDIWRCMFISWLSRSLFICPRKMLRRVF
SRSRVYEIGYILFMNISTYGRLIFFVFWSFL*SWRFLITSISSIIHLIHRW*FVLFI*VS
SIGKVAIDDIFRVNE*R*DGFSDMIFI*PVLWDWLSVFNFPIL*YRRIQTLMKWKIH*IE
ISHDVQKTCHYLLVIIFCMCRFLPEER*RY*LFYYYKRSTKNCLTPHVAQREFSQEDVIY
SYDN*IGYVTRSCT*NSVCVYYHRFFMV*SRK*KNMYIRNC*ENED*KLGKY*LSLCLKP
DLFFLILAKIGSLIPLLP*IPRPSPLFHPSFSNILLPIFSFPISGAF*PTISPSLT*NFP
LIVLVLSKAACSSLGLLISILMNTGLCLINWSMRL*FGEDHFVFFIFSTTTDV*FAFPIF
ELFIL*CFAIFITVLFP*GSNGGKVSLSLFLDKKDSNSSLIF*IWSPYGYFLSISFEFLF
S*SMKSSLAFLFFALVSMRLLNLLCNVSNVSVSSAKASSMSSFFFLPLPLVSKDLVSNVL
NLSVSCFNVYAIRSSRPSSMSLCTTEEAISSSSS*LSPS*LSPSSLESEIGISE*VGSAG
SIFGIREFLIKFKYAGNLSSGRPNSSTTKSVSKSWSIQ*KS*SPSNL*HRR*YELSTPPI
LILETTMSLVFMTKSSSLNPNSNSSLAGDGRLSLLPSNVLVPFIERHFISSVNCGLGLGK
RLLSAREL*RWPT*LNP*STSELAEDSYKGSLLFSVSIS*SSSSLSESLVCIPCNTLEM*
PANG*YVLLPLFGTSTLISLLSLPSETLSSTFPIVKIGSNSIATSLGLAISSIHTLFILV
RSGDC*ASSSTKNRSPSSTLLSFEDSEWSVEGEF*LSSSSFSLSSLLIYSTSEVIFPGSS
KTSASLSTISSLFFVSFFALSF*IILWDGS*TSLAFTNCIGLLRNAALPACRSVEESYRL
PGLKPPIFIERLLASRPK**SSIVFGDMNALPGLKSAPTSSRSPSPSGIEELCQLLVGVG
FFFIFLPCMPLAFPLPAFLELLPRACLRLLP***LCLFAIFFDGYNNLCLYLTLRLNHFF
LLETLRRPNCCCFVQILFNCKMSNFTFIL*AVTVAAANNSASKEKSKNIHTITLVDEEWT
TSYHV*E*YTCRGGYNCGKWIWYKKCLMAFLKARPKNRLLL*IMII*Y*GKYILSETKNL
ALNNVNKTVDIAVKRLVTGF*ALFLVGKFLLTQRNFFWMYNQGSTLHIGQDLFL*QGRQM
GLHL*V*IY*YVQIRSVQ*RTI*QILIALTLILGGGV**GQDKVCWGMPYKSFIWAEISG
*MVTKVWKENQNL*IGLMTRLRLHFRYITLFLQVQNSLIKDQVNGLVPQLRQGVYNL*YM
ASPNVASMIV*YLFHPAISMKMKLKKYLLRIQIVEYCSCWA*SSGLMR*MRAIEKVYVVS
*VQHSQ*ALPAVGRLHRCIFLVIKEMNFYISILIFLNRQ*KIHL*SRAIPVNLVNCNYRK
WIPRCSLVF*LRAKKTGNNGS*KLQNLLLSMFLLREWMTLM*VVVWMTWKV*VLTQ*RKM
QAIMKISEY*RETT*ILVQYSHTQQIQKM*TNMIVFKIFIARNRRLLLWETHTLLMRI*Q
IMK*KASL*RRKR*VFTVLLMKNASVRNSLVHKHIYLF*YIP*N*GIQFFCSYSFDHPLR
IFRLRQWKELKKRKIIKKKASRHELKTTCKKIKTTVV*TSVEVQNA*SSQFKLEVLHSLC
IKQQSFNGIA*SPARSRL*C*LLRNRFSCETAWSIDR*A*CVLIWYTL**YI**SFITIS
RPLQVERFIANAGS**KTQKST*KMARKYKSLRLRFHL*REMF*CRL*RFDE*RWEIKQN
SACN*C*H*R***KC*NW*QSYIGIS*YAQ**NRTM*KR*HSL*RLYNGHFN*VAKLTFS
TTVIIRSFILLNKTVNYCRKA*ALSGPHESYIIREISILSQVFDSFLVIFII*YYVSCCG
SLKHIICLLST*LFFYQEA*YTTHCIFSKLDNVLSQCSV*QVSFQNTSPDIGLK*RK*KH
ETLKVSVL*ERNK*KNVPFISENKSKIIRSTRSYQDLPKFFP*RERAKLRLLKRAHLQTT
IPTK*SQQPYLHHKLKFIRICRQKLKWHAREK*SKRMPLQSSLLKGPSSPNTNLNLVSNF
SRQKKQRAPKISLTQKSPKESRD*PMIETREWKRQQTRLPRRMCV*PRSLHQ*LQ*TIIV
Q**MLNVLLLLEAHV*SVGLLDLL*YLKVSMRILKKFKKKLYFNAKSMFVK*FY*MELLL
SIYTSCQWKTRRLRKKKGAKTGNNFIDIFKS*GMNQ*AL*WQRRSPYLN*HIIRFVATFN
L*MCTYRVPGSKKTIIARYDCYLPSVYIAL*DIGRTYNSVQFIIRIFSTTPPTYKCWYLH
F*SVHT*LVAGWPHDDL*IRFPYHFHNLSGRCRW**NQSNHVPLEVEFSNHDLFFRLGGK
PLLPIVANALSPFLELDIFLHCPLGDLVRVVCKIQQ*YNVGRM*GRMKNY*R*CYQECEI
DISDFYTMQLVCSLQSTTT*PWSWLHNLCKTPKHHLHS*CLLHPER*IARSSYCPSVLRF
YHSAVNNQFHFSVFVKISSLN*KNRRFLRYMPVI*CYGCL*SSRN*SFFPLASYPTSSWR
PPFYKMSFLYNPIE*MDNHPENIIAYSRTEFAGIA*GQCDTSLVSGSVDAITVAARTMVT
QQSNPWS*AFLL*LME*KDRHFL*TGL*FY*CCSVWQLAICNVSQKFLLMCFGCCMIEYV
IQGHIIR*KRRLFRLEDSFHAVIKCRQN*QSSSVNHLISLEQLDDADLWLQMQTYTSVVG
HYDR*SLKPF*IVQTI*STLCSLNTMLMTLEL*LPSMSRLLMNIDNLVLLVFPYVAKEC*
KPEYKLKGVTL*LQYPFVPKIRRMDPVA**NPHRFLH*NYKLTLGIKPGLRDISLSLLFQ
LLTFL*WILKSPPHCHCFCLLQLLYQYNLNPCIRPHRSCRYHRPTYASI*SIFE*VPIPF
DIPIFSSCATF*HSKCGWVAKQSASVSSYI*PCPWE*VLIH*HQCNHSSPYDY*VTLYLD
LLLMIL*SFALMS*FSALRGS*MM*PLVAC*VS*K*IC*PIVAALWTF*LYKVALHLGHE
LFWKRLKTPSTHPADHFYAFPSKLYCAFFLEFYEHYAKPFYDAIFEAMPEIFSLSWLLWN
YAWPIATA*PRIVEN**IGPRLAYFPIHSDHSVSQFLLMKRPRPLL*LI*HFLCDFASVI
DSY*ELSFHHFL*TNSRSFVIIMRSILTFLAKCSSGRLLNKYPRSSKTCHRSENLIEFRS
AFF*CEFH*KVFPQCYPLTRVQCHVHITYEKMTSKEVNLPSLWPVESIVIYFATN**ICK
LKGISNYRNPRESDGEISPIQFALVTKSSGKHVPLTCSCESRYGKKLYLNNLDFTFTDRD
PFH*VTD*QSK***VNIISKKVISFSY*SFLF*LSLYFLTCLIKETIVEAYLDRVNIKLF
VG*GRGNRNITKFKAYQNG*RCIGLPMG**G*R*TS*FTGW*I*YCSPLRRW*QCRAYHC
CRRC*V*FPYVTIWFSQPKLPKPFG*WCCYSCSIFFQRVGNLGS*RFEERKE*IICFFQS
TFSL*LSSGD*QAKRIGVIRSF*RW*KYRYYR*RYWSNLFHKGF*IWFESSSFGE*STRC
LGGICC*I*EIIGNEKTKIR*FRIRL*SQAC*IQEVKRATKAIRRRFCRFHAQCY*SKEK
DIG*GC*CFDVGY*FWYLSICDFFQYWYWWCPHRFRYSSTYY**NLWCC*SLHN*SW*RS
FPNGTIERKWRKTADHWC*IWCHYWS*ASLRLVRLGSLEILNFDQWIHEFEHYQVRRPRY
FQRNPSGYFIFYSR*EARFVP*RLEYSW*S*S*IQSFARLGSRYYQNYKV*RFAGKRKEV
LKIY*RFCWRSC*MGWYRPRKRKHVA*RN*IGRWTSMTNFNLISFHSFIVLYIRNVTNHD
IF*KFSMKK*KSNEQTYFFYKMHKNI*IYIYLRGKMLKLLIRKNAQNK**AGFFFFCCLF
*RTCISISSLSWFFKQTVINVTNTVHLIPLFW*NYLHDSVDWLRYVKCSTQNLRIFTVDE
CSTCQLIPVIHQM*RVENVFC*IYWGDDVNKIITSSDRPLFTGIIYILVIHSLR*SSNLF
ENRTTLWKITWKKTIKSRFNKF*PMIIWQQERTWEVIPFTSRTYIHYRCLHTTLI**RKL
LVDGYRSCVIVHQSHYP*HCLACNN**N*QLYTFFKNRLSIE*IQHFVKGDTCTQSY*PV
NWIEKSFLFVRLLSENGNPCE**CP*WP*SQMENSQNS*N*HRQWEIQ*QI*WIVVPWLN
PENIWARFLTCINDIVK*DVP*YRSKLPVKYTVSDNHSKCSQ*KYQTAVECGSDGRNNSM
VEKVM*T*WQA*N*NKWPA*YTSQEIVR*TFRKVRSRPSGQIA*RVSGGTYIQQHGNGRR
Q*FHRCMEPARIKQLENNPNICDLQCQAACNFTM*FKFHDKTKKA*ACSCDEKVPMTF*V
SKFVYWIKNTVKR**ESP*SNRILG*IFPGLFTKSTYQ*I*WFPIIKSFIAI*N*RECRL
NIYSC*K*QQ**TNGYRLAIHRSLIIVLQGEKRANSIQLKF*NLVE*P*WYNKNEKVFSI
VSKTPLYIQLSLFQACIDSSEYRRTVLIKIQYCVTDLLLHFQVNKPGQDARRR**KVGIT
CARAKRI*QHIQVISGRLDTSYTITV*Y*EPS*N*HLFFVF*LTFNHRLLSL*NCTRCLK
RNVF*GRSSTGKK*LISRRTLAVRSETGSHSLNE*QEDICRTAHIMPNLL*KSLFFLNQL
SS*HMWQGKVKAFE*ATNGVKSFGRPKKEETS*LREIH*S*K*GP*N*ARS*ERE**Y*D
C*K*KQKI*GSTIHGFCEINSGACFEQRSTSQRLRKQMVAENKPFAT**KIEAKRIKRLC
RSAAHSLSR*WYIVQIHKTRDYTIYDTLGPSRCRKDFTS*TINENCDNQ***IKCWFQVL
HDRNKCDKGKYARIERYI*KIKKGISIDQKKNCTFY**NSQIQ*SSTGFVIATRRKR*HY
FDWCNDRKSKFSAEQCSH*QMSDFCPRKAECQRTVYCFIKRNCIIE*MQETSMEY*KSFE
IV*KHTGVRGRSVGG*YKEGVKYVGNDRSFNKRAQGRRGRIIYR*CTRHN*EQQQQRVEY
IL*PKGR*PL*YNLCVS*IH*RWGRKRLTVLFSKNVAGRRGPIVCCPKNDSNSF*RYRIT
G*FIIALGCRGT*RSNESWFARGRPCTGAMLCCFG*GTKVSRTI*SLEEIKGNDEREHVQ
FSKQ*DTDAYQKCANQIDGGAGLS*RLQVQSRLY*RKSPTRLLSQRSAREMSK*N*LKVP
GRQTFRRQRRS*LETVISGLVKGLPYFSQCRVYNSYFFLCWPMPLVFLRLRRIALLARFC
AA*TI*TIILDNQGSTFFFHARKVSRAHLRYIRTYTHPIRRAHYS*ISSSFSSTFQLVK*
ARLEEHRYAKMEDKRKRRAATLSTALILFVACCVYTLYIFKFDNPRLSPPVSLLPTISTL
KKIEHVTDLNKEYVFVGDVHGNYDEFIELIDDKIGGLGENITMILLGDFIHKGPDSDKVV
SYILNHKDQVKCVLGNHEILVMMAYLNPDFSKWVRRPKLMTPLTFSTETNFIPQDISKIS
NAHGRLARELGFSKLSQLAEHCSMAIELDLDITGDILFGAHAGMVPGDFMKPNQIPGVSS
LSNMKYVDKKNWSKTSREKENKNYVRWYTLWDKYGDHFSNAKVFYGHDASMGLNLRRQTK
GLDTACIKNNLLSSMKVKYDIKKGQYDYELIQVQCS*NKKYYLKAQQILYNVLYEKDMNI
IM*LIILNLKFQ*NFRWSYKYSCPMAATRLFFVVEVLKFSEKRKQNRKQTTAIISSTPNI
QHLNTINTRFKQNKPIAQKVVNTNRCIRNRPT*DTICVQIISICLVQMILKLHQQNMLMH
WIRVWSLLTVVLLQSQRHRIQPLR*KLIKTKKTLVLLLLKLVRKWIRRRSKRKMMMIPLK
SV*QLPRLPLLILLLPLTLLRHQVHLLLNLLLMTPLLMRKRNK*VVLLCQI*NSILIATR
MRMTL*MILIN*RV*LEQTVVKC*TPSQENQKRMFSSCHPIIIPIYQR*LRLILRHVVKA
TRY*TWKII*YHTITLEKLSIVGCRRNRILMV*IIAIAIAITRILSGPKQK*SLRILMAL
RKTQPAKKLW*TLNNKLDYKSKLSSFVNM*AAPHQSQAEGTMTWSRSNNLKKIPPIIIIA
TSTTKTMIF*HRTTTLKQQMRGMHLFKHKGP*FREALCPPTIKLLLQMRKMSLFWML*EK
IQPGVQHILFTMKYPIMCLTTRVILLGTDLESIFPKD*STFMRLTSLVNWLETTMEI**R
LKFCHHQLKGNFQQMKITLWQSRSRSSFIVICFKSTLILEDHLSQMRIHPLL*RGGI*QW
IQIMCQGVNPTLQLTEPKAVGDRLHENFSSILPKSMQHILRMLGEIGLGSFFSLTALMII
LVIMKLKKLRIESRNR*RTSPIDPRGLAFPLLAIITLPPRGQEIIVLKEMFSLLPMQRPL
MLLPLLLPLLPTLTLYQKTNYWTKIP*ISFPV*RMIYPIFQIVCPLSIHTRLRKL*EAIF
RMKIYMIILILIP*AFHQKLQQQIFSCHCSFILAVRDNLWINFMKLFQEIMSHHRLKNWY
RIFAMKLVYVKISVRAY*RVYPGI*WSFLAIS*TCLRTMLILLPTFLVFGHMMTTNR*KA
MIKNK*GNWLKSMELVEWK*GKDFLRRTCYE*LN*VTSLFNLFYSFISLIHVFYFVFQFN
V*FM*TFTYFNFQNSYND*GGTVL*NPISKKERRKGGKYNAERRFSFLTCLFFKDKTPN*
QITGD*QTTMDSEASDIEAELSDSVSAGGEEYIDDDDYTEDIDDQIVTAKSSRRTARRSV
PKGVRTSKRIRDKELSVEVDEDYDEEEDVLSPSKKRHLHTRSMDKRQVAATASEKSDIGD
SKGNDGEIEDGILEEEESLEKELNRGGGKEVEKSEESYYAQNDVGQKGEEEQDGESGGYE
DNEPSISKESDELVSVVNGNGNEEDDEVEATKENTTDSTRSTTTRSKMLLDLLEDGGSKK
KLTDEEIQLRRAENARKRKNLSEKRLEEEKQDTINKLLKKRAGKSRSHLPNDDEKNDGSS
SFVKPRRPYNSEGMTRILRRYEEDLFCTF*VEDAI*VFDVYRLFYFCWYRLGSVLLLHPR
CQVNL*GSKIK*KH*NISIILISRTT*GRLKIMTSINSFPRNIDWPSNIGIKKIEGTNPT
VNAIKGLLYNGGSIYAFLYFVIAMFVEPTLQKQYQQRNDFSLFVLLRLRRIIAQLQKRLV
MTPVSSLGFNEQNNFVERSTQTSDDNIIREDNSHWAEMIYQLQNMKQELQYFNRSSGQPS
ESIDDFVFQIKMVTDQVELTDRSRAFSNKSRNIIQGIREIKGWFVNGQVPR*QSKIIALN
LKRSSARNASV*SVANNTVIFHST*EDTYQFLQVKVQKRFH*RYYCMLSILMYIYMFLYL
QEVS**YINPSKVLLFRAQMLQNV*FVGVFLFRCTVVRLERFKSANIPCY*FR*I*VGPK
YNLSASNNLIGYKIGILFSLIHFFYPFSSSFPSLVGVIVFLISTLPVGLQNSSNSLGRNF
EPVCKIRCCQFRKVEFQ*S*SLHLFL*YLFWWVPPLALQFFSNCHFLLLPLRNVFRTISY
FFCKLFIGQTRFID*FNNLFG*PSPVLIE*WTAAQAMKRTTCYSQNVHAKC*PNDSEGSR
REYVVPC*IAYRDMNSIRSTLLGDFLHHW*LVF*FYHHFIFTSFMIILDDCGNVVIFTNH
FYLVMSLKDSTESKVVKHFIRT*LVETNFILSLRIQSNNICSSYSD**TF*RSLWSLVTS
QSSSRYLLGSLIF*GLRIPLKLL*NVFTTMQL*AYVK*ANLIMSWRFIG*RTIVKEAREM
RLRILKTTPSVFYPHSLKRKKRSGALKYRIKSCFTKHGINKETWRLCGRT*EVMNKMKRF
NLLLPLMCRFLMLNSLSKLFTDANSK*GIKNPLSLPQQMT*RK*SIDQPGSLFKMMMTS*
IQAQMTFKMLKTPLLSTRRKVKYWKELLLH*KKFQKGNIVV**CLAYTCMIQFKKNLFCR
SPW*R*QLLIQASTNFG*R*KVKIIVLGLRSPQISILPLN*LPMPFFSTIRYKTLHCLIC
*NLRT*ISVFNSGLLGLNVYG*L*TKKRGPTFLKRRKIIF*IHHPCHWKSNLMTFYT*MT
DQMRKEIKNQAKVKMIAKMRMTKTITPKESFHLKPLKNLGVRLPKVIVH*LSPLGTTGHM
LQEITELVCSKRMMKTIL*NL*LP*RIFLI*VVKALILISQCCIWKIVI*F*LMAKMRTN
FIRWI*KEER*LKNGLLVTRMLFNMVQPKNSIK*RLNKQLLAFHRKVSLKLILELTEKIK
*PSMNQKITWVNITLALLEQQRVVILLLGQKKVT*NYMIGSVLGQKLLYLH*AKQSSLLL
PLLTVNGYWRLARVLCFLWI*KLRMEKMLATLDF*SRSQPVKMLKHMY*KYDQNIRHQS*
RTQKNQSDLRRLILIPV*ASKNKLLLHRRVLMRFLGH*RAF*IKMVVIIILTESVGTMLM
LLLIILNLVQTKRLSLP*KTMSLYRK*NPLNSQAKES*CQVLPSKIFMANSYFQGFKVVF
RVYYIVVSLPEVV*YIVLNIYNGVK*KCQIVRSNII*IACVFFVLKRDFSVKCSQKVLLS
VL*YLYIRQG*INLF*SGLLVSF*TQK*ISFHPKIKALKP*ISVVELAYKDIEKQLIGQ*
KDLL*YHLLSYIPCVQIYGNLDYSVTCSKTILLYFLEACLN*CDKHILVGNRVFVQSF*D
ILFPNFFTFLNYCFS*FHNGFFSKNRKNLRSHQLNTNCFITVTISRTS*GNI*KTQYSKV
SSAILSE*YYLRSKYRMICRFRNRTVDCSWRQI**NTFYKVDTGCLSLPPFH*QVEY*EN
GKL*KLQMQNIYLVL*FYPLNGTIAF*PPTVLI*VMNLG*FDYASQLLIK*DREF*SASA
YQNNE*PTQPSAILFGHQIGETIRRAPGGKAIQQ*KHIPGKSIIFEARS*LFFLQKEFTR
VLRPP*QDKRSH*TKL*HYIYFVPVGGGSPQSGIYRQYIGNMFAQVCFKGGLEGF**YFL
HISR*PPTYSPRRLFSIVQKNQN*GFCTMFYS*GNFSDKPRNFTSKLNSGRTAKEH**ST
DKWAATARFHSHSRNKTEQNTNHFPHWS*RNEN*KLEGKIRRQHKNNTY***NDCT*KEP
P*ICSTNNTNFG*LILNCISRHQYRVCINYFGFIDYAEMVLEDTRL*AYLIVSMMAYTRS
HLIRIIRNGKRNVDFLFQFFFFS*FFWATQR*DKKIFQLLFSIEFFLLSSPICYINFVIL
HLLPIVFSFKKPRTNILINNG*RCFPRCYRYRFRYNILLCCYL*IFR*NYCQRTR*QSYS
IFRCLHPTGKIDR*CCQEPSCFEPKKHCF*C*AFDW*KIRRRVCPKGHEDLAFQGYRRRW
*PSH*SPILGRNQDFLPTRNFRYGLDQDEGNC*S*DW*EG*KGCHYCPSLL*RCPKTSYQ
GCRCHFWFERFAYHQRTYCRCYCLRSRCW*VRKGKTCFDFRFGWWYFRCFLVAHCWWCLH
C*IYFR*HSLGWSRFRHQLVGTLQG*IQEEDWFGHLRRCQSFEKIENCC*KS*ENLIFCH
SNYR*S*LFV*R*RFRILFD*S*I*RLERRIVQVYFGTC*TSFEGC*DL*VSNRRSCLGW
WFYQNSKGPKVVV*LL*R*AIGKIY*PR*SCCLRCCCSRCYLDWPIHI*RNQGLVVVRCC
SIISRCWYAR*HFRYCCPKKHNCSNHQEKNLHNCQ*QPNHRSIPSLPR*TCQL*RKHFVG
*IRLEEHPNDASW*TSLGSYLRS*C*RYLEGYCRRKVYR*VF*HHYLQRCR*IVF*RN*K
DG*PSRRVQGC**SFC*EARS*TKTRILRRFHRTNRH*PSLVF*IEERFQVQDRSCFVRC
FGCFANRRPIR**VEKGRSWFEESCHQGHVFSLRCHSG*GYTHIYIFHF*CLSFCILDEV
LVLYITIKISYNHKFNYSSVSPLEASNECLTDTHQHTKATFLAAQSCGTYETAFRLHKTT
MWSFYCIRISPR*HSSFMLKMRRGLIFSINNSGTRTAHTGKGAGCWAWQKTQSEQSFIKK
DFNLSC*TLVSLPNIDHLRQSNKCPKCLQTNSTQVANKVNITSKTTKKELVLQTTVNMVP
TMVTPTVNVVYFPLL*VAVPVRTLDLRCRTTILS*VVCWAP*VVHSLPTRYLMSVKSISN
KSNTATQTSEVLLKVDTTTITVRTITTITVDLAVQAALAVKVSEDKAHKDLEVLVHKSLV
VQVAKDSVVQILKNSAGQVAKDSVVQTLRNSGAKVVKDSMAVHVGEWLNRVSVIFS*LHT
*FIYIYIYTTRFIMMS*QMTYSRKENVKK*AKNLAMRFSVEVGTRNS*FW*GQGSSVISL
K*ELLNNIKPFILGSSFY*PINTILNISSTTYFQSD*NEIGYFSYEIFDN**FSCPPGR*
TRF*KSRSRSNSLDSSNLGDEIAVRNKPSH**FGQA*PYFQNEKCQI*WLQANL*RY*LF
GFENHVKQRHCLFCR*HYWCW*GI*HL*SK*QKWKP*SNENSQIR*NLFSFRQK**RLSE
EIQPGGKLDASFTFGSQ*RISVYVHALF*GFQGP*AIR*LASYSRYGAYRGLPNEEIKKT
*EYTQAL**SDVFHR*SSK*RTYPL*F**V*YYDKGQTRG*KRLWVRSY*FSTMYIYSTP
RRRLLFPKGC*LYSSFLQKETEVRTKT*FINARH*RFRRWL*ICVSRFQKGR*KNRQFG*
IGAGFRI*QKASRR*GPGNCR*KHEKCCL*FR*RYV**RGRRRKWGGRLFRGG*IL*LRT
***KF*R*Q*RCTRRGERTYYRGAFQWC*KSKNG*TRKLYTRVV*FRRLHKWPQIIKLLS
IIFLIFKPCYSSG*KKWYL*TLTYAYSCYIIISNLSQSYSTPDPSSSSSSSSLSISIGIS
SSSNGSLNSLYWSSCSG*PFIEAKLLSLFKALWPFLSSSSSSSSSSSSASSPSSAPSEDS
WPLPSERSLSASKFWSFSSSSSENTPAFFSSCI*RVASCRIDG*SAVPSVAWPLLLDLAF
NSSDIDLSFICFLLT*SSILAYSVWSIMENSYFSPSFVTKLALNVNLVIDE*VIDSMSEA
SNNKMGFLNPKII*SGKKYSVPSLVPL*HCR*NEFIFSASVSTSVLLTNGLEILKPVKMA
CFLIYSTHFSKSVTLESRSPKFLNWFSVFSLFKVITTGSENLLSSHDV*VIKRYIRLGFS
GTGKNEAILIFLFS**MLNSLSFPFSNVITGDPSTLER*NTKSSFFLNGDSTETPSNLKI
VLVSEISSVLSRSEETSILGFLWRPLLSLLFSFNAYLYNSSNISNELGSTLTTVPIFRLR
DSGSSSKNNFDIKSVGLYV*IVAFWSAFPAPLHHSYYYTLMRYSVC*MKKKSTTRH*LVG
*PTK*R*KNKIRLYLNF*SICSYDV*LNSGGRMSPPVKQEKTGEGKWGVSCNFSLKCTND
LLISFGKFLC*MFSIVG*TTEPLKSSYDLYNASESNCQLLEMVPMGSF*NFSIVNVLVAL
VTLFSSRFLSELKQAGNLSQS*KLSEPNTFSGSTNSAPSEALLLLDISLNVLSLIWLVAP
FVYCWKLLNPKYMFRLISLLRTSLASLLL*LLANKLSYFSRNGIPFCKIPFLDKKEPNLL
FPLFSTLLTSFSSKLSIVIDFTQNMFVPIPLKRFAQLTHINMPKLQETNCGLTLLHSKQL
LLPAAFLARNNLFRFSISLLFSNKRMVHIFLGPFYTSTLL*LV*FVN*RCFYYAFAGLTS
QNHFQTARTLTALSISNSVTIGVYQKG*V*E*GSKSKKI*I*KEVRNF*YLHF*SLGGRM
FESWIL*IQQTLWTANSLLRVLGDLIYLRVKWHLSLVELARYVGYRQKPWFFLAVRQLLS
AGTKKEQNRQQKVFRS*QRTKMQSWLLQTSMFAILNKWRMRLKRP*RSSVRSISSLPVLL
EILCAILRTSLQTPSNLLLT*IY*EVLIPPRHA*RS*KSQKVPSFSSLPLSIIMVCRFKD
MWALLKRE*THWQRI*RLSWGLWVYVRIALLQVLSIIRKA*RD*PAKNIRKRPWQRYHYK
GLDLHGI*PNLLFIFFHPPHRMSPVPS*LLTVVCGI*GPILDMSCIQKP**RV*HLNYNT
YRY*VLLLYDTFSYAF**LIVY**ILYTMSALSLLNFLQP*PLC*LFILLSNKEKLKYLH
SFGQRFF*MLTDHQNNGGHFQSVQSQNVIF*RF*CQYLLNDSKQIHLLTYLQKCHSPLQC
YFQS*NDRVGFLPRFLAYPG*KGYQ*LFSRHHHMFELSICLKW*SLSYCCSRSF*RHYRC
HHKNHWFFPFCYGHHFDKLYILL**CGKNLECMNLQDYSYLCSPGRV*KPAHINFLKSYI
DDSIYHRDT*GF*CILLLLTLAASYDYRR*VC*QNLVYRFLI*IFWIRHDHAQCKQMIPI
SLNELTKDRLL*PFLFAHLFLPFPL*YPS*LMDQTVWVRFYYRNLQNIPLLEIQIQILAL
DYSFHRCYSDSYLN*LNPSLNHN*NLGNLQMCS*LHNLICP*DHMNLLHYPHILQGEAKY
LALAQLVLAIRDSCRTEEWLKVSITTWNQYWSCNPADISDGKTCHRALIYVAV*KNLHSE
RCELTRYRVRL****YP*LKS*HYYPSPCEMHNLKL*IDPFEQVFYRT*NGQPHLN*LTF
EHTVATI*SRLFVFVQTSPSLKSFLEGFWYHKALLVCPKTSLLEESRLYTFPGP*QFPRL
S*NYDRLKIVLIPRLLRTVSENIFSLLFLSPHFPME*PL*NWDLLILNISYDLPLM*GIQ
YRILKSQLFP*SYRPPPLTPICLFYCKVSKF**CYLAKINPSVSFLLLLCGNEKSVYQCN
LTGG*TQWFRFSKNRKKYFHSKSLELLVKFDYSVAGRWRARSQGPL*CREQTRVRCRWIL
R*LKKYLTLCSFGREQ*IHIRCHIPYFLQNSRLYLSPLNPSKQ*AFPPAVDIQYFLLVWI
LVKFQLGSLHLRQQDMRTYLRPPPLYKTLYLCLSIRCSLKCKPLLFWVQY*PKRLVQYPH
PSGSEM**VYPVMTLLLLYVNPKLFS*NFCFKHRPKKILFSTGLIWNK*VSMNYSTSSVH
SSLFFFFSVCAGFESTRSFRFYVKGGRENIVNYATDASNLYCAILVISTLQLPFRKYWSS
FFCFFFG*NTKGKKKKTDRKRKDGASEKETTVLSS*KRIMMAICSQNKGLYKNYVW*WHY
RFGLSEFQYLVCGFISKWLKAEFIGEISRNESSPHVMSCLILPYVRAAWLGDSQRYKNSR
IN*GLRDRTFVNVPTCGDVHRNNRDNVLHFAQFFDNALEWLSHGRLETKTKYCIYNA*GL
FRLQIFQPVSLILRQDRNFEKIQLVNQLFVEFSALASLGVENNRVVTKKLQMSCAHETIP
AIVTWPSNNKYMFALFRFCLASQWKLATYSLRDTKPS*LH*LL*SESDLRTHQFFVDFSC
KL**NNFQRRHFYLTMISL*YLRLVC*NENMCWPSNRQ*YKQGSWSFDILLEFFSYI*TY
VYIFTIPIVSTPCSLVATETIK*EDPR*K*RKFYGSAAK*RNPFCILYIRNNVKRIIISS
*LYNNVCSL*KSTRNSKIVNVTVK*LIIPPIYTRKLKEKAIYVKHYYRVIFVNPLTYF*H
NPCLQLTFSLTTASLGAVIPILFLIAQFFGLFQK*LRHKLLSMGVSRLLYL*VPCCLKDL
NQLSFGCYSRLN*CPDHHLLTHPLLQLSSASASYSYLSVAKVLPPLRHPAY*HLTIPVTF
VSTNGIHYWTLYYSPWYYWKHWGSDLHDSNQIQILLSQDWLAVYNILSTNEN*HLVIAFA
VVFVTVETMMDQKAYWYLGCLLLYY*MHSYL*CRFSLYYYFYCFSHF*HF*PPWCLFFSF
GCLACFYFHSS*YYSHFQYYHCSHYCSRCLFPVNLMGSL*LMYLRSFPSCVLELEFGRSE
DRIL*ICSLRLIATIHRFLILSLSLFAKAFHPTGGSILRKDLRQNSALVP*SSVEIFDIV
RLPILVMLIYRQLTQMIV*RYIVLIFWRKVENIALAYIFHLRWH*SSHYYQ*WQDCLHC*
WLR*NLNYHSAYH*RYLSWFSSEHYYQC*L*SHRC*VCYQTPSTLLD*LSLFQPPR*PYL
RACSLSSVASL*HSARKHH**QTR*TVNYKL*L*IHLT*FGDALCECNFSSNTLCVLRFL
FGFLVVFPFSLGVRM*RKSNTDRKHLMDALMIIMSNGQLSQKSRYLKEKSRENFILDKLS
KKNKKYDVITRIEIPLKDIHKIDQFGHKQSRTSKYQICSCHW*PIFF*SALVA*G*KYYI
EVDTDIYFYKNEFWNKSKANTYI*WENIQRQSFLNKERIKVGSIKKRYSLFKTFVGYDLT
*ALGALMTIITLKSDIR**DFSLSILFTLAQAKWNEWHIKIENKSSCCCRSGIGVRKMVV
KKKDGGFNS*YNSNVRQKKKKFLLYARCNVIVKR*FNVIEEIKYYRCYSYY*SV*KILL*
QIIKEKEKMRQKILFLL*WGKDEKQCI*CDTCKEIRFLRNHFFSFLYDQH*NCNWKAYLH
*DLGYHCLLFCCLGP*HPVGFLKSLI*YLPYCSQWSEVTVYHTIQLTLWLQN*HHRIQRS
TSVRDYDH*MWYSYS*MIVF*SLLDQKIAVLVLAQ*RRRVNSLHKGYYKVDFDQQGWQEV
EFWLVVTNQPEKSRQIQ*YLRIMR**SYSCVNFYLNLILRAVLFEECYFDSQDTYALVGV
VA*ICSVFEV*CSYQRCLPYLKCAAIEKTLNRMEAMNLKRLGKC*SCYQFASLVVASWQR
VPG*HHYCWLHCWSWRLHWHWCCYS*VQWLSMLQRVKRTKNHVGMQKYFPILKLA*KVGE
CSCNR*CWKVYRLCPISFH*FQCYLSKGKICQYQMFELLIPQTNLDVNG*NVTQ*PGLEK
ITVLKNSLVVDYIVVVNVFA*SVVVAVVAVAAAVEIAVGLKENHWKMDR*MKTWIFVITD
LAFSFPSSIYSILRCH*KWQMMGMKPSFLLCHLLFQRLFYWENWVQRVHFSNSK*RHN**
LDSITQIWQ**KYHSRLLMRQK*CLMKSFFSVILYFSHLQQERRLHSIL*E*YPWLHLTI
LGCSSP*CCYRDC*CCCLQCLGAYFQGQVCLA*KISLRVSLCHSNTTPHLRFLYPTLRGD
EK*CSDSNWNDDWEKCCVCWWY*TQRCRYWTQMTLFGQNKLNFAC*EIQVFPSEILIDKG
CSR*VTLTNICNSQKSDDKDF*LEMI*SVEKKLVKQMKNTGRKQEQKVFKVHDLFSL*C*
LIE*REDRKETDT*NMWTE*TTVREQRFKSLFFLEVCACLKKAIQSGGYTCLFRLTWSCL
FFLLTSHVRKGPKQREKKAAISYPI*RG*Q*RLF*IEQISNS*EHEEGWR*NQCEAV*RS
SFPFPFLLFC**YLI*R*NTIRSL*IF*IRKAK*QLDRNKWGILTSATLVAWLFLHLGLV
FHPYTIFQARW*HF*PCLSIPSLAAVAFYLSHADH*MMQIC*DLR*LALLN*RRLCRCS*
YYIWDQELMRP*SHYWSCCSLTSVVPRR*TPCLEGQTDYLSRRRGRYH*KVP*VGH*ED*
MFE*PDLS*SWTRFDGLCQNLVQSVV*VYHFQLLCSD*WLLNSVL*NEILLPVIIFSVLL
AFCLLFCSFLFLLLLASLYLFYLYFFFCF*PFYLRTFSFLHQKLSFYPFPS*YLFDQHFH
LLIYFSLLVDLLVVSLRTFCNR*FDLLYSS*Q*YIMFLIFTILIKVENGTILLFVSFH*S
TVIYTVNCSRA*FRRLFILSSPHSFFDSTQAHGG**CPPIL**NIFMQ*RERNSCI*PIK
NSL*Q*YVDKDIKV*GWL*IKTVGKTKTTYARPYSQGAKYYDQ*RLER*PKD*SHP*FGF
LGHCADHPHRRRRFPFPQFPD*MMEYLRDIPAL*WCKKKQRRRYFLLSSFSHCTCLRKPF
GGPSCLGCYYRHGEKKRCSTRRCDEVDFEVNLHREHVGR*AH*SADQRCLDNQSARSCCS
FLPRSFYYYQNWLA*T*RFCYSH*PLYL*LCHIPGYRCYRHRCLK*GLGIQLVKFQSAVR
ETKSVRHDEDI*GRLPCHTLERCTFYPLPGSY*EHHHLHMLEQIGPNPASCHKICQYGSR
SRAV*QKTLGLCLIHCCRNSEKKRKRVSKMCMIH*KEVKIRFLFIRWYHYIV*RIVLVLL
EVEN*RYYI*GNIKD*WNIGAKY***IKLVSTENRRRLIAAIRFVIICNPSFNNKGKKSL
LCTL*YNRNILFSIDAFLLNPVWFIACASHSSLFRSQFLKEPMILVGLRLLDLSYRHRGR
YSSICWNWSWSL*VHCLGRSETAVIDVLVSFMSSHHDSTANGVYN*QKYCGPNKPKILGT
*SSITILMVKRLYCLSVTSCVQTSG*GYEEKRDPAHCSCQSGGTSIVSD*TGNNRN*RD*
QKEKPD*KHCPAHS*KIIVGISVV*KS*GHEGGTAKVVPW*KRLSCHLRRAVDCYSAAFP
AAPVIIVPSGYGGRRVKARSGCLKPIKILQHSCGPATC*YQKKSQQCSP**KEKVNKVHK
LFVGH*LLETEIYEVILNAYRDRNTSNCLWLFENPRKVANFG*ELQIGSLT*YKLLGYLA
NVFISKAGDNSGDRKQGIVISSFHPFIPLLRPCK*YKLRVVMQDLMIYRVLLHCNPLP*K
TLGSNFVLEVPSLSSSQIRLVRLCGCALQGVSLP*FRGVFVSD*FSQKFNV*KGDSFGIC
DILLDQLVMTKALKIMLGAKFS*LHT*F*I*FAFFSFLPWLSVDADS*EF*KFMYTNTAL
NASPLKQTTRVL*TR*WDLRKISSISVRVINTKRSRKP*LLKKISTWQRSTVKNKQTVGC
YRT*RNVCGSI*RL*STTKMV*LL*IPRRKGNIISIIMKQGFFCKFIQIIWPITATLISC
NT*KWMICLIFPIWCYLCHRLSNGLKLFMRLSQNRELGIFNSIY*HVI*LS*SP*TTPFR
PPLQWKVQTF*L*QTSILKSFNTWLIICYKNYKTGVKMQNKIPMTQIRNCKEILWMKTRC
KLPGTEVVSEPMDLYNLQQKLWTFLNK*LRLHLPKYSPTL*SSTML*WNWLLSRKYLLKK
MSKRKS*ILFRLISWKIQPINSIYNYATL*TPFPPPFH*I*RKSV*PRL*LKV*TSLAPE
PSSHCKILFCKPSPLPICLMKKMYRVRLIFR*LELISLNLPFYV*TIILQMHLGNSLGY*
PKFLQRLELY*QTIEIKSCF*KIRH*TNN*VT*FFNFVMS**IPPIMN*EGTL*KNQLKS
HKKPPGERIL*TY**KTLTFF*IMLSLSHQNSAGYKKRLLIN*RGTISIIKPRKDYFSYR
GWNRSQMRMTVLLLRLPQ*RSICHQNTLFIATIGSEITYIYISRR*FVAHMLQEPLVKRN
LIQVNTCRKHTLPLKQSRDGAQQSFFRNRVAW*RDNDATQPLV*NLIFLAKLGIIFVTNY
*F*YISRVHFLRRYSKGSEHLHFEAYRTLQYCLFKYAVYISSSSSLFFPSSKSH*INTGK
PNQKNYTMSDQNNRSRNEYHSNRKNEPSYELQNAHSGLFHSSNEELTNRNQRYTNQNASM
GSFTPVQSLQFPEQSQQTNMLYNGDDGNNNTINDNERDIYGGFVNHHRQRPPPATAEYND
VFNTNSQQLPSEHQYNNVPSYPLPSINVIQTTPELIHNGSQTMATPIERPFFNENDYYYN
NRNSRTSPSIASSSDGYADQEARPILEQPNNNMNSGNIPQYHDQPFGYNNGYHGLQAKDY
YDDPEGGYIDQRGDDYQINSYLGRNGEMVDPYDYENSLRHMTPMERREYLHDDSRPVNDG
KEELDSVKSGYSHRDLGEYDKDDFSRDDEYDDLNTIDKLQFQANGVPASSSVSSIGSKES
DIIVSNDNLTANRALKRSGTEIRKFKLWNGNFVFDSPISKTLLDQYATTTENANTLPNEF
KFMRYQAVTCEPNQLAEKNFTVRQLKYLTPRETELMLVVTMYNEDHILLGRTLKGIMDNV
KYMVKKKNSSTWGPDAWKKIVVCIISDGRSKINERSLALLSSLGCYQDGFAKDEINEKKV
AMHVYEHTTMINITNISESEVSLECNQGTVPIQLLFCLKEQNQKKINSHRWAFEGFAELL
RPNIVTLLDAGTMPGKDSIYQLWREFRNPNVGGACGEIRTDLGKRFVKLLNPLVASQNFE
YKMSNILDKTTESNFGFITVLPGAFSAYRFEAVRGQPLQKYFYGEIMENEGFHFFSSNMY
LAEDRILCFEVVTKKNCNWILKYCRSSYASTDVPERVPEFILQRRRWLNGSFFASVYSFC
HFYRVWSSGHNIGRKLLLTVEFFYLFFNTLISWFSLSSFFLVFRILTVSIALAYHSAFNV
LSVIFLWLYGICTLSTFILSLGNKPKSTEKFYVLTCVIFAVMMIYMIFCSIFMSVKSFQN
ILKNDTISFEGLITTEAFRDIVISLGSTYCLYLISSIIYLQPWHMLTSFIQYILLSPSYI
NVLNIYAFCNVHDLSWGTKGAMANPLGKINTTEDGTFKMEVLVSSSEIQANYDKYLKVLN
DFDPKSESRPTEPSYDEKKTGYYANVRSLVIIFWVITNFIIVAVVLETGGIADYIAMKSI
STDDTLETAKKAEIPLMTSKASIYFNVILWLVALSALIRFIGCSIYMIVRFFKKVTFR*V
D*LPLCYK*VYVFTII**LISCKYGIFQRNI*YYF*RVPLP*NQKKMASERKT*IIDKTE
THNTNSSALNTQSSKNDMCTSISINFQKSGSFANS*SII*YTVIWHFILSLLKLSAGPLK
LWRFLRRISKKRKRTKEKKLQIYIQNRFHVYCLGVR*RSGSLEEI*MYPTNY*KSFVMCR
FLIFKGKQPIRLSHLLTRPAHSIINQSFDSRLRLDRRRPMNGDGFGVAYYPLDTELSEDG
PCLFKAITPAWNNQNLSTLAEKTKSDLVFAHVRASTYGVLSETNCHPFTYHSLCFMHNGG
ISNFKGIKRKLLNHIKDEYLNFIQGSTDSECAFALFLDTLDKLGYDPKKQDGDFGNVALR
KAMLRTIDYIRDWTKEANKDEAHVEPSLLNFAVTDGSTVVVSRYITSKTDEAASLHFSCG
SSFVETSPGEYRVERLDRNQDVIMVASEPLTFERGDWTAVPTNSILTIKKQTILLHPIID
EYYQEDPLYLRSSTLAESKGLMGSIPLAKAVEKNVPPLEREGRTRPPTAVAHIA*AHALE
DCTIVTTRYTYKQIRSIDT*QQPQHHNFISIWLVSPYGV*SSK*EGTRLVSMTTFRVINV
HLNPFIQLISGQSLPEAEIYKYPVGPTRGLKKKNT*KTAMRYFLYRLVRVFLTTMTGILA
GEKKKMRSRTSVAVAETRQFLNSFVCVLYLLSLLYICC*VSFTN*CSLLSSFIRCVCCA*
FSFR*LLYIV*FVLECNKDFCFILFCYLETVYLV*LKRVSLR*SDYKKTKLLLLCFFLFF
LF*IKNFPLRSNLSI*LHIKHFFFYF*LTHFWKNIYFFDLLSQIPSAL*LKYEVLFCYCY
YSSHRCHRCHC*EG*T*FHYHFNFVIGR*FNYYHLYSYHSQVW*VQQDFQVQDPKPHWYS
QVR*VQQDLQV*DPKPYRYSQVW*VQQDFQVQDSKPYRYSQVR*VQQDLQIQDSKPHWYS
QVR*VQQDLQV*DPKPYRYSQVW*VQQNQT*HYHLWSW*KGP*EQCRPWSI*FQLHKIVW
CYRW*CCRSRCLITIIISFELDLRNKGRPNFLRFYVFYPPYPLHPEVVNSFYYTISTTMC
LRVLVQK*NLL*LCSFSLFFIQKMEKGNWDLRFKEVLFPISTS*MNVCVSLTCKDRERSS
NF*SWFPFLFYSNRMWKENRAELDNCVCECLAFSFSLFLRYTKSVLFSSIFFSLMTLCVY
YPLINYQKKNKLRF*FLIYQNFFFSHITIYLYVTLFKFVSFLSTVQNLGYLVCTLLSPLT
IRHLLLAYIGLNKKGIFV*NDICIQSKV*S*IFY*QVTLSSSS*LNRPN*FNSNQFQCTE
EFASRTI*VILVHFSSKRKRDYITINEFSSFLFSSRVDGEGLGRKRFRYEFSD*SYSAQE
ATCKVRKTRIH*RNKEQDQL*ASFYTHIFRLYFVKTETFPT*LKLHRYFIERSFYFVFCS
LDIPSLLHNKLINMDNGTDSSTSKFVPEYRRTNFKNKGRFSADELRRRRDTQQVELRKAK
RDEALAKRRNFIPPTDGADSDEEDESSVSADQQFYSQLQQELPQMTQQLNSDDMQEQLSA
TVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTK
VVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSN
KPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDG
PQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALR
LLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAI
SNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARG
LNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIETYFGEEEDAVDETMAPQNAGN
TFGFGSNVNQQFNFN*LNVKKKIN*ISLFR*IFII*SIIFKFFF*CI*EILIF*FAQ*YF
HVLVRTVFSFSGVFPFYRS*LVL*LLYMYCWVF*SILRKTPKIRKKLERHKKKVRISTAE
RSNRRIFIFEETS*KDLIQHIDNSIGIFIFLF*VHE*M*LLQKMGITVSRRKIDLIQINR
DSTN*MSRRRV*IYQKTVIQLFQVIQRQL*QMMHLITMRALHRVPKILILIVIEAMIP*N
KTTTIKGRPDITLSTMDQGSISDIHSFEKESLNQHLQKTKPKSTYRTKIM*KLMKII*RT
NSSLRRKLKRLVYSDLVY*DKEMF*ILGIQNQKNHTLK*NPSSITRAPHKENLVQHFGNN
*ENPYRCRI*IALIVIVHPHYREKKKYSQTKCFKKREN*LSLNGIDFSFMTKKWWKKS*K
V*ENTKGKECLHEELMFLALSRTILSKYRRQQNRMFLWSKNPYQISLL*ITLMMLPTIRR
KKKRTTIY*SSKRNEIHYKYYSLRSKCILRNLTR**SY*KTIPIQRKKGK**LMTTQRLN
KWSTKDGGKT***STKNQEIL*KSIGNISYGQFVF*YCYIAIYMCIIGFKPYKG*YMKKC
VQLWQ*LFSSVLKRVLSRSEN*AKKEKRALKNRWWTDRIFHKHRWYKGIMSP*IEKMMKE
*MQFRIATLAKCSRLTR*RMYGKEKIRNG*KGLKVIEVDTSIHD*ENHHISI*QTTSEWK
RR*YVKISFGHVMVHRLFLCIMILASDNI*CRRKVIRTS*TETSFYHLQGFLETSLLFHV
Q*TRFTRFITRIPTG*LVTESWLEEKTSLYNYTL*WTGSVSSAMTR*TK*MENTKLYTV*
KSMLSLVYTLAHAVTKWRYTTRADEMPCG*TRVPKKQAREDKALYLALKSNQWEGKLSQE
DLYCVAVMRMKCFR*TAVIND*RD*TTPAQLQVGLYKSLQAITGVTCTLSDATVTRLVFT
IGETCSTSLTYCAYRFGSTTTLQS*RHI*IRLTD*VWGRRREQY*TGVETLWNLEVFPHT
IVLKTH*SRLSRQSQSGALTLILLFLPR**RIVLGIPNCSPYLMGAQFHYAGSAAKNGKP
VFVYHPASFLR*TRTSKKLNCIPQTPPLLFTSCLMPSKNFFRIEKNPQKKRKKFLFLYSA
TIGKNFPVKH*QSLPSPLLSFICFIEAIKHHILHTGACIVSEASFVLYCT*YFIEKLTER
IYNS*YL*IRPIVISQSQTMTTQESIKPLVDRILSNPLQFNAAMISNKSNNNDTSAAPEN
SSYIVIGKQHNNNSNSTAIAATAESKQIKENNLIDRPNGKKTNTVPKSMAEALLLYTSKN
DKDAADATGAKKSAELSTELSTEPPSSSSEDDKVGKEEEEEGEIFHEARDYVEPRKASLK
ERDNADKGDGEDIGEDIGEDIGEDIGEDIGEDIGENLGSPLATIDDSSNENEKEKRKELS
TSISSDDEIEDDEDEDDMDYDSSAMEKELPEEEENDSSSKISEGEKKSLYQDLMENSTVE
VNRYEPVNNTKENGNRNPKGEEEEEEEEELKHKSRSITPPVTISNLSNFYQFNENINDRG
SLNSTRIVKNWGDKFTNLKPRGLLNHGVTCYTNAAVQAMLHIPSIQHYLFDILMGKYDST
ISKNSVSYTLAETSKKMWLPVSKNPRKNVSASYINPKHLISRLDDINCMMSEWQQEDSHE
YFMSLMSRLQEDSVPKGHKLIESIIYDIFGGLLKQIVTCKSCGSISKTEQPFYDLSLHLK
GKKKLDPNSDLSSDSINGTSATTSTTTSNAATKPSLSSSSSVNLNNGSPFAAASDLSSAN
RRFSIEKSIKDFFNPELIKVDKEQKGYVCEKCHKTTNAVKHSSILRAPETLLVHLKKFRF
NGTSSSKMKQAVSYPMFLDLTEYCESKELPVKYQLLSVVVHEGRSLSSGHYIAHCKQPDG
SWATYDDEYINIISERDVLKEPNAYYLLYTRLTPKSVPLPLAKSAMATGNVTSKSKQEQA
VNEPNNRPLKINSKKNNRKKWKKNKKRKFTK*KNSIFLDFPLFIGIFISISFLLYQINIY
I*ISGLY*LIKQLSVYRVGEAFTQNSFSTTELC*HNGRKRI*NLYTYLQNRSVERRRKVC
*KFLEIDGTFLSFHYLQIKVQP*YPYFLQRQLLI*QYLPSPINYAFHHSFLSWLFRKRAS
AITLLKHGLVPWQVHCLTLSPHSVVHVPCPF*ELLAANIRLVEISFQT*MFYQVLL*LIL
EPVHLADSLLILH*IPYKSQWLLYPWSPMRAPREVMVPLGLLLLLALLSRFLLPVTLWRL
IVPLWYSRVRKYNKQK*IQKVTLSI*MFTLFFLLMSCRFTALSKASLL*NFRKGNCRLGK
TINVTRFIIIN*WRDILTNFSINYYHTKLLHFSDKIVDYEQEVNLFRLL*NGKI*N*FNR
SKYDIVF*HILK*DKKRLYTNAWKRNKSGDAYLLIILLFLFLF*ACNMCFTLIHLCVMMV
FSSNHFER*SIFNQVAHINATDPRIFHDFFDISSACGRQINHTSNNMLSLFW**VQQSLW
PDINIIRI*YIIGRAFGFFLFC*VRFIVGRWIRSSCNQAT*GVAITSGTK*FE*IVP*FR
NFPWKFLQYHTCKNDCRRPNIYGTWVILRKYTDFRC*IWITSNNSTCFHKIF*EWI*KYH
SSTKID*FYNTFFVYNTII*L*ISMS*ADTMQILYTSKYLFEATTNLFIGHFITHYNSK*
IVFTIFHNLENSIIFIHDFNCFNDIGMIQSCTNTVF*CNFLDIISFGFIFKFSSKLLHCK
YFVI*NSLS*FDRTSCSSA*IGTGFDVPF*ERNS*TAVTMRINSISISVITSGI*VIPCG
KMRR*MRV*RNGNSARKR*SVRDHVVTIRGKVTVRTFFEEPL*ITDGRML*PWNTLTWR*
VVMYR*GGTVKVISIGTSWLS*CRIYAALSCADRLRDRRRTIGNIGILNVWRRTIGIGRK
RHACRVRI*RFF*VFGKEKIPKL*RE*T*TGYRS*LSGICIITIHRCFLEFLFGDNKTWF
HAIYFWGGYNI*IDCRNIIGHTACICFEPRRRQRGAVAIRAIVIFVRIWHGVRYT***RR
NGPS*SM*RGR*STCDSVLCSKRTTM*GKSCSTLIVY*GSKSISTLCTCAVE*CSVSKVC
IKEAGGKLIPIVERGTGC***IFL*VYLSNSCDTARNWHVSPITITTAAITHATNMTTTL
IPRVKVKRL*LGRRGQRISRSSR**VRSFIFSFFL*QSS**RHNVS*SFPFLFEWV*AVG
KSEIGKS*TKVLMSSGTSQLVCMGLKMTQRNENSCLLFFQ*QKQDF*SLPIVATRYATD*
SVLTLYN*RRPIF*DKL*G*ELWDASLITKKFRNR*SVRLRMRCFAQVMNYIYLCCIF**
HSYFIVQNARLFRLLLVKHLLVFLVQLFVHVT*LLVGMS*CFYVGLKFCNFLIFSGIAV*
R*SGVDFIVNHFYIA*HLTDM*KYRFLRFDLLQIGIKVVKW*CEVRICLCFWFSYLIPNI
V*MAFVFTIKDNSL*VWYLHKIVTIIITRLFAFGFSFKK*ISTFESVRVG*EIGHFSN*I
L*CS*SLDSSNDLF*VNFRNRNFPLRITDQ**CTIH*YF*A*HI*I*DILTDKLAHCI*C
IQIFIFAAS**VTLH*GKNPTFLNCVYSGGL*QINDSITL*FIK*IQ*KTTFRSTNIACS
VSRIQYNGFDRIRSCKCRKQYWGLTNTNVIFVCLLLLFAAY*TQIIASNGSILRYCEEFR
IST**KFSLTRRNLEICHG*SMIVKDT*RLRIIIGR*YQVNSLPYNNSRIVTRSNNILAV
*NGLNLGDTLVMSHRLHVQ*NP*I*LPYVQFTRFGGAK*KVRKIEVW*IMIDTLNSIILH
TIIFNYFQTF*DFR*W*ALFNRFSFERT*QIVDID*CFLCLSNKKVFISYLNTAIS*LSG
ALPQIYLFK*VYRSYCS*GICCKNNLLIHFIVP*KILFYEY*TINLNAYALVRAVLRISI
FGMGIDLKFSFSGM*KKILVRAYSFSTFAI*CRMALSNHHSYYR*IAR*HFNYRHILLNG
CFQIPSPPRSSPISTSPLKNPLCDAVYSLL*LCSTIQWLLMSFPRSSARKCIAYML*AWQ
LL**FTRYLTVLIYQSLQLSILCPRFFSVYRRDRMCLKNLEEEREGCISNRTLRENSLQK
QLAALKGFFGEEQKQRTKIFRKKKKCL*ILLGRLS*TGLTRFLTIKQSKRWHLMC*RLVP
LNIGREGHQIHGKESCTVKFTWLLALPLKEWEHPWLIKWQS*VHN*SS*LGK*MNGLLNG
AKNYVKRQRTS*FL*KNVI*AICGRFVSLPQVG*TIRHLED*MALLSCPVIWNHGVSRKY
LCHRGDHLRMGWNCKLLQTM*QFSIF*TYYSLVSRLNRLIEM*E*FLPPAGYKLLVILI*
KIRCGKMPNTKAP*SFSQAASYNWD*V*WNCKEDLPKT*KTKRRMALKEQEKMLPLLWFN
LEL*DQIAYAASLVMVRWYC**YFTVFCCTPYCGCLPRVVVVVIKVSCTL**HRNWRK*T
*KTRRLSISQTVQL*NLLVKNLMTRNYRRNYLIIRKEIFYNWKRKSRQREMPIRPGIKIL
KRRVRTRVEKMIRNENVNICVDFFFSYL*YRYM*LFIYFFCLLDIKVLHTLTSFSSCRFS
SLV*LACCDDYLRQFYYLCFLIAREFCLFVPFLWV*Y*ELPSPAVSFLSEEYYLYYYYGV
VAVFVLEYFYLHWCWLLQSLIHQLEYDLLIFG*GILVRR*RTSPPVQRLPGHLLG*QLNI
RYSP*THIFVRVHLFPLETRNRSLLPAIFSELPDHLLGHFWCLPIELDTSLI*YKERYLQ
YWKSASVQVAIFL*HWQN*HVRLLRNILKKYLFGDNITVLNDRNLPVLQCPIN*FYIVFC
PYLVKNWQMKVNLFYHYHCQALGGYSQFRSG*LS**NNYQKPLEHSLLGTNW*YMILEVT
FYLLHHHQLSHI**TSSDLLVYYIVFNKYFGVCFVGATCLVFPIQLNILDIVLCNRPEKK
K*MFQRFGIQ*WVKDRAFVRWWIGRTCLVRVLFKLTLNSKIGKATRN*KVKKKKKNKKKR
KKKEKHDCQYSQELR*REKGRYIKK*KGR*FK*ALLSCLHRSLLQLLISSYSS*PVT*LI
*PRSVMKILSGRRNVVFFLL*SR**PFIIFFLGRKTGLSS*RFSHTQVKAKTEANTQDNF
PVYSHCSFSIDADLVLREGGRNEKIQGRERPGRRGTKPLLHTLIF*LLCFSGLVWHINKI
LLLSIIWSSLTDVESLALEK*DKTSD*GI*N*PL*NEIRTLV*HFLVAFSIYHHLHLDLC
LV*GDFG*IFFEGKMS*K*KQ*RNKTIKRKTQPSSKVLLFFFTCCADVSSRTWQEENRRI
VAATPDKQSSGKCKIVHERLRSQCLRRPARMIQKQTIKKIKIRGLAAGIRCIALS*MTSR
**ILRRMMLLICLRACHRAGSNY*GSTYLENPSKRMDIVILKATQKRSTSVPHNNIYVVF
TRSSYISTNIIAGEPTTLHA*TSTGLR*YFWPPVNSLVFFS*FHFFSCSFGII*FLMIK*
DCFLFP*HPYLSCIIFLL*SLFFL*KKHFLFLR*GAASLSPMGSGKFSKSMQLFEIQQHF
SYILSNF*FVDIVRLVFEHCFDN*K*NSKQTTKMVALISKKRKLVADGVFYAELNEFFTR
ELAEEGYSGVEVRVTPTKTEVIIRATRTQDVLGENGRRINELTLLVQKRFKYAPGTIVLY
AERVQDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARA
KAMKFADGFLIHSGQPVNDFIDTATRHVLMRQGVLGIKVKIMRDPAKSRTGPKALPDAVT
IIEPKEEEPILAPSVKDYRPAEETEAQAEPVEA*I*LLNT*INYKYNNFFYSSALNCCGF
LHIAVFSQEGAR*SSALKLVVIYRITILYNQKKSFVQHNCEYRLRSE*QFIFLSLQDDFS
DMNEFAIVFTTCIRRL*HP*WAYLPTVPMALFFALLNVLHKQVFVS*HSLFSEYI*HVCK
DDL*FRFLSLP*IQHVFSKTRHSLSKSERYISPLVSNLIFGHLLHLFEVVLLLREQFSY*
KSDTEI*LS*RRGLPITSTKV*PFSSTI*FYMTEHIRKVLVLQFLFLLTLACNVR*NLVT
LQ*YLSCKTHH*FYN*LHIFPFSKEIISSVMLIVPVAATI*YVAVVVYRFLWLLNPY*LQ
EPLQKNQKQSLTY*RSCLHLHPPCFFLPLVYFL*CFRIVILLNY*DLLALHESNVYLQKK
VEP*K*HRPEIFLPCGSSFSLIKKIG*GEVL*LAMRLLMAYVKMPSRLDS*LLFKIPSTV
KA*LPRPQKINRIS*VLFKQQAGEKTERVSYNLVFIYLGELKYFLYTQRTKFSFFFIAEW
YHCFLCLLKGLVVLHYWQ*RCFYDF***CYSARADFA*LVNIILID*SHRHIISLKNPCE
LF*TVFLSS*EMSLSKPRPSRIEFEDKVEKPP*VDEPNDEYVNEEP*ENLFSWSMKLLRI
F*KEPFIAVTFLGGGTGGGFPLALKLNSLLNGLLAEAVSVFRCCDPES*A*SDASFAWAV
VGNPVLRPIS*QKESFSLKCLFAFLFLTSMNQTTSTHIRIPPTLPTTLPTMVPVFVFEVP
WFLLLSKLPSSQC**KDMSAVIVEDGAENEVTSLFATAMVVGNPVTNVVEESVISYVWV*
K**IVFESSELEMATVLKT*LDVGMGDVEIVLVLGV*VVGGILLLVVDCKD*KVYVLE*A
LVVSSDDDDDEGRFEGTLLLDELTELDVGTEIVLMETVEDEADGLSFDDLLMVEKSFVDE
SDEL*NDVEVFRLELGNVVSLFDIVEGEEIVENQLEESSEVVLI*NEVADMEDKYV*LGD
ITVGVDGEKIEDLLSNENNLVSEYDEDSDNDNEDDTSNEDGDDNDDHDDDSDVADDDNVG
VVDVNDDHSDVIDDDDDIGDVDEKMDMDGVIIEYEEVAGSYWELYVSCSLDELLSVDDTK
VLVEDTSMDVCKVSSYVKLVE*YVGVAVLDTGGNEVRLPCWGTKVEVDAKTTSVDREFRL
LLGSLNDRDIVSDSPRVVLPMVLLEFIRWPK*LLYPAFLLDFLQISTDGD*NTKCVS*AK
VCQQPVQKTDQ*CFGTW*VV*DFMSVRRLSVYY*YANRS*RSCLPHFFLLFFFFFRAFSP
CLDKQ*WKK*K*QQLVIQCIYKT*MIE*FTSEIIALYTWHLQSVHAD*SNFTFLPCDGTI
AAEPL*AVAKATLLLVRLLESTGGRLLALDRLYSGLLPLSCPARSYPLLLEISNDEELFL
DTFSTFLRTCLLLLSSPYSIRNGLPAIFLQLLSFNALVDPSSFLKSINANPLHLPLSSNV
AMRIFTISPQCWKCFLNRSSVTSNDKLPTNRILDGGFLDMATKSSLSGLPE*FSESLISI
FLPFK*DSDNSKTAFICSTFLKNM*QNPLFFMALEFLAATRGMDNLVMSCSVTLLFSSSL
SFVLAIKNLTKSSFVVSKDKLPIQTPYLFSSFFFFFTTSPDSSPVGVLIVDSSPWASFSE
APDFFFSASSLYSSIDLGSILYFAFNSSRVTLPLLKRRFCFFDRGMELFRSISISSSAFL
FFVGSSKAFLTCSSLSFFVTASSFDSSVSDILSQIIESCWV*VMFCGEKDFSLLYG*IYH
LCSSQFFLSD*KISGFCISTGNVTPTEFSEQRRTSEIQRQACAFGKSAILHQSLHTTWYC
Y*YIIRFYIVRYGEYVIYLGILLIVFTSKAGPTF*RTLHS*QGSFGHLYLVFLSCP*VSK
V**LS*LRFFLRQR*ERPVSSRKFESQSQPCRLVSQKSL*HGL*LSLQVLFLPVFQI*RI
YLMVPYFDLLKLQRLHLYWCPYRRLYLRPLPLLPFQDLRPIVHII*TQKIASYPNRP*HI
LHS*LD*LWGDSLHTA*LLFPRLHQHYSQLSL*YRLSHPHSCPFCSPAGFHPRYRAIQPL
LGKISTFLRFVYLS*SLS*S*TFLIFLHVFQLLVR*EGHSLKQLIRHFQVPAC*SHFRVA
LLRLPR**SCFPLPRRCSPCSLCLAAIGHQQ*T*NKTCC*GYQTLLAALFRRRHWGPSPS
AKYLSSRRTCLSE*LLRVLWAI*T*IEVSSIAF*KHFPFNIIL*CLES*IPSRERKLGNT
EDRRTEVVSILHKNRPPFIFLNHKRGGE*WM*NLNHVNARAPAPKVPIGPLRFAAPDICG
KGQPRSISPMPLL**YVF*LLFFIFIASFYFVRCKPYTK*GFHLVFTFAQK*RRYVIVIE
SIDIFGAC*QIHGDKVS*NIAYR*SVCYSSVLICFSFL*FLAL*LMTSKPSTRNDYLPRE
THNGEYTGDSPEWQLQINITNKIGGINGDIWLSRDGRSVKWCIEDQCLRQFTYNQKIIKA
GYIDFEKTPDCFVVVLSDIAHVYMLKNGGSTTVCFPFQIGNAFWYANGVILERETSASFM
DGGYDLKPIEFDLKHKYITLTDPMAPFGLISITNTFKGGINSASGNKTDILQDFQLVLFP
SDKDKCIAVFLDRNSKVLRFYYSRILSSDQSRKGELTISSTKKTGLDAAGNSQKSGGISK
DLRKFSHLTRRSTSINSNSHDFNAAERVLSGNVGNASGRTDIFALPSSCSRRSLSATLDR
MGNNIAPTNRAAPSGFFDSSSANTATHSNITPVSQPMQQQQQEYLNQTATSSKDIVLTEI
SSLKLPDDIIFTSRRLSSILSKLKFLSLRFERREGLLIFHEPTHFCKIWLIDLLPDVLDS
IPFKIYGNSPQNMIRLENLKLKEPSRIQAMYIHELLESCLILVSEGQNKEEYKACLYDPF
VKITSPSKNISEELTKQNSLPSLQKLFPYPETSFTKLCFEAVKYITSPAFNISFIFLWQS
AYSILLSRANDDVVGGLKMEHDAFSLVLSLLILPIPSSSAQEYQEYKEIYERDLFQHLKQ
DSEITSSVLPRIVIGLHLIREEYSLNVLCRNEHALLGQFLRFATAAMGWPDLWQSYYVPK
MDSESKTFLHPREQNSTFFHPLDEPPSITKSLYSITENSSIPLCPFISFSRLVATDTQVE
LRITPRSFKILGLYELVHSPNFLPDYVLGILSSFKVDKDELQTYPLGILVPLQNILKILE
DKLSEVRDNLELLDRADLQRCSAIINSIRSDSKEVLKRGQRDSYMLCKVPLAKNRSSLSK
KPSDIYSILSEIVKSASQVPLDGSAMRMSNIQDDEDIDEGRSLKLNAGLIFSEDKRFTHV
VSLLAYYRPTKTQFFTTKTEYAQILAQKKYFAKIMALRTCTNGVGWGAVAYATEKPISTQ
KWVIQPLNLISVFPDDTKITVKAPEDIAHDIVEWGQFHAGVSSGLRISKKATGITGSWIA
FNKPKELDAYHGGFLLGLGLNGHLKNLEEWHIYNYLSPRNTHISIGLLLGMSSSMKGSMD
SKLIKVISVHLVAFLPSGSSDLNIDLKLQTAGIIGMGMLYLNSRHKRMSDSIFAQLVSLL
NVNDEMVADEEYRLAAGISLGLINLGAGQTKLRKWDSSLLGLGDDLPEDVYDSSDVEQNV
MYEDLTTKLLEIVTSTYDVENDWIPENSQIGAVIAIMFLFLKSNNFGISNMLKVDLKEIL
KANINTRPELLMYREWASNMILWEFIGDDLSFIMKDVDIGVKFSELNTDLLPIYYTMAGR
ILAMGIRFASTGNLKIRNILLSLVDKFLPLYQYPGKQNLDFRLTISVINVLTNVIVVSLS
MVMCASGDLEVLRRVKYLHEVASGPYSDLFQEIPSSKSDVSGVTQVTSNTNTPGNSDRER
VDETAASLDDERSSNGSDISDPTAYLEDKKDIDDHYGKFISTNLALGFLFLGSGQYALNT
STLESIAFLSMSVLPTYTTPHPLQELKHFWSMAVEPRCLVIKDISTGDAVNNVPIELVVE
EDVEKEEVIREISTPCLLPDFSKIKSIRVKMHGYFPLEVNFTKDYSASDFFSGGTIIYIQ
RKSESVFENKASFRNVEDIHVALKRKAAESKNYSRLNLKNEQGNTTSSQLVESLGIQDLT
MVELDTLLSAGNNTALTDSESYNLGLLCSDKNSGDILDCQLELWYKSFGPHDE*CKTQEY
LFGYLRLALKGSKTGVRCNLCV*LGL*KGYMTWLKFFRRTSLI*SLHLTSPI*KMYSV*F
YIPPKEELNQSVQIILYTAK*MLTLHMIAFILNHSFQLCLISVPS*PYHQP*HRT*IQWE
LQNKVQQCYPIQSHPFLHP*PKASLPIFYLHSHILPGSRYVVPSVCRSLNLSQILDQNST
*LNQHLLHQQESC*KIRTSNYPTKQLFHLERKD*GSYAGNKVPRRINHLGNGGEPYKPSQ
LESGNDGNHREPNK*RQRKVPYHEAQSTKTH*RSSLKKVDLKDVYFWTHLV*TLEQIDRP
RF*S*EEAVQCLRNPLIVFYLPWRILYAFPHQKSNLD*MHS*TSRGGSECQGIL*WNMSF
P*LVRFRQFQS*LYQLVKSFHHLEKL*RLRLVLLDVCLVLCYDRKIRINLHNVSNQDLPS
RPS*LQKGKNITCNPMV*PKWVT*ENLLGPIIETSHSAVK*NSRKRANYC*IF*FFLSFS
LFCPL*HPPLYYHSLTLVKWFLEQW*N*LKQPISWRPVFFRYLRQQLWHDPQSLQNCVVA
ERKDAWKTFYSIAPQFYFLIAFL*KTLQQASSP*GASSLAPRRS*LA*LTCWLCFSFFFK
K*RPRRI*AIC*QLAEESLKRYVPLGVSFVSKLFYIIGEEQIFHMLVPALDVP*PRDLKK
HQKGAGYPACDM*LHSVAYTEAQLVVYVPSL*EISNA*RVICDKRECDRHYVSLNSYGPG
RFSHSKFMSTILSLFCNSSQ*TRSPGFNSPTPAGVPVKMISPGSRDIMVDMCCSILWSGC
NMRLVPPSCLNCPLTEHLTLKISCKFDL*DENFSRETIAEIGMKVSKPLLIVQGSPFFLA
SSWTFLAVRSNARATPLIES*TSSGFILVTLDKCLLTINANSIS**TFTPRGIKMGPGLV
PSSFKPLKVEFAGLVVLTNDEDNGVTILEVGFRKKNGCFGVELFSSLICAA*LRPMHIIF
LAAFK*L*LITFWQFPESLLDSFQNISI*EVLAETFFLIS*RTVTIS*KRTKKREAKEAI
*ENRRKRNGKRRNGPFKIGISSTA*YMLGLQQYNCTLFMSVVKRR*NYNGMLYEE*ML*E
NLR**SLYCC*STKGGLSN**TSEKKNPIKVYIKYRKKNLEVT*IQKKAGE*KGFPLKRN
FIVEYLQ*EKRTG*RVRKHQIEDYLRTPSLSRQLL*GRVDSTSCLLVSWVSEFAFITNGL
VTE*HELIIFCALFPTLLVVVLLLLIFAPEFSEYFLSRIIGLELTEG*PAFSLLTTLVSL
LKLSSWPSMSSLGFLPPLR*KFVSHINCFMFDNTDIALE*SLLEMLLSNNAIKDVDGGDD
DDGVETFTLNWEFEELEGIMPHSFPMT*VRSSYSDS*NCRSFSIFLMYSFFLFLNLDAAT
LFLSKNSFLFLSCSSFSSSVTLFEILLFSTSSFCAGAVVTAEFFLDMEFFLEALEVELVL
DILLFLFRVLLLNWSLFSI*VVKFSFSL*L*AECSMALNSAGLSILTAAFVEVFGEKLEL
LMLLLTVPSVVFVVGVDLNTGLAKTPVDGKFSRELNPGVSGVPFTVGCIILT*GWFSILP
FTVTLLLTFLLPVIVFLLIDGNTG*L*DCVRIPGVNPVLILDSLGVNPDLDKFNKKPGIC
ESFVGKPLPELLVVTFEFRGWRISEVPEGEELFGYRDPEVEETPIALGFELETETECEF*
LGFVVEFA*YKIEGERSRGGNLFDPPGVRIGGDIIVGLCWPGKKLGESFFTSL*LLLSVT
VEFPFSSGILFKL*VERWECCVIVEVELFRESSFGRDGWEIVPGSDKAFLEEAKLCSKGL
GSKSKVETVLGCLERSSLDIMIKQGLETGQVYLECRN*NEKNEIKIKIHELIKELIK**R
SVKR*ESNKWKTHLNNKRVFLDKKTQFTFTLNPFGSNFSELKTTPERWQCSTKLLCFWRT
N*SHVSVTKLGPFNWKNVQFVSKTITV*LNSFYSAQLIFVIFPFDSTFFPLRQS*QGYR*
RG*VRLGL*KFLEKRRHNAIEIEFWVLLLFRFMLLQYN*LSEHFVFIFFFFYYRFVYV*A
KYSPLYY*NNRIYQKKSQQHQK*QMDGSRIKDSYSLTIVYVLLVFILTLYICLNL*IFIT
TLGVM*SFSSNPKLAIFATINLLSQMST**HSDLIFLLRFLVKIFLKLHYGSM*SLSVFH
R*RTLCIHLV*IVNFLL*LNAFHG*IIMSFFQLGNTAQLRR*CDRRGDWRIILI**RFTT
SVS*IGIAAHRDNSERICRASCLEIRHFFLSITI*IKVIYIGTIFFRILFRDKNFSLRI*
GSASSRAIGTIL*IIVMGCLIS*TAALMVVFIVTSYNYGLRLYI*ILISGRKFV*YKFSV
*LVLTAQGVILGHG*FERFNLTVFLCSLIYSPLFNIRFFILPFIIIIFDNFNISFTPVLI
YIDCTIFFVLSAGVLCLFISSGICDK*IIGVTNSNGGVSYLLFRYKRLSNR*LGWVIRTL
IRFILSGNMDLCGFVLFNLS*ISWVTIRSIIATKKSRFCHLYSVDHTRILDIIFDSFVLR
RFN*L*IFVNHLVHLVDIYLYLRKPLLYLVLVQAHRFCCSISH*HSITITVNQITKLLMI
FVYYEV*IFSAIFIS*RV*NGLGSGHL*SPSLLVKKKNK*GFWKRKSIKLNDRRSATYIC
QRSAWIEYAL*LEIAGDADIIANILRILTVGLHPPSISWELMVMETTNLQYLHEKMNLWK
PLPTRAMIVRMQLL*IQRYQKAQQLETYKDRVMLTEPQDSRQKEPCHSFRCYYNEGFLHS
PVKNLSSYFYTTRGSSITLIQRGV*DFPYFTPFL*TWSSRFSVIKIHR**GYINTL**TP
NAINLH*TQKWSLE*TKMSPYINMNSALF*KKWKAIIFRAG*STILYFIEKMNLMFISP*
LITIKGKMRIRQFMD*IFVGTGQLV*LHLLAQIASTYLYSMIRWHPT*TNKLLKSLILTA
VPVPQDRWVISQYGPDTQMIKLVSYRKKEL*E*LPCTYKKLIRLMMALV*HLPIILKWAL
ISLKMCRGIVRYLLACACYYMNMNQERRNATPHGAARPHIC*MDRQDY*CKPICIYLCFF
LLLFSHNTAKKHINIQREILSYTINFSITLKYV*NVTSFPHKFSSIM*CSLYYFIPTVIM
LTIYSFSYYLVHLLVDSAYDCNQTYDYTTLSCYVVVHQTPCSTRKINTWDLIR*LGQRNL
EHGFPFWKYIQNHDNSSFVVWISFHNDDAGNNFYGL*IRHKSHVALHAHSFSSSLTCCAF
*KIWNVDRLHANELRQRYHDRYL*LLLQHLNPLHLLQFATPPVLHFQTLPVTPILSFEKS
FPLYHPVYPVLGSHNRKLFRLLRHPS*VLSL*DHHLKYFASPPLL*SLHYF*KLFGLFYF
QRFPFPLRNQCGMHFGHLFSQVHLPNSTSPS*EEHL*ALLTVHLIKLFLHFL*RIALHEE
RFEKLVCLEADWKEF*SALSHLLAS*RLLA*VHPLKVPPQMH*SFH*IGL*VSFS**YGM
KIEEKRI*LKL*IRRKKHDISKYG*QITKYLAKKFLFRVYAKSAICSSCCSSRLFCHSHR
PDHLNFLVPSLKHSLAREYVVYHRIRKTGNA*KLCYFISYSSEYTYIHTYIYIYFQLVKT
IYISL*FI*TLKNLNSFSKYVVFRHFRQLFLQ*IDLSFF*WHSYAYGQYSLYLLYHLVPP
ILLLWLGPKMDLNRYTRIRKIPIEVVLHQMFVYEYLHLNRMLPQRAHVPQFEKTVYLLSF
LQK*FYHASVE*RHTLFQVHRQRFEYHMSKLPT*FLGTSLKRPHV*RPL*KLSTSLISPQ
YVVGSADLQ*IQFRLVTSYVRFQQEHTFPVRAHLPEVLR*QPVGSHF*WNLNTQRLLEYL
QIGFQEDYPATAKCCTQLYLAQNLLTLL*THLIVLCSSPPDL*PLQKQRVKTFCLEKNFQ
LIL*RDPCLKWTSSKCF*CYFDVEIKSL*LYRLMGTF*M*SCTGSIVVHEHPFPAVNSAV
DSYLRLIKMFPYME*PVQNV*FLFLQISLLNLLGIFLNVIHRPYTECVHQYFQRMCARKD
LLDPTTLILVPTCSFPQDWLAPQQHERLA*NGN*RPLD*RLVRPSLSTYHSLKLYRPDHE
YRLYFLMDKRPKEPIPYP*TNINA**SQFQYAPLDILDHILDPIPKSPDQLLVCHCIFLQ
MLPSILPFRQKYHLLHRSHPLKFA*YSPKVDLLPHIQTLNLEGHLDLCQLVQNLGRSYLD
YLNHPPPHIQILNPRRKKALKQHRKHHYFLKVLALSVLLLRGS*RYLLLFYINLMYF*NC
HSNPSLPYFLPYQHVLQH*VLPHVPFYFSPSAHPKMLSS*IQQVILL*ELKAS*IRMH*L
VLLYHMSSWLSEVLDPWLLCRIRRPK*CSNDRFVIPKVKVIFQ*LLTILLC*RVAIDP**
FLTIVYRPSTLDHVQVA*YLKFLLFFRPFQNLSM*LCFDKFSIYFRGLAM*KGVSGIFP*
GLYC**FFLSWDPYRNHPIKLSVGFPF*RLIFVRKIWPIDRC*NPNHQLRKQK*RCYQ*G
*SKYPNHPFQYIPRFRSFLIAPSKINHPIVSRLRKRTR*LS*LVQ*LWTSEYKLLGELVV
VL*SIYQSYSILKWASASPSNIVSTL*RFASIPPLRHQPVRQHHHIVLKLH*PHLKNQCD
LGNQLSLLDARLQEAHRNLLVYAIP*NIKR*PMIPL*YHVVVRQAWHLRIEFCRQAFVI*
YHSKPKENLKVKFYRDQHEQQYIYFLYRKGHFADVCKSPIPL*AYLLIVLRKITEFGYFI
NYFDNLDDVQRLYFGCTYLSIFLALKFPFFKISFLVGKRKRKR*AENSTLQYIEYPVYQN
YIQTNTSLKDV**ARLPSILSKLQ*KTSKVFSTAKLCHYNMSQLSLRLPIQSKRSTRKSN
VCRR**RLKSCKKKIIFTKQTIK*LHYCCSLSFIIPSNAIAESNMSDNNIKSNNMIVEIN
IKEAT*LKVSKSEDQVSGFYE*STFYVKPKKVRTRKTKKCVITCLALALKLVNYSSPI*T
NAFWNAKPQ*QIANM*LSYRHIITVFYQMLSYIQRSYILTSKVKPRHLLRVILFFYLSIF
SLADI*HLNSA*RQD*SCQGRELCLVPIGRTSRKVTAAGPQSDWVTGNSATFSFARERRF
NLPSKG*YMSAKEADNSTIKWSKCILKSNP**RKTTIISKNGYVITIIPNGE*NQDQ*RK
ANLIFIVNEIS*SS*MHKQTHLATV*SAPKKGVYTKLNDAQ*KFSSQQ*NRDMQQQSIIC
MEDPFCFSDNML*KSSKQHSSLFVKLKKGFYFPRYLQIVQ*YSLRKET*RG*VG*LLFLF
NMLDFAYHLTDFF***TFLLTLVRCLIYFFYLVNVPKTRKTYCKGKTCRKHTQHKVTQYK
AGKASLFAQGKRRYDRKQSGFGGQTKPVFHKKAKTTKKVVLRLECVKCKTRAQLTLKRCK
HFELGGEKKQKGQALQF*ISLWVSLLYFLCFKI*YNYILLQYKTLR*FLQLMMR*YGSGA
LGRVSVG*PSFLFDEND*FPEKQLHSSLICSPATIFNIQRSFFV*IVEQGHINFYITRIR
VQILLYYRRTLILPHRYRSFFET*A*ISV*VHVCADPSVILCSFRNV**QHQSS*GCTYF
RTWLLYVPTTRPTASTTTTIRQRNESVSANS*TACCRI**QLHERARLSSIVTRAFTT*D
R*PWQRFYRRSSPELSSHTTTT**LRSFKSDDQYPTAVDGWSL*T***FPEHGSER*WEW
ECTITPIITGPIFYRVRVQSKFKWQFF**SVPPTANATEQWVIFKRVKECEKLPEVTTRT
GKCPSSATTFPSTATKFPATTATTSIPAAATTTTTTATYANTTTTTAATTAAAITISRSE
RL**WYHIKLYVL*KTTRFVD*RNAR*SSSCKVED*ELLPILC*IRH*KK*KKSGVRNRT
NFS*LVRRKEI*AIEFFG*KRVTIFKAA*NEIIVRRFPHCESHWKRGIW*SQTGSEERHR
KNICNENFIKIRNVQKGPISTRQG*KGCSGWK*FSMGGFAILLIPRCSILIFNHGIFARW
*FDDHANQVATIYRGCY*ILHG*VYFGHRNHS*IRIHSQRY*TR*YFDRY*RSYKII*FR
VVYGVP*NSRLKLL*KAFATR*GN*WYFQARYLQCKYNRYCK*KANNGCGFY*SNNVKQA
TNSDMEKITSFNGIFYRRYTRLYCS*DIFIPRLWARV*LVVTWSNYVRVSDWLASILFRN
STGNVQKNHEF*ANSTIS**YSYLL*SRRSNPSTINSCRPKTW*TWWCR*NKKSSIFSRC
*LEYNQTSRSTVYTKVELHHRY*VLPNR*VGECSRFPSYGTSCQTKGTDDKARWKCASQG
RFTFYWLHLLQI*LFDKKKCVVGTR*GHSSLFKYLSMDVERTL*INNCTFFGKKITKIDI
SFIICLLEVFERPPFRRQCT**PTGCP*SIHPRTIAQSR*WLVFLP*KTRKMADVVEKGK
RDGRSGDDFVEEVSIYIDHIEKNMK*HTHV*EYIIFVINTS*KRKDRAFITRFLSAFRTI
NYKMIQSYNTE*NSGKTIAEVRQPITVKPTLSSSLIVA*KIVITKYC*KQKRSG*VKP**
TSSTRIS*SVLFFKKGKFRNV*RNP*SSLAFPFTPFFYRRWFEGKRKMSNRKIQ*SISIS
IPYWVMWRRGLNIRYH*FNVLTMFKFSDRVSLIGISFQRKGP*CGIEDT*VFFSPSKLLL
TRKTSAIRWFIM*LFCDFFFCEVFSSSAEDPAGEKVSHFYPIGACYVDMLCVQETHEPKK
GTLSK*FTLYESKLLEEGAEN*RRS*RKFILFLMERLRS*KGIYSYSIASSNSEESQ*GV
KPASRCYSSTSIL*RKKAPIISLLPY***LGKREKKVPH*KNHHL*NIKSLIEGDIC*NF
CCVLLGYCSY*ISLLFLSCL*KISSKNIYRINRQLSNTVIENEVPSCFICPFGMFICRRR
KPNRKPIQIQGC*GISQ*EYQLHFAGLEWV*L*QCYLR*WNKQYYQYYYCRKQSITNHCN
RWSSTNHQQFFDPHKLHQIIQQFFCFEHYRIVQCCPCC*RNDPR*VIRRCRCCCQRQIFG
SCLILLLYHF*HRKAYCCH*RFRLCHSSR*Q*ERYQTWCLVRHF*QISVLRCLHSTYCLF
LRCWFACCYR**PRRS*MVLRCF*ANFNLF*LDYQKGIQ*LHYSLWSIRKRCSNCSNCL*
RWLLFQFD*LLEFCRSRFGCCFFWFYQLNLIYY*KH*NPSRICSS*HSIKLY*QQRCSKE
RCGCWLPIPN*GPNLVVHCCR*WCHLQVRSGKHFPMN**ILNLAKHRDSFFTSHHNHYFT
KFPRNSFYFRS**EPYFPLKQYDCFIHLFIVI*DIPQIIN*LIDERII*ILGHTYFFIIF
CYIDHR*ISSRGDTPLKWEKKKSFKTLLTLSLEGLAFTTCKCQDPTCIHGYNKETMSV*F
VYILLQIRDLTPFFCV*VKSSDIFSVL*RPCFKLERQNSSCCKRLFSRHQVKRIVKSYNQ
CM**VAFINSF*QFPF*KKPTTTLVVR*YTL*WSSVTVRKACKQLLHRGVASK*TSSGVK
CLIQRPHAKETTTDKQIHKL*SWIHHQNTPGPVILWLTNIRWTPLYLLITVNNRHNTKKN
PAVTM*TVPLTP*AK*IRMVETLTNSSKALANISLIQFKLGSLPSLLFIICFITGEE*NT
MML*NFPSNPNLPVSLYAINVVPPEPNILANFQYPTISIIKSFSEKVIELNPLLNMLYTE
NGNKISPIK*SKMNKFLRKVLRGLCCLAVNGESAVLALVALIVSALIPPFPFVVASILAA
LFIFEVELIFLLRELNIPSIACCTSCCSSC*DCSVTGEGSLLCLVSDSSRNR*NR*SSLS
SLSVQLLRR*F*GLAIFSH*MLVRMYAFDSVSL*SYSRIDPI*R*RELFPLTIVIKDHQ*
RKLICNEKMRSLHEYED*LHSNVVDPWYSHTLSQHRFVQFLKRRWSGLRMFTGLSLQLYF
SSDLYTLIQNQSYIRFLTTFPSKNQETALLMQEM*T*YLPYHYREKQ*VRSLSRPIPLTW
SCIILRILNWRTYSETKHIRLKCVGQQYIQFPLIISKLSQYHVSLNFRELSQTTREY**L
SRSCLTRILVSMPWFQYKSH*SPLG*VSPWIFTQH*SLWCY**QGLLLPGHHTY*TIFC*
NFSMEA*APFGWIAWPHHN*NVKKSINHQMLLIKVGIFIERKGPEYLTRRYVE*KLISQ*
**PRFN*TE*RRKRNY*YQQILAQRNEAIQNVRKAAIKERYF*AYHAEKKIFRQW*LRFA
ESWHSKQ*SNKLWKE*PAINKSQQTTRRYNKKKDKHLSVNCLNRWCSR*CDVDTKGGKYI
EWTTIV**RYYWRW*YKFNASGEPQLFVVQFVY*ITH*INRQPVLFYIFLGKEKGLLYLT
LIM*FLEMSSVTAIWLTVFTLISYI*TISHSDVIFLYF*LIIFTRQNFDFNENIDIFLVF
QTLENQGNKNP*NIKIGNRR*YLCSKRYNNPPQCRCSSLTWILSRQKTTTV*YSEAPMPL
PPAKRSSTVFS*SQM*LPTWH*YF**QRSNCHGGQSS*QPLFEKYYPELVQQNQITVLQH
RSLTSLAEPHWIASYKV*HPVEGVSMQNLDVRDDYRASFWTVHDMRNRSMTKLIQLAGNE
EYFDEFVWFLTESFREWMMLIKSFPNY*KILCSLAASRQPYGPSKKSNQ*FDLYYIW*NL
*RQSVSILRKFRYLPISRRHHHIMNKAAV*SESRLIRCSSLDPVLLYWPFCMLFSLRNTL
SFIFVLVFFLVLCV*VLSKLFLYLLHANYYALYCK*NRYYNKPYHQC*AVN*KFKEKNIS
KFSNFLAFIF*MSS*FRIYPLSHADKKKSSPLVASDVRIYIKLPHPPFGGKSMFYK*V*R
CNKSLYKQGLELGRKCDNSEL*AHCSVHLLQELALILI*KKGPSTNFCYI*ECRRLSKKK
PECWM*ESTVHIVDN*TSYLSIVRFAMKISARTIDLRKITTVGGC*SMKKFIKLKKVLAK
AGMAQVLTMKHISRVCYLRGPVLESRE*VKQESL*EVLTLPK*ALL*TQRH*TKYLSSSK
GMRKERAITNQKRISVPRRIR*FNWLISRKLLKVTPRFLCKIGFTFGVTWWMVMRRI*PR
RIQECHYTLTKCGLWVGPWTICLSS*T*NLAH*LIQVLMTNFNYAN*KRVNKFHFIILAL
P*ESLMRSKILILCI*YTITPTKNLIKKDTINNKQSRGTSSVYTI*KENKKNQ*PIKDT*
SIKNDIKKHVKYLIFF***TFSPLLFK*KT*KNIKCTSKS*Y*NKM*RSLDGGGNDYKKP
PPFSILTAS*LTEKTFR*FVTISILRCVFSVLFVVRRWLRIIWILVSLTIGTCIGKLFGF
LLHLLLLLLSIFLLSLLLICFIRSWIKLRRLSFFVIVRVIWL*LITIGLLLGLGLLQLLL
LHFGLCLSLCLSLSLLLLLLLIVMMVMIG**ILMVFTSMPF*FFIWWIWVTITM*VRLFV
YRQIPTTATIQLHPIILSICCFT*IIQHR*K*HAVALIIRSFLKR*ISDYFQIPTKLDWE
TLS*IVNIC*SFLFANFFVLLLVIWCFQTLPW*LPPQEIKEDMTHSFHIVSSRLFSTQMC
IYRHVSCCAT**FLFPVRNMLFSFWITILFGHTKVN*MNFVSIWLTRSSDQKIIRFNITV
YQIMSVQIFN*SYHLYCDLYNSFYRKSSSTPIE*IF*RRTKQINNQYVM*SFLTKVVFLW
YTRCSR*NFIGPIFVL*LWGFCFSWFKLDSNW*SIDHVCTFKKYTK*TFTDFLTYLIVQP
DYSGIVA*L*ARIGGRAIASVVI*VRANM*GWG*STIDQSNIATVRHL*VHCVIIDS*TR
VRCCQRTLHLRHFWKTIFLAYMLCSVETTSFVYQNGEKNFLI*SAQKHETQPRS*ISKEK
NNIKRKK*FP*RNSFFLSEKKGT*EYMRITKVYKKNSISYTIT*TCFLLSCSLLFFNFPP
EKIKNFSLLILWRHPQPTL**VF*RSRLILSPNLAYRIAFRASRRESMSLCLSSKVSILL
SRRSASFSSCAVTLLCFMKIKRSPTLYCTGSSSSINSISRDTSSRYSFSSLCKLNSCAMA
SLRIINFENSLIFC*SSNVT*VLFLCPCGNSSIMVLC*FLGVVYSGSFRRTKQSISPLST
*LPVKLYEKPPLLIMNDGLAFLI*FR*KHRKVC**YERIRRP*VSQLELG*LVESLSNVR
RSMEWKPRNPLRICEQS*RLA*FE*TGQAKCNA*VANSSYDKSQQHSTSSRSKPCFPLFR
KI*YYSRDKAFNVRRSLLR*KEKISAANWKM*NRPFKCY*SRPEGGLLYLVRTEKKWG*I
CWHYIH*VDFHSQSTSFKQGRS*QRNGQVGFIYGYEADTTIANRIRV*LCSWFYDETDYS
PVC*HKSRG*G*GTALQKWQCFLHVI*IRYSGIGK***PNNFTSNFFSIHGYNVYIRN**
YCYIKHFEYKIPFCQFKEIKGEDKYI*ES**FNKQLPK*I*QGRY*GTSKGYWCNFVVLR
RR**R*RRK*RILFFQP*SLPQL*PTALTSYTDQR*YVQLFKFAQYAVSKKR*TLTPRFL
FA*LTSSSIRPEFSKTTTSTDYFEFQF*FEEEFDVSYKKKTTSKAQLMTRETCCYCNTNI
*IELRFLMFTKIFSFLNFIISICIHKSVAPSPPI*TIKKNANCTNSALKNIQKYGKAV*I
FN*KAASSFGSSSSP*SSSSPLLKYFSAL*SSSSSSSSSSSKSSSAKSSSSPSPVLLPFA
APSPVDASSTSSANSFNFASMDSPMFSSCKPVPVKTSSALLNLEIANNFFLLIPITLYNS
LGKRFKLYG*SSIEIPIFLFFKYLSEYLSMPSLVSSSSRIMLGLRLPLLLFSC*SIIKLI
DPV*NGPSLTVFPKLMYFTAKDLSLFVIGPLMGNGMDGNSVI*FLPTSP*PNPKGRLLI*
LLPPPLLPPL*ELMFVRGIYARYYQVTISFCRVVFYRLLR*GNYFLL*DFFKFLFIFHAA
AQELKPLTKAISVH*VTPSEALLCGMVAIVLRFFLSTISLFLHKRKEDLVHDC*LL*TIT
SAM*HLFESRPLVLKIIYIFNWLDYEIWTSHCCVILSLLRHSTSL*TFSFLGCLRKVSSC
RIYINQFLPIFFCILAVNSRLSRLISCLNCELHHSCGMGIIAVVIRLTNVGIC*LLRRHV
TYKLNLRRKRKLIRR*E*CK*QHR*WLDYFIRKL*KN*KQNNVTMTKRNPYIHREPILPV
VPQYQHHYLGPTLGFFS*PLPKRFQTTPVVF*LFF*FSYPNRKKLFLLLQHHLACRSGLL
ISFPLCLVCPFPLGQPTASSPIPWMRYFLRVNNHLQLSPIL*SACSHS*LVLPSRYPPMF
PLLQTSLSITRQFFSS*HLFLIQTAECT*IQLQIIIC*HRMEITN*TATALILHKFKFHH
RSPRHHGRLPPRRILRLLIEFPQPADAQTIRDPAPQAQTVLPHLCAHRFCLRLPGIPHRT
MCPSRPTVVVLRTVKWPHVERSRLL*HDSGGR*PPLIALGHMLRPALPAQRAGSAVQH*T
YHSREPSSIVIRIDPFANNPPR*LLPLRGFLPLAWPAG*RLIGH*SL*QPQ*APPLLLGS
WHLHPHLNRHPPF*YYISPCCRTVFSQLFPYPLVPLR*HGTIGP*TALI*ANLVIPFLYG
PIHSL*QL*P*FCHVIFFSISLFEFVALCSCRLSSSTAVSLRAGKKYCSFEQRRKKL*LK
TDNWETTIKNTHVRVYYYSKKESYLRAALCLLHRTLTKKTCISNTPYVSLLIFFRGNNLP
FDLFILTL**LCFLFELRNQRTNHNSKGKNSKALKEKLFWI*RSIKILKFASN*WVVN*L
*VS*KAMIN**TWYLMIQ*NICLILMMKTTLN*FLKTQES*V*PS*EVLFWSL*VPPKVL
MYYICKNRFNNIISYKLPSLQLKTKSNHGMAFLYIFSIPD*HSMRYIVLSYFFYTAI*SL
KPENEEKRNKLRSFV*GESLYSCQYQFSFCQIKKVSAYTYTPPSTILIIY*FLSYLSSMS
NTKHTTSHHMELKRIIILTLLFILIMLIFRNSVSFKMTFQELLPRFYKKNSNSVSNNNRP
SSIFSENLVDFDDVNMVDKTRLFIFLFFSFIITIPFMV*IRKVKAACFHLKQILMQ**VH
HLLHN*LIVSFSVKCMHRTPIIF*VKKACIYLFGKFT*HGCHKERK*NMHVRGKRTKREE
KAVALPRNFVYKYLINNHFISIHFFCRSSVH*HH*RHQRAIIFIQQ*LPTLMQPITTAST
QATQKDKSSEKKDNYIIKGLFWDPACVIA*FLTTTKRSNQYLPFHLLRVAGKLIYSNSLI
ISSPFPYFFILLYICICSYHFNRFFHVFLF*YAFPSAGNER*TTHYIRFFF*LYF*LLFN
H*KHIYFINS*GR*FYRKSEKVLSQFSKTRRIPLCMALNNGFSRASSPYYLHHYKLL*VD
YSFRMLVAVPV*K*SYLPMGGLPLTV*CILMSL*YIFSLKLVVSPVPTSNRYWIDSYFHI
LVTISLENHDLNNQSRKSFSY*ILYRTQRPHSHSEILFHPNIPIY*CHHPQHIHLHHPLR
N*HRLRLRHHLHLHLHLHCHGLTFLHDSYAQQNSK*LTFLFPRIPVQNY*FSTLTDHSAK
DL*GWNSIYF*SFHGWMFVPLKQNVLWEKKWKIEQKYWY**YYHCHRFLLEHYSVPSISF
FVQCPY*SFFSNWNLF*RNFLVLM*ISHKNQFENSPLPMNQSHWAHWSHDSHRIQREVAS
LNFLILICLSDVRCRWPLLLQQKRCVIFLKVKSGSENHFYHYFVCSCFCFCSYCVA*IFL
PSDVSFWERFYRWAFPSIPDPRTGIYPCSNT*PNRSIRLHEKTALETVVPHNAFLKQNL*
RNNL*ADQLWHIAGSNS*RGAHLIKICARLVLFPRISFPCHIYRIGKWISS*THLITTEP
NDGDR*QFWNGGNGQTCHHHDSF*YAWLMNRQ*NKSLSA*SLFEE*SCSIIEKKHFQRAI
VFPSS*KPQYSVLQTVYNWEVSQK*GTDDNAHI*GT**L*TDSQNHNTEVPLGTDLCSKA
RFCQQHQHLLRIVAPLFRS*CLC*CLLCYRYG*KSLSEAENPE*NY**YWNKETRRPWIW
MRLSVKASAPYYPYRRGLLSFQRCWRTFSE*VRLSLLLSAKTT*KNSA*CYCLCNN*CQS
YKETSLTVFAIYQESTNKINK*HACIYYEKSFNYVFHLLYPLAENRIHANFREFFKMPAP
HIFLLDQEQICSFAQGVAWGRNWPEAAERKFAKR*WGQY*RKRRGGVWRKQLA*VTKNRS
KIILSFFLLT*LWDPDHSVLHLIPVPRSLGVADFRVSRALSASVPSE*AKIKKGPRRNLN
SGYVSHGAPDRKD*FQVHVSNEDKSQTPMYRKSMCWLYYKVGIDHGDKTWNF*LTMRL*R
C*PEEFT*FTSQEQQNKDRVYDEISFYMNKVIF*LTVHGLRAVI*WDEWFYTTQEVTLSF
DGITVLIRSRVA*CELMEAFEFHRTYLVNVYEFFIPFTRRNFPRLRNCCFVLHLFIFHTF
Y*GVEMKWVERHMDVTISIIHVEPIPASVDALLSIEPTRFVLKDVGKEENYC**QDL*Q*
IFFSFLRNYVRFSSKKNPVNI*ISASHYHIAMAFISESHCQQ*LSYSLQCCLTLCSFWRL
NEP*RGK*LYQEY*QNTDWMHWCW*VFFF*YYWIIFSAIDYHHSALVTLKYTFHAYVIAY
SVVNFIL*AAWSPITAPLSRTV*ASVLGNDVIHVGHRNHSWLCNSHNEQGMLSWVFFPLR
IPGLPK*KRNKW*VFKIRKIR*DIFFFFFFFFFFFR*QRRILRSLLTAVTAYQECLVIVK
AR*DKKCKIDYFPRKKLQLLTHRRILSGVKTLCLINEVFSTRGVHSEPLFCTIYKQ*LHM
C*PNISG**SFVLSRPFKLNILLK**VCTEL*KKFSFVIYHT*YITIQYQQCLTILQVRL
QAKERVVTR*QQI*IHNLTWPTWDGSVWLQQVCGLWSQVSVYYILVYPGKSMLYPCFGPR
*WLPPCVFSNGFSGDTH*LSHTTLEVTVLLVPWNSLGFVTF*EPHLVSVLFPIYCLPFTK
VCLPQSPVP*C*VVPARGQGCFL*WCSCFYG*LLFIVLLHAGSGMPRVGWSNWVAWTMQV
VYVSI*HLDMVV*FTL*YWVSVMTLLHVKGCPSTNHIPSPRWF*AQCSYGLVGCSLTEAL
QVMQLYEHGTLLCPQT*LLLAVA*HGWLSIISDAEESGLQLVCVQVSSLA*WVSPQPPGS
CQSGQPLSLVWLLVQDVTLLLT*RVYCASMMV*IVTLSMVWVVVLVLY*LVSLLQTM*MP
LQALTLVQLMVAGSIITINKLVIN*QVYALH*PGLLLSHLSCF*L*MPFHF*N*D*VLMR
KN*VPTLLKLVNLHTRNPLLTSQNQSDLKHRHKCHLLMKTLMIRLWVTQTQKRILRLPTL
LLLRTLTI*YNDILKQTMILCLIFM*RFI**FYF*YLIYFLFLITPNDEGRR*YYFSCLM
LLS*SMTLTVHTIIYSISRA**QEIFFKKASIYPIYAVNRKRAQGLFCFGCKFSSLIEDI
F*CKNLDILPFCLIFHCFHLFSFFFFFFFFFFFFFLNLKILETALKWRRKLTSSHANED*
KKLTYKAYESDIFCK*IIDKQACVFIVILK**LPLELTKEKKKKIMVSVEFLQELPKCEH
HLHLEGTLEPDLLFPLAKRNDIILPEGFPKSVEELNEKYKKFRDLQDFLDYYYIGTNVLI
SEQDFFDLAWAYFKKVHKQGLVHAEVFYDPQSHTSRGISIETVTKGFQRACDKAFSEFGI
TSKLIMCLLRHIEPEECLKTIEEATPFIKDGTISALGLDSAEKPFPPHLFVECYGKAASL
NKDLKLTAHAGEEGPAQFVSDALDLLQVTRIDHGINSQYDEELLDRLSRDQTMLTICPLS
NVKLQVVQSVSELPLQKFLDRDVPFSLNSDDPAYFGGYILDVYTQVSKDFPHWDHETWGR
IAKNAIKGSWCDDKRKNGLLSRVDEVVTKYSH*YHLQDIV*YFC*KSFSIHKRFFVNL*H
YVYAQISFDVFDAFYIPFCVGKDTIEFYKLI*VIIRALAGPFVFHEITIRELSKYTLKFS
SGMLSTSNYLWYLLT*FPPLGPCGSA*VLLFLFPLYL*FSLALWAAPLSRVFL*SCV*NL
FLIVSSFLNLLFGFSSFSEGESRL*DEAW*GLALLLSLPS*NGFSGNRNCERCELFFLYS
SRKRLSL*SKPSPLSGPVGLSALLLSLYVLLLLGLVGSSDLLCA*LLIGLIFLGAERSLL
GPL*LELP*PSLPPAFPLYLLDLLVYSGAAASEYELVVSGYGSREIFLIYLLSESIFSAK
SGF*GF*MSVLKYLSNISKVEFLKSNIGIFCLDNFLKFRVSSSFSTKEIAFCKWFVAK*W
FISSTCLVTLEYDH*LLEGFVGITGSLRE*VYLSLLFNPALPLATLLGGSF*SLCDLLSS
NCFLKATCFCSFWQAVS*FLISSNSISRILFCSASSSVKVQNSSNSKASFKRAFKWPINA
LLGSLISSLSSFIKFSSKVV*TNWI*AFTTGKTLVTCFMNSIPFLIDM*FFSDKRSMTCS
VITECHS*SFREAWSLKSPFNLIFSSFLRTSVKNRPKLPASELVQQNSNVFKIFDVIQVF
NIDIKFSVLKAIKIKNEEKRASEGENKTLGTTQFCKNILI*SSPQSLFQTFDFSDINSEV
FLKAL*CEIPVTKISLI*F*IRCFFLFDMWPVFSPDSAFLRSSYSDLSKWISYNESLQKV
VKRSFDIFVKSTSLNSAPSINSSIEKFSFEFN*LSK*SLHMWKVHGVDKWNLLFNSTNGR
TFSSNAFPFKQCLINSINDHNNVFISSHLVDKIL**EFCVFAFRFKVYNRRIISEIAL*S
VKNEVSLDEITELSSLKSYMRCLAYCFNGDPEFNINSCFILTSFKSLMPPTVIINSFRIE
TAMIFPLCNVFKI*VIIFEISILGQFLAKPAINIDNLWTHMAWLTPSN*TAGLL*VKRNN
NTNCNTSYAKSLKYFVV*TTSSETLS*FSICLTAGTSEANGFVEINLANLLDSFAIVSIL
KAFKILFASLSALLKLTLSGRISWDNFVIISL*IKYLFSKGKNFISS*TSDVAIGLFCNS
EVAGKMNFLT*SIHLSIVTCRDSEPWFF*MSATPIREILLKSVGILPKYGPMIDK*ICEF
SNRSFTEAKGVKLEFHSL**KT*LEFNSRDSNGS*VLYLWINLGLWARIPLSIRVIIKAV
AISFDSPDEVIDVYNGFKRYSNTLPKYLDKDSLTYNTFGYCFNTCITGITQPCMSKRSKS
FILPNNKISC*VFCLPFDSISAFVSSEILSFILTSSFTTRALSSSVSFSVDKAAAIAKGF
STPLVDSSSSSVSKF*IYSCRNSISGLTLSQIE*KLTNPFFSKMQHISIYRS*FSLSTSS
LYCDKLNEIMFAAIILPPSLREE*LELLATWLDGQESDFRKRAIKNLYPSVIN*LETFKI
TSKVRIESKEYFPII**ISFKYADTLEKLSGS*YANINKATN*P*PTEFSTKRLYFFSSY
FDFFNKCLNKVVCSLLSSLEDIQLNLNNSSCNDGISLHNDMVVRSFIFGTVLETAINILP
TMEAWDTCLS*FTNSLVNDATSESLRGEFSSFLFMKSNSSINKVLNQSSFSSFDSSAVKS
EQRVFDRSGQFRITSSVKMLA*LGEAGGITF*ERAFNLESSVCSAIKS*KCILVRICIN*
NRFTLLCFR*RR*NHSPIIYATVFASKSTCSLGINSHTLCRY*RNSGKSYAEVSVVTREE
EKNISLLIQNM*IVAKMVILHNSKQ*N*EKKWYVTFYCALV*IEIIFTMVLTTLAMNRAS
PCGLYVMLILKTGGKAEAVEVAEDIQTKVHRTGR*EHYTRTVAEKCEKRYTKYITRPLRI
FGVRFIEPRRP*YT*HSYSPPEIHVPWL*SLLTRREVGR*SHIHK*FLHKITPRMSFSRF
MVEITLSQ*PFRH*F**LSNIINLDVYIKI*NVGTVYNSYRLK*SIHVA*SHKQGFRSEI
FW*YRGKLSLKLFVIE*AKLQPCEIESCLTLSTQCKVITLLSY*KG*KKPLQD*RMSPSI
KKVIFRINWRHLKITSLPTPGPMRILRMNLLQKMLLK*NKIRNA*LRSNLTSVRILIRW*
NYQERSTRWS*MLCSC*REAFNRN*LF*ELL*DQENRIILLKLSLIL*DLSTKIL*SWVN
*RNQTVKANTSHI*ALYLRVLLCSPGLQWTLPCLWSQISRTQHSFGLIEF*KNTESLILM
LLNGLRNFWPLSII*KPTLKSIILLGFPGKKTVWILLTRWHNQRRIQVLLHLLRQQVLQR
LQHHHLLHQPHQLPSLKSLMIHQQRVVMLTKAVLARSSPN*IRVKISLRV*KK*TNPNKL
TKILNYVNPLQFLPQEVNPVHHQGQKSHQH*KLRGLLERNW*ETNGLLRITKMKLNLWLL
MQIKMSLSS*VNVLKFLFK*KEKLTLSR*VKLSHAVLFLILAFPVWMSSNPTSLAFKLTI
PYLKSPLINLTAVTSIYPRNP*ILKSTPRAQLLLTSTYQSARTMIT*NSQSLNR*SIASL
MVSSNLLFSNMLVNIARSINCI*LKEINHI*INQKEK*MNKQLYTFCKTFFSCVTFS*RS
NRKTRSD*VTT*SFE*NLKTKKIKYLQCKERLKISQKTRATIHDDHLPFLK*YIYARS*T
GTSNGEITSDWPGRATGSLRYTAWHVLKDISK**GKMAKGDKNGLGFHGVKKGFLGSCLP
*T*FFCHGKFINLRAFGSSPSNSDNLIGS*YFKFLAHLGSNVSEPSEISLILVLKWSVIF
FVHSFTLSAMILFPDLKADLAPSDNSFFVVSLGFIISVASEINSSG*HLEMISLLISPDL
KNS**ALFRLSNN*ESWISGRPCLSSSIDKGSLFDLPISFSTFKSFLKIPSCVHPFNALY
CCDSRFLLYCLKNS*N*SFFGLESDIFSKFSNFFSQTSFGSVFASLTYLFHKTI*VLSIF
SASWKLGFLAPRASSTLSGLTLNISPGFKV*LGCLIFTPLTRTFPCKMN*RACLTDEANI
ALKRAKSSLFSNTAKVCNKNGVSLISPPRSEASNCATESNLGLKTVCHLFSVKCSP**AR
VSCFAVHFC*YKDLDFKSTPPFLYKLNKLYLLKEVRTRPLAKDFSKLAFLGIISVF*L*P
VFRTKKV*RSSYSIYIRISCTSSGETFTFLTVRSLFLYIFSIVP*LILRSETYPAATMKS
KIVLNEEINHIIYEDGLAEFIRSC*LLVKKRESWM*W*YIGQLWMKYDFLDGHLNSNRPE
FISISTCFA*WKE*IRQISIQ*RYYRKKP*SWGRYLLQKTYGIS*ANLTI*RKLMKWRIH
IPWKPLQRVHGMAMEMVTMQKFMKKLYLN*IIE*EYASKILHYLGRNTVS*S*KMQEKVQ
TLTKSILELKI*MRKIVQFQRKVLLQT*RTTTINRKKMRQLK*KSCLNIIQRKMIAP*TS
RKNPLRRCKAMKRNSRGNI*VKKNRK*KVQIKQQLQ*ENLKG*KEVRKLNLKMKKRKR*K
KIIRKTKNRKKRKRRSRSQK*PTMKK*IRKKTKTKKVMMSVKNPPLMKIPMALKAKELTK
ELTKNWDTSLNVRQKVKENKLNQKGAT*RKKRKTKKEMINRMIPKRILRTKMNH*QRELG
IHHPQVILAMKPRRKGKGGRQALVKIALLPQEFPAGYEIKNNHCSYIDRDNKRSSVP*RY
LYLM*CSRYRIK*P**RNRIYVCFSLSNLL*LYIYFN*GSDTYHKHK*KAERRLN**YFA
FS*PSTIRRRKPKYCLVESNLGNHVGHKHMGQGWLT*LFHQQTTLEYQHPNP**LGRHRC
YIGMESPCQRRNRIFGRSPRYRCNEW*PSHLSLGRWHHHLGKFCQF*RYLQLLQTLLLVL
IDFLLILEFR*KALL*AFTSLSTKFFQRRLSSGNFFCPKKTKAGEGN*TAL*CGGKQNDQ
ALYT*VAIDYLFQDGNQLFARIPPVLNIIK*LWDII*PVLVNFHWDVVDFTIIDFWIDEL
NKFYGGFLVFRVCWQSKRAKWDVVTSYQI*KGSFNTDVLPPVFLLDIFFG*NGQLNDRSV
*VISGTFVHLLNSFCVGDTVHQVRNVVVLLFYLFDNVSIVVVKKFICTVLFQQFFMFTRS
NDDDLAETV*FFCQLNKHLANSSGTTPK*DGLISLRFGGLPCHVQAKTMCKDHTSRGQ*D
WEGYCPF*RFYGAFW*LVFTAQSKLSGWFISSLG*NGRVLSKGTV*GEPH*STVNNPINV
ITNGKACSINIWAQLYDLAGCITA*EGTLRTNLEINMFPIGRVTGNGDSLN*NKSFF*FR
NWNVLFDYSLAIFNDNGFHGFWNRGGHA*YAV*YCFLLCIVNDFFSTRITVLIKK*EEEN
GKKKTLSF*IEALPKYLKNGLKSLTSVLTNRCQSNGGSPYARY*EYAGAEPRDNRKRIRG
TLVSRGCDDH*KIADTGSGTSNQCDQFAISFHEMVSILSMNALTLRVLVISVLFIASVGT
YEKGR*IEKEFPSFVCPMFT*FI*LEV*SWHKALVVTKCVGHHISSPVFYPIFLWIP*FL
V*GWMSLRPLFVFYCPN*CRSLNIFLY***NRSPLVMLFFSFQN*LP*RLSSYSVLFPFL
ATHSCSSGKIPGPLYST**NFHGLSPNRYIVFVY**H*T*ADLAGTSWFSFYIPLHIFFA
PLALVSSGPLHYQLLLTRISVVFSLLHY*HYYHW*MT**YNRAHSLLLEPLSLGFDGLTS
NCTFSCV*TSFFPQIGSASKVIPRDDKKAEKVSEK*ADLAQLGERQTEEKLRSSHLEVLC
SIHRVRNLKNFF**LRMWMCSVSTDARFSNQMIQARPNIACFPL*LPRYI*ISCKK**FT
RNRVKNFEKKK*RAKIQ*DEMRC*RCMEILYLSQIKYAIEYISQVTFYIS*FLTCKDL*E
TYKTRRKWPKKLSIQESRH*SGMVFKPNKGPYLSSLGTGHVTSSQIYII***VLTLR*TS
PSYGLIRRSF*DSLRTEKKERIKLRKKLKEVQGK*MKWTLLNLLSLTKISDMYTTKRVRK
YWVIPMVCVFFRTSRH*PQIF*QEPLKL*KVVVLWLFY*NQCHR*SNCTP*LWMFTPVIV
LRLMVTLLQDLTKDSYFL*VQIQTV*SLMMN*MFYRYLVPKT*NHYLLRKMTNCLQSN*S
CKN*KNP*KMSNQLVHWFLYPKLSIKPTLFFLSLMPFRKKL*ISQLH*QLEEVEVSLLL*
VFLLPRPFLTGILIFLLLLHLPKI*RLYLSLFSKDSMP*VTKNTLIMISFNLRTPTSTKP
L*ELILKEITDKRFNILFLKTIKFWAKLN*LSLMKLQLFLCQSSRTCWAHI*SSWHPLSM
VTKVRVDLYL*S*FSNCVIKTTHPVGKVLKPPLFREIIRKKTLTYILNPVNYVKFPWTNQ
SDMLLVTQLKNG*TSSYV*MLL*LKTQDLQQEELLTHPNVIYLLSIEILYFLIILSQKIS
WKK*WHCTFHPITRILQTTYN**VTPQRTNYLFFYHQLIQRMAAGSLTLYVSFKLHWKVK
SVRRVSEIHYREAKELVVI*SHG*SLNNSKTRNSLV*VVLVSSELPLILNTHPWAMVLVQ
LNY*ETISRVNSLTCLKMFVLRIIL*RG*AIRNWPKLIY*RMTLN*ETQKRCHLYY*NFL
NSLLIIYIIWVFHMV*RNRCINSGRITALFLFIYVKPQTI*LVNILVLC*TFWKAENQTG
SLNLPKISVKDFCRFFLMIFISLLPFKP*VSLKVVRKHKICLMTKSMIIKN*RGRIWMTF
FLHLT*KDWIATQIIC*IITLSVI*YPCLLFCTSAIKWEIQ*NYQASRVLSCWL*GYSVK
TSTLLPRN*IYLPIKLLLCLRRS*EKCLSTSVSC*ANQLKKLYQISKMMLLLKWMVKKSK
ITTLQKHWTKWKKI*KKPVLKPFRR*GKNKKS*STP*T*INTP*MITVRNGLNLKNL*K*
LPRPKASSV*KLVKRERLKRLKISIDKR*KL*KNQESLKRLQIKRSTLCQTLL*LNVYLI
CTII*NRNIVDV*TFTYSFQSCRAI*VLRLCRRKLNPF*TISINILHSVVSNFWSNTK*P
KRSKRNYIPQNKHHSNGRIN*N*RRCRSIRRTTIFQKSGHRGRKGFCNKQRRCR**R*L*
**F*R*I**K*NIVGQNRCFKRHCPPR*ETNNF*FFWFY*LFCEKCFHKIRKPCLDFDHH
CFVTRCATILIYTCRTTANRNGKDI*FTK*C**HIGPR*KRCCSNSQLILMM*KKREGFR
KGAIHVPMGH*LTNLFCLHSSIYCFRVKLKKKNLRFKPLYQYIVIVYPFRLL*TSDAKHF
FLPFYLFCSFYLAFLRLI*TNV*TCTYFK*KTFSFISRKLNFFWMFN**SVNIQKGSDVI
DNIIDEHSMDSKCQAESHPNQCRNYASFLVI*NVNHKCVQYQLDSWD*KWEIDHWEWLHG
*MSNNHPTNYKGNRKTNR*N*SQRNKRWLNQD*GKN*REVCKEWQKTIYCFTYIFCSFAW
SCRFGRLGFVIPHDVCMSCDNIKY*CSCAKCIH*MNGFNIKHKILPGELRYFSVPDGLRS
VNSDCNERNTQNNNTFNRTAEFS*IKFVGVILFPCAQVKAAQYRKL*KNGHICVTHTCHG
TDRNH*QSCVD*INTMVKQFP*RALLACTTCMHSIASIKSLV*KQTYSIGEIGPTWRFLV
KIRVVVKCC*HIKYNKAEP**CYQIGCHP*WKNSRKLSPKGPQYMV*KERAVITLIPKVR
LVI*CYNS*YLFFLPQKI*GAIR*ATYL*SFKFPKLL*GIKNPIVSPESVSNTVFESMVD
DFQIHEFSIH*PFAI*SFILAERQRKKKKNVTSREFSHAL*SISFSNRTGL*ETTI*EGL
HKINFYAIGNLVIW*ISEMLYDMQMLHYSGNSH*HLSIYLT*KDF*SYRQIRRWSQNVNN
NFNLYKFSYICF*ILEDLH*TIVAVDSFETEKQYTQERNGSWSEKQNQLAF*AVPIVYQS
KGKNSVQKLSKCELE*NLKI*LRKK*Y*LH*VDAPPVVRRQLRNLQQVYSRRLH*FMKMT
FTNMIMKCQ*MLNITFKIGIRQKLLILNFSVKN*M*SNKLVK*PPNLYTITT*MIPLQSS
TLIDKFGTS*RLSMTLLMTTNMKL*L*MGL*FSIILEYQKNLI*RY*CVLPMKY*KKGGL
PEKDTRLWILSGWIRRIISTNLCMNLIVQIMRSYLLMET*KVY*TQGSQRI*KSS*MMMT
LQLRNL*AGCAKRF*SFVRIRKAPQNR*EV*KKKSKNNKNKNVYLDR*LK*DNFRTTILI
TPSRFLKLFFWCK*ERRGVN*KWKKASLNGNQST**RKYCLYQ*KKLKTI*V*D*IYHIF
*LI**SAHTR*TRIQNCFIGIAWMT*YCF*QCTMAREILEFLILEVRKKTAIIKIMILLV
SLPSLRAKILKFKNYVRR*LMMERYQYHPLISKQGPWSKKKPIM*FVKGSVG*IIFHRHL
NCWKRL*MV*KITCPFRRIEWLFYIVEWGKADLV**Q*HTS*NTCSVLLEKQD*YSCRLD
SSMV*RMASPYPLN*DT*GTMSFLLPMKKQPKKEFLMRR*NSNLNSGLLK*RSSAHQA*S
LPSLLL*LLRFNTTTMIEMPS*PEK*YIQISWRMNAVVI*PSFLVGTT*HWKMIVV*NLP
WGPASPKPPVA*YLGLHAPAVG*IYTLRL*CT*LKTILRQITFK*RG*RETKCLGQP*AG
KSWTVLGSSALTA*NYFRH*NWNGKLYRFMHFVKSIHSLNLVKSVIFIVNWFVLVGFFLY
YVFFSFSSIFLYGTLIYWQVFFGAVNYMNQNAILETGRNI*EPRSRLKGIVEKFY*YL*P
KKKVK*QIFIYKPR*NEC*WKISFQRPHYKVCVFRRS*EKL*FQRQSKVQR*SHFT*RTT
GRNIEQRRTAKRFGQHVAR*TEHGKKQFSCR*KK*IRWKYQCLNLQGKIRS*GRYSYHRY
TAR****K**F*VQ**WR**G*K**ER**Y**RR*ISRRC*RS*RGE*G*IIC*CR*TGW
L*FE*GF*WQACSYQ*KGRS*L*YAGR*RISEIT*PVRSFT*GKIKCTLCFTKSSGLGIE
DVLFFGR*TVGMVLQL*LYAFWTDTDSV*TENYATTIIL***KLCCERS*MFN*RHPQFF
SI*FTRIIIYFYGMLCVYE*QK*AYKDYTTQQFNACSSYSRNCSCLQEDCNKL*G*QQKF
KETNNFAISFVNNPILHMQYLYRR*RRKSGSSKCCYRRF*ENRFVGIFNKVY*KLEVE*Q
ISYAHKKYDFFALQAYCITIW*QFCLQTDQIIYL*SPWLNISIKASRKAFYLPITLSSIQ
GGHYFPFS*LQYAQFWLT*RC*QIRISFPVSGNSSSKIKESSKYGAHCS*KTYCYTCSFT
AKLSTINAFR*RS*TS*IFPNKHGISVFVSI***RI*R*HSGR*DRFKYREKT**RYSYS
IQYRRGSENIKREFRN*AEYKTTLVRKGLIHDN*TWLETAIRK*AI*LCRA*S*CKLFKR
GKKCDLHYAAN*QIL*ELPFEL*LSCFCLTANNGIKLDK*LS*EK*SLR*KSSKYADTPI
GDRES*GIVPKVSSGHITCVIEVV*VKPYFEI*TLGGSYSRFAIHQHMRIYFKQIF*GLS
REGFQ*ICTNPEFILEGVFSL*RVLS*ILFSR*LRRGRHGDYAFVCISVKNLEKSHRE*N
TKVKGAAPLHRHSI*TLLSALQP*HVSSNIENNKRTHTIQKQEVEIRAYGIDIGGLPL*K
AGVN**LGNREGYIRRVERCLWSRNCTPGLASILQFSTL*NIYGGPWIWTP**FQPRSVK
QGIRVFEYLNLYLRIPRLGARCYCH*QSPIPPYVYIVFNGGA*KPLK*CLFDRAMVMIGS
SYHKWDTRTTVVGFLLS*YIRVTIFDASRL*TKLNKTNKYTHLMASSAYKK*KSQNTKHN
HNIYYSLFQL*LKNQYGTRAHSFWYNRGIGSSIIVAESFADICI*CSQFTAIIHQIGNSI
RPFN*FLQITITRFA*NNNYVA*N*EISRCFIWNPEHR*YGKVPLCLSIFASIKLQSKNC
PKIIWAQYGEPC*P*TFT*PSAGSKYIYRSFI*KHGPIF*KKVHGIFA*SLRSLFNLQFC
YFETVVKSLLCEHYTRGRYPKIRIIYIISYDIGTISV*S*ANTNSV*DTQF*EWTFTFNI
*SGFIISKFGL*SGEV*DVEYISNEKSIDYRNFRRITKLHSICEQSGLFRDSSVIEIVIS
*NI*KYNKASNIL*VYRTP*RIERRYILD*IKYFQIPRRSYYKKNSNEFV*FNDFSLL*V
FNELVD*RSTPSYLWRILHC*KH*YKWYRR*FYLPHSYRVQPRKSSGLHTERVGI*NIHD
RQIVYLPRKVL*RGSMDKRIF*KVSCPVPEQFLSGNINELF*NYK*SIF*NC*SY*SNSK
SEVSLQRRGICVKEYSSHG*I*FYGCSYRKGQ*YSRDTIGFIAKL*VNKGFTGSRAAFFL
KTFNE*SP**FCH*WIGCEGTRSWTWIRGLGCFYFRLHPLPPFEFSIKRKSSFWQERVST
NFQFFMEI*KEQLFLSKGNVEE**YNQIIQENQRLQPAHP*YYQ*TF*NQYT*NSIPAIQ
LEDGILLFELHYRGKF*RNDPETATHRE*KPKPIRLN*IK*WHHRIKWDFNPKS*STNKV
FKQ*TPKTRNRKDAEY**IRKCT*HVLDEYSFS*AFCN*HK*NKRW*LFWATIPNFIGFT
FKFGLRVRQSLL*FERHWIRNLH*NESQ*SRSI*RIIGKI*YEFKGNC*PV*KF*RQTVY
F*GRFKERWR*RAFLIEQIAPLRNDPVPFFIYNKFPPRRFNV*VVMVANDLQIYLQVKRL
FFRFVFPGSATQSVLHMDTWNIFTVLNILG*KKVVFCKECFFSVNFTSF***RNLIR*SG
DIEYYVLMI**VGDVTIAYIT*IRSSKRTRPSLDIPFLGSIF*CPDLKEGHI*SFFLLIY
PNLHRQNRYRIRLPSILLTSRLS*LVFPLISS**NIHEG*KLKLVRQ*SSNRKKFVHVSK
DCSYLSPPSMPGQSPHKPIRKAHHSS*RRPKRAKTLLV*PYRQSERYS*RWRHQRMSQLE
LKKR*VEQTYERGSRTQTYILLTKWLIRSLRLPYQTYLPLNPSEVFRWIASRSKWQSMWK
RRAMIILSRLRMKIK*KPSYCRQIMRT*TIMQ*VPQMA*L*PLMKTLL*AVQTWPEAISI
LWQV*GFFLLRAQ*QLEHLCYTICL*YEGTTGYFQSQKAFCL*PNRKRHHQHRYPIMRHP
LRQLFFSRTILVRRLLLERKSVILNNRP*NLG*HTIAITW**RRPRDMRQALQHHQKAWW
SADQLFSSVPSQGGIRVDRERQLGQQLRHNRTSKHQGKYHGLSSRQGRHRRMRCSPTWKT
WSRTHRMSRPSHNHRRGAVPAAR*TCW*ILFLQSVHQARIRLFLGPQDPYRSVSWKPDIV
YSS*VWSPWKLYVL*YHFE*KKQRKQRKMVPTTRRLQSWCV*LGCLTLTGLTHCAVA*WH
RPRQI*ILIFY*RLRNFLPSASCRHRQPF*CR*AD*LTSY**TIFSMHRSTWCCVDQSME
PEQQ*KP*RMIQAVKSLSKKPRTMSQRPFRKKQKSSRLSALTFFRFIFRSPVIIPKEKVK
KSGENKRKR*NF*ICGVTNAKYYSDSHI*LTKENLSKSSSFGRI*KKQSSFGSDMSGQSI
KI*GMPSIYPGSPEDFSSIAAGVFFFCRLPR*PAAKIRYLGYRRQALL*LDIGNCGLQRC
GIRPPSVLTALSAFDSFSSSGSLTK**IPWFTFSLVCSRAMLSWHINESGTTTRVTVCAF
LFAAMKFFRR*A*R*RKKMVG**VG*SGMKVEEAQYSTSKQC*S*AMTCFLRLWRIPTRT
*TWNCPRMMLI*VF*VMVGTRGRPMNR*QTQKDQQA*DPALLNPNQIPVLILILILALQV
VRMILQIRTLKERTKVVTRLKMKTKTKTLHLPVLYYRRTKY*RKLFLNYRKIMKFQKKRS
SLLLVF*SLHLKII*SFTPRCRAKSVF*KRVPFSVSRIEL*SGC*RRCLDPCKTHFIELS
CPIQKKTYSMN*KCVWVRKPL*SPLMPTG*ILSS*SATKVLMRLMGTMKNYLKRNKNFPT
TKKRPFSRK*RNSNGNERKGTTAN*PTIVTMSR*RELGSPRPTVYLNWYRRWA*AVMLRC
NMGTNQETHVKISSVNPVLPLIGMAPPQCQSHSTTNNSFLQIIIPSLNNQTVCLIHHTHL
SLSRLTSSIHLHHLGRRHRPNSPTLFHMVAYLPHTTICRRQHSSRSCQ*PKVNRHFHMAY
LP*IKCKTQCTSNRHLKHLLREMVISNK*WNYIKYFCSNSNSNTSISISISKIQEPRVTI
EIFNNKCYVS*IN*KEARKI*QVS*LNIILLSLPLLDAISACDMIIFLFFFFFPQGDDMK
LSKNLYVNKKVLRGFKYGSLFRRYLYSEYTRRVQ*RFFRSTNDHIVEQYKEKRPF*NFRW
NFW*IIACKKETVGKRHRRSRGRIYRP*NHYRAVALC****HCTHRFRKLSKMAKYHLQR
C*ISGFHSFFTSCAIRLRFCFGI*SYRICRGC*IRYNSDQ*ARRWSWSVRRLRSFR*S*R
MRCYTNLQRSCS*FWVPQIRSEKHKIF*DQSVNAKTKFG*GRLRN*SCR**CR*EIKYPS
RFY**N*QERSRIW*ADIQ*LQYRIYSSCCICFWRFKWFSSRKYRWVCCGFTGRWLYRGI
Y*FFFTVR*NS*SVNLHPNQQTYHTWYDSSSMAAEAL*RV*KIRFNFRERK*GSC*ISRK
YRTVGSRNRFKRRPRL**N*RR*YSNFNKR*NHIFFHASG*NSR*KCWEGNPIGYSKGRC
RMYCHLHCW*FTCYHPSSLCRGLWCDFS*IIISNGKVLCATCQGCIFK*CIRVFQL*FKR
KSGLDCGFYRQ*GNPRLRYIY*NYENYSRS*ARYCTIPPSNRSAFSTCYFYLH*PSLVQ*
IQSLHKERYNWYLGLQKCC*STSSRCVETSFGQNYSYSC***KSCKIVIIVMYSGYNGSS
SIGFTFC*YFKNIRLNH*C*KRLCPSVQKGSST*LS*YFCHHCRFPCSSSHSRISPSNSQ
LRYC*I*SRVSKGSTNHSQAIYHQNETW**ASVYRFYPE**NCYFRDHCHRYFLCKYSK*
FNSEVPCH*FRSYIYRLQR*HQM*FRYFDR**WYSKRFMASIFRRKIRK*RKGLFDGIRY
NGL*GSYRYLKKWR*TKSKYS*CWVRFNFRSASQN*RCARRMDHAYGT*IK*QATVYHCF
*SFLYRRQDSFRDR*RHFICERKISH*NE*FEWSCKLS*WYFAISHVRF*SCS*W*YC*F
EN*NRGSSGNRPFCNICR*YLTKAASCCFASYG*CSKGCLLYIQGRIVTGAPVRYICHKL
HNSCQ*N*NT*SRYIFESCQNNP***LL*NEVNDFRQCALRYFTENELSLLPYCRIEEGQ
HHAQMD*KGIYRQQPK*KIGQI**NIYICMYVCIHQSLP*RTVFL*TITGALRFTSFSII
LRG*DYDVEMVASA*RNSI*LLQRLNSLRYYRLYKFMVIVSYLFIYMKTESKYSNN*FGV
NGAFGLEENIIIPPSMIG**PL*ML*ISWMGNFPSG*GF**SMGPAYIAMFSSSYASFKS
ITGTPPPLCCTFMSFH*SSYCYCRNVIE*KAVELHFETI*TFK*WFEYIENRHVLVLVSS
LPFVMQANFHDRYIYYLFCI*PDFFRLRKLARASRLKKLVVVYTHC*LFTE*KRKRKRYI
YIY*NMHTCILKQK*KQKFSK*DVNVIAALPLSFSLLCYLVFVFS*KFLSLCLLFTLNPV
RVI*LKFLESF*PILDQT*FFVEL*RLQQK*WLVISLP*F*PNQRILRIM**LHRYLPAA
ISFELNRF*LAHFLGLVWTLFLINSWLQ*NFLLLDFLSTKWLYRPKAQFQHKYHPTCFLI
Q*PNRTASKPCQNRSCLLKFQQRNLELLVPLEIFS*LH*TKFHSHQTCFHGTLDMLIEYK
GRYSLGLIP*LYQNLFLLDHSFVK*NSFGRGDSKQKNCLSPVSALYRSSYNIQSSHFYQP
*LMPCRYMN*LLGTIQ*LS*CLRELPMDRFSRT*KYLCVLMRWPIFPLTFHPHCSCPIVL
QITLQLS*KTHQPCRNFREIFCTNYLNRSLTLYQLHWIHHNWQKSTRV*KYQRKRPWM*L
KASFPACLCVL*LVGWIIQLE*Q*RCQYRQTFLSI*T*LAYSSSSPTLVQ*RRH*SHHLE
TIQTNRTSHPQIFLALR*QKLFSVKLLSSLVLIQEP*YSFQQLFSSHPQKHSKPINSSRK
LGLLSILMPNYST**HRHIFYF*RTGYLCPLTLMHIYPFLQR*NLPYWKNLVRHY*KPGR
*EDLMGL*IS*HLQSPFESPLCPFFHLC*SCSFFLVVVVVAIGCNNSRHRWQYL*QQRLP
KWLSCSL**SSSLAIENLDVSCNFTSESCFSFMVSGGVPLNSFKIFSTGRPNTKGGLTPS
YSSYTVILYILN*WQ*NSFFPST*SLNVCF*NDITLLNLMETFEVACTVFLSIKSSLLFL
NS*LNYIIIIYVLWSFFQLRSEKLL*YR*DE*DEHKINFGFCICYCPSLS*F*KYNSIKL
WSARGALHLPEIQRQLSLERKSFAMNVSSSLLVLNKGNK**RMNISGTYLKLYTHLKKKD
PSLRFCSPYHILIQDLWLC*ILCTTCYWNKLSNTIIVQALPSMYSRYSPRKMFLLSKNVW
NP*LMKKCHN*IKYPTYLMSILLMLTNFSTMHRKYRLLSLTMKILRFSASQSQ*MIAIY*
H*KKY*ANTVSIIHPGLI*YRL*KLN*SSILHTKMVIMP*CGDIP*QSYLK*LFLLW*KV
KVLK*RRF*TRNHLIL*IINHVSIKTYIL*KIYYPSRLKVFYKSEIWHSSSLTLKKLM*S
LIA*SPENHCRHLVNKNW*KI*QSTKLPTNTFRIFRTIIQI*YRQF*EPQIN*RNLNQVW
LSRHNVKYVNLKYTQIHPIG*IGSQLLRLILWRPLKKSIYLNSGKIQN*GNLTHIMLNC*
MKSNRVPVIASMLKTVMSNCVMVV*SY*IPVSRIRIWFGQKSIPWILRQMRPIKTKN*AK
YWISSRLIPMGRNNEMSKASLFQWLCIYLFI*QCILLYIASAAFIYSVSIKRITLILSLP
MQNA**FIRP*SSIRTDVEVGLIYCTRPVLQHI**FI*GIFVVIRCQGISVSCIYIIIEG
AAVFITMQYIQ*FMRTVLI*NILIPIIKRLGL*VV**LC*ILI*FLIICSVVAFH*R*HF
T*RSTLSARVPGRVVLFQNIQQSFS*IFLRV*VNIIGLFWCCNVFFLLF*HSQKFACIRI
VYT*S*CIFFAILRF*HRIPLQHHHDFFIPT*MLRFW*LLI*RYSRGNWVS*HL**IF**
RHIGA*IKSFFIIRQTGKGFTSF*YFNFGYLFYSICC***PDSFVYRFITFSGHISMRHF
TVLEIVLF*NILAN*FGVVLSLFQFFQFFSIFFVRTAFEDFICITITNVNFLTIFILHSY
**ILFTLSRG*RFTRPPFYTIRFCRSVQVCFACVVPWFFLLTSSAVFFAWHNVHPNIYIQ
*ISFISSCLHLFI*TTLEIFIFCILYTRYGVIW*KGSIWFGSVYLLR*CWFFQQI*QSLR
V*MSSFIIIVLLD*IQVRSSL*DFKLWLFA*LHVAVRLFRI*YI*QLPRGGAAVTRVPR*
RSRRQGKRLRYCWSRKVMHVWNTKSHRIRRSIKIRGDRSWNRVSAITIVS*W*HKWERCK
RLAIHCRKQLRI*HEYVSHWHSRWYNILIVSKRFRKRWKY*RLLLRRKR*LLILLLVVFS
*LLFQMLKLLARGYLSVGDRIIITVSLHCSM*HIQQLSTGINLLLLSDTQQQFQLFFRIG
FQLIFIFYLPLMP*PH**GSHHGINQIILDI*FVHCFRNFLKIEPFYLINFISNLRFKIE
DF*NTRYQKYFVIFTLNISFNELVVVNIVRQIETNFFFHFSNATIYVIFIFRYLPPWE*P
RIRFSTLYQ*NFTQVLVKYGSAPHRYTFLILGELLECLIHSYVPFPNQRT*FYDQLSK*F
NL*GG*SWIHQFDEIRVKP*GFFKMK*LSLDTR*IFIRTIYNKTY**VL*NSINRSNVLQ
CVS*RQ*HCLMRRYFYFFQIQSNII*TIDTK*A*GGLNNCGILHKDSIFVFPGYFAIIQL
SSDVKFVLSDVSIFPQGNKIQ*LSLYTQQYYPTLLSAQWKSPYHSFHWADEVSRRIEAVV
PFPGEPAVGPRFG*ILYCVLILS*VLLMFSLGNPRLINHSFIPASIQIMTFLLQCQPYDD
YL*ALNIVCRDSYL*LDNKMRRIDDPYYYFSTLATDLTHLLESI*VTVKYTVLLLMLFVP
YFSFLVLCYST*E*RLLF*TKQSSKST*KN*ENG*GQFG*RQITGGC**GAFL*TI*YYS
GRYSYQGCSRVHCSFTQNFQQQEKTIIGKQTSCSEEIRLGLLSSGFPA*NCKY*K*SHLA
RSNFGTGVN**VNGNHRASIEKYADQRFECSCEHLYD*F*RFSFTYLEQHGLRSS*SLRR
DQKSNRF*HTKKIVQIEWKCGQLAHYYRETPWLAHGGKAPLCR**TNQRFHL*FWFIFLP
*CQRINQIGQRSLLLFAKDGAPLGS*TMERRLLCSSRLHWDPKGYNQSYCVD*NFACCFP
NGRDHLSIKTTF*WVELRTLGLYFLYNQEIKK*S*SHFAQ*KSSDYDFPIHGCIREKINQ
YLSSEGCSCHGWYGCANPYQRRPGSQ*KGHD*SP***D*RADKWT*WVMGCTPSTGPYL*
*SFH*YGNTKPNLFHS*KRCNGC*SAGNQNSKW*DYYRGNCTKLGYRVAVHGSLAQRLWM
CAHQQLDGRRRHC*SVSLSIVSMGETRCYSKGHGRKGHPRINRKDSKRTSGKTV*GKSIG
*QEQIRAGR*VFLARNQRREIQ*IFDYIVVRRNCVH*GDAH*FEQIVISLAPVYTYIKIY
SCLYDYVSESKNLSLYCFVS*LAMNHLIMIPFFVLARLMYHGRRRRHQPLLWNFKHNT**
LQTWAYILI*KEVEKV*QRIVYV*SFQQRIYRGNVHAYPC*YPCSHCTNFIDDVQLFIRI
KCQHH*Q*WHKPKEQSQWYSIQ*AGSSGVGYQFVFEYLRN*AK*PDSFFFCGS*SASIRH
NPI*LTYECGHGKYRYRSATAGTTSASSYTNASVGPVPRSSQLSTPHLHISHCPYNHRPP
AIICA*FRRQQCW*RSRVFESAAA*RY*QYHNLDNFHGASGYNEKYSRWCRWIYYC*QQS
GNV*EFTSLDICCKPAKWDRNFTFGFTCNKCRGVKQYVQCR*GHFEAKER*AWSF*YKTN
PIY**FVHDKSRFIL*TDYKKGWPWIPIGYWPLY*ACSRCNF*NT*TISSSCI*IQSCFK
DTWLF*S*LSR*LVYKGCEII*WNFLKSPKALTRFLFIERYPSS*W*YFTVRNGF*RWHG
RNLSLCKDED*AK*IMETKGKFVQQRSFTAFAEFTKINYRY*RRRLFDLPM*DQTVSSNF
HITMRT*LAFPLCKKIGHALISAICLPQL*IKL*FGGLL*K**RGR*K*CGK*R*STGGS
T*RLNGNFKGC**PSLRSKKIHSLKNKEKPPNSTSRTLILF*LFS*YLYICAVYIFDLLF
SGIQYLHRWQSILLSHIKLKKK*RTRLILG*FAKLTY*S**DFLSLLFAQTILIYFMPTF
NYFPFLSLVRNFGQISLPIAP*CRLLHHFLRANDACLHILQRFCIVCHISVT*N*TRHAF
QKLGTQETSLIFHITPIYTFFRPMMS**P*SL*SPS*TRPNAFPP*SKFVMPFYLRR*PS
LIMVAAIPIITIAIVAIVAITTAWR**SLNVVF*Q*FFMP*FNKHHAIHNIDILGGKYSC
K*PAKVVSYCSEGTFNFCIFDQCVP*RFRNHRNRDWGGRRIAQPVPWSIV*TISLNFV*M
I*FLNPGGRKVTSIITSVFKQDDRLLLIFRQICVVFLIKYVTITSYMQLIGFSGIYVMER
LVRGRLNGYW*FVSQSVGIQCR*KCIQGE*SEEY*N*KLNSIPEPNGYPFCQCMFVLDQL
RAVGGGWRPRAILASVPVFGTICMVFVESTNISIINSAFLQWLIY*VVVKQEIPI*YCPN
KK*KRSPQICKRAHKADSLPSVFN*IGQC*IEQRQNTESYI*AVI*S*VQSQLIKPEIER
ISYDRDEY*SQVVKTCVPVTESEKNIDIEKEI*NQSGD*PDGVN*N*DI*YPFGVMNKDS
ITFANLKETIFDEPIGFNVTTFINCWAIRGSCTKGPVVVVQQRLRFWVFTIYICSFHSRP
CRIII*TISLHDLFALMPTVLSSMAFLSFPPYRI*QGI*LLVFLSSL*TARWLKLGVRIA
LQGID*RTLYMHSHFKTC*EHAIKVDQYDC*FDNFYIT*AYTYQKNVLYRYIF*FLKHNL
LLFWDSSFSLNYVFWAEI*KKTEKNGTQESLFKKTQQYHRLF*VPTT**TLF**SYILSL
LYSFIGVNHIYFNPGNGKRNK**KYSPAMSWKKKKFQKKTILMLRYKVTNWGKAINPKSE
KLNFT*STRQMTEDIEQKKTATEVTPQEPKHIQEEEEQDVDMTGDEEQEEEPDREKIKLL
TQATSEDGTSASFQIVEEDHTLGNALRYVIMKNPDVEFCGYSIPHPSENLLNIRIQTYGE
TTAVDALQKGLKDLMDLCDVVESKFTEKIKSM*MLRIDSKTLCHSEISNNYAHHASIDTA
*FVYPVYSRAI*NLCII*PDKNTPSYKVLIMLRIRNSFLKAYSVLND*KIYFFFYFFFFF
FFFFLRRCSSQKIFPSVYLSYKKTVLRSNNLYFSVSHSNYFLVNNL*QN*ALLRQI*SKY
DLRW*RSAI*QD*LQV*RWRLPRWKKL**KLLQ*QTTRR*LPWWFRWSFQLQPTPGIDQT
KLG*RITQIANFRKEFLC*TRKCSRQIGQ*DCSVQKGK*NDYFRTRYSKANHHFR*SWFP
RLRFE*SEG*RI*QTNWHSMSGLANGFIW*GHGWYCCHWFR*DFVLLFTRYCSYQRSTII
GSRRWTNCFGFGSN*RIGCSNSNRMFQVWS*FQNQKYLCLRWCSKKSTNQRFISWL*NCY
CYSRSTN*YARDW*D*FEESHLPGS**S**NVRYGF*TSNQKDC*SNQT**TNLDVVCHL
AKGGEATSR*LLE*SNSSSSWFSRTICLP*YYSDRRSCF*FRKERSFEQVLRNSLSRQRI
QDINLCFYEKNVR*YHQVSKRRWMARLGYSW*QRPKRT*LGSTRV*KR*IPNYGCY*CGR
QRYRYVKIFSIFLLILFFFVTPNDITAIS*WLLMTLMTL*QP**YRRETFFLFFFFFFFF
FFSFFLFFFFEPFRI*TLCESILDGEYRKLNFNSNDF*CITTEN*YWEDEKN*L*LVVLR
DGKL*TRRSVFVFMICTSCQKKFRFLTSAQINKELAFQLISRTHTYASLIVVFFNAWHLY
KGRLFYWKNNSIFYFEMPSSFLTIVILILCSLCIL*LY*DTVASQVRIIKKC**KWKITK
*KDFNHIQKSFTLFSFF*VLAFIQFE*GFWSIDD*IFRIL**KYNF**SSSQGEI*DNVG
SPNMNLWGA*K*SSYTE*RTKLLTVCFVNVCLLLYFFRCQRYQLRYQLRYAR*H*RLCSQ
NR*NW*SRCYWYCYIFLHRTKQRFRC*INLYHERS*SKYSSRIIEIRQEILWWRSPKIRW
WSWWSWWLWP*RWLRWWPWWLRR*QAERWWLG*QRSFKLLKSK*FNSFISINNNYIS*LH
LISSMHDKILFAVYYIFNILKLFVTLFL*YS*VFG*TVATGLKLFRITLSVP*NNRTDTF
LCSRTTLGPMLNE*FSKKQ*TYKEVVH*RLWVILE*AKCTTTRLIVLK*EQSFICLFFFY
LRR*FLAIHKDKYIHINL**FYLPGRFYDTVTYFYAI**HKLML*DINLALIACK*II**
TETKNSIEFGEECGLFWKKNYSFNK**ATPSIKMANMTTNVPLPLLWFSEVDTFSTETRS
LVLSTSPMYKPFSSLNASSE*PISTKLSVASCPPKSIIISSPPGCSSLN*ETS*TLSSMI
IQKFSGPLCSATSW*L*TLGMIV*YFML*LIDFLYYEENENRI*ILTRKPERKFLRKFQK
LLVLYIVIGKRTIYIFVIY*YNNNASQISLFGHECDKNFLVMLTSLTISISYSFLFCSYC
SFSGPLNFSSGNSRLLPAP*FWSLNLRKSNHVNIIEYGQTELYCWN**YKWFPKFAISPI
LSYKTLFSGWMRSDKSPFEFDT*LG*FFYPFFMFLLHVIL*LFYWFGDTFLY*NSLLVFV
QFLDFSSFW*YTHL**MTHQQVIVHRFLGDHCILFINEF*EAIMSGISSFLITC*SHFF*
ITELSKIFT*FLFVEPMWQSTHINNPRILFKCLFIFRLFFISLLLRIQSFNLVCTALLII
RSG*TFNFIFIFFVFFI*TARRCF*SQLFFLLYRFFFGGLFGYCFLGGSFAC*LYHIDLF
PLLFYL*NLTL*KR*LMKLKVMVIVFKLSDEMRCDALLHFFLWRKIFHSEKKQAKSGG*P
HTSLLCRL**GC*SCNSCYAH*KGFSRIMSFQR*HKTRKVSVLLPRQLIFQSLNLEF*SL
GILKDTVNSINLH*TLTYVYIYIYSHSFIMK*KSNAEVYNEKYRIQDSL*FSLHF*FSAL
SCSSRFDISV*TSLKGIHKRPIHFFPIS*KGGVAIHCKFPLSLFKWYTFIFSFHQLKFIN
STTSISYKGAFVINGLFGTGEFQQVHTKSGFSGCVGNYHNGLYIWKFSLHSVNKDRPEFM
APLKNIFFCFTLITRNNTRFPVWRDHAWKKLTHNFMSSRLRDNGSIRLIPFSYTTIDI*W
NL*SLHCGFTSF*TAVKWGGENHFWFDI*FRDIVRQFMCLFNTVFRKRDIVINTGGRWWI
WSLW*PV*PVTMSGNVYIFDSHNL*HYFNLLYN*LNVLHIERNCFTSRIVFKAFL*ISKY
PLFG*RDDASAPLIIFPEFRCLLCATEQVAFES*RDRYITCDHLFTASQRKRDGSDNKQK
DKNSLREQTNNIWQYG*KDG*R*TTKCSCRTYSFMDNFCQGPTK*RYIVLYQESRF*TS*
HLPKPCEIHRSASV*TD*NRVG*I*YKY*GLFCRRGQ*KSVEFLP*ITTSSLC*SCTEFR
QWK*AEYNRP***RCRS*FCVF**NCIQ*AK*RVFQNFNEPTRKFVTFKQN**LCILQAI
RTGRN*QNRDRHRKG*QGN*RIEAETGKLGKTRSH*RKLGSLHPEQRYFHNSHSNTDHGL
KGRRSQNRNVCRVI*TSKQQL*YIFYKCVILVTQFNWGRKASMDERLASLVQGSSQELLV
*TFSCKGVPLQILNSTGKLLLSVLERC*AC*QQHLNNAVF*QLVASQVLWRPLLAQDLL*
WTHLNFW*M*RFRPGQYCSSF**EDKVEEQFSHYLWSL*HAVILKNFSVKRLA*IKIKRA
LAAVVWVYCVSLRQEDCSHLYAAIR*QWKSLW*GKEV*KMVPYCASR*EEAEEAH*AYFY
RVIRY*VLQGQQQTVGDWDQKVEAKRTRKYHLGQLVLCPLIERLHLRVYFPFVFPFLHEK
VRQDL*LVLRDAYSYILHTASQLG*ASLFRQQISHLPYMQHKLVYDRLFLKVRPNMPMDA
GFHLYI*FYQSKTEFSPFQKYHNYLCHNHIYRSDGIGGSVL*SPEIPLLHLFLESTDHIE
AIYQYSHPFEPLILF*LHHLSKLSCS*GHPTKTTNHGVELSLILERLCSCRYCCSHCDVR
QCYSHLLINVY*RNRMKLPHNRI*WLLHLCFQ*YHQTQSFW*THLPLLCYRLYLILQKIV
SKERTSVPL*VKDIFLRIDSNSQ*P*FPKKNFSYNLHSR*TLRSTL*LPATLTQRHQV*I
YRRLEITILTNLLFESFR*H*MYRQTNLC*NEW*IFPLTLTAFH*RIRRLDHKVQQLAGA
VVCPKVCQYFAVFLYLQNC*CTFY*RTSSHQKGRQKKTFYLSLNRTISEHLSQCKFVISD
LRCRPIKHSPFAQIHYRR*NYWVLPIGSLPKIV*KRPVKSSVGSNLFYLNNPSNWF*RHR
LVRILIALLLHRMKSNRRPKLCFLF*G*SYLQLQTHLAKFLYGNQSLLGTHLYRFSFSQN
FSTVPCIASIIEFLKI**TAG*LYELAHTS*IVL*NVHQTWAVLLQQIW*FESLD*SKMY
PAPKKLEGFLLSA*KHNNTEKST*SFLFQQNLRHGHHHLYHVH*TLCLLFSNFAWK*W*V
LLSTY*YS*KLFQQTLGLRS*GILVDPIVLWPLHLVCLCM**FRP*ETSST*TPGQNHQN
SKSVP*IHVSAMYKLNQNRCCNKKIHLIIAFLVHDMDAWELVLEHSNS*RKKNVAMI*KN
VWKY*EASLLQNLHH**QSDNRMNRCP*NPI*NYLSKKNPQHIFC*PFCLGSAGPP*IYL
LWLL*T*GLQFL*DQ*NRIFHG*IVF*NHYHLIQLSEPIPRHM*ICESSYCLLA*IPVHV
FLKLLLSF*FAVSIGVFS*LLSICF*FCCLCVAFVTNSANKNMLRLYEASTYCPLCLVFQ
LNLS**LQVCFNFVTNRQTSFGSPHTYLVQEYTKKRKTSTSPRYGKKDIKT*F*FRHPCF
**LYG*KKRKGSK*ISIEINRSE*VLKYRKVLMQSQMPQHSYLRPRPKMEWTHHQNG*YC
*WWQRWLSLKNHRHLRRHLHPICRPFRCRHYAYTIDGCKKQLA*KNQNLENALCSLLRQI
SRSTSLIGRRPKKRLDHYLYLQYRRSGRLL*LDQ*TLYVQCRIFQHYN*LN**LGTVRHC
SCKPL*ITWKSHLILVLYPRSQHGLERR*KIRFACFLVDPNPKISK*PKRHHLYQTES*L
**QLRNHGQCPLDPMASMGFSIEFHLEHASCFVS*NPS*WRLGENRKRHKRPSHRRMVLF
AILGSYYNAQPHLGQRSSQRNPN*EKHLGYTYS*QQ*PSPHYLYVHHYQRDILLHGRHLQ
AYLTLWRRHRNHGHCDNV*RCKPSHAQ*YG*RSIQSDQHKHLERQLLR*QVS*K*LDFPR
*VPKPS*QLRKFLQQIHLEYH*NIRGKTHRTNEWLVGKGHP*LVS*LVWWPLLPWK*LPL
*TY*KQFHGTYHLLPSKYV**PF*HLLMLPPFS*SSVL*IGQDIEY*HRLGRFLQHI**S
RNLFEMQRGRKPRFL*TQY*PACESILSFVPLTWDPAEIGYHLSNLLITNEEPS*SGYPA
TFY*IALER*MACTWRKGP*AYFYRLASLEE*LLRLWRPHAQQEQ*YSL*P*LFLVFL*G
KSLQ*TSSVRILFFLQKIPFERTESLTRKFLFTGQVEK*PINDYGKNVERGERLTQEEKT
SNLRDSIAHISHAPVLIYI*IYIHTYMHAHTCTRMTVTGRYCTIFSAKYDTHSTQLF*GL
LSFPARR*SDD*PTTVSEPVPLR*QSWGWS*QPSGSVKAENRSISSIAGHTDAYIRLIVV
EKYRIFYFIYRGFFEHFSAMAFSPFPFNHVRG*HPAHSWCLVAHAIVCHRATQAYCLNFL
SSFNLNPPNLDVAVACNNVYPCLHASVPGETVCLNAHHFIY*STPEGLLACPSTV*TDSR
Q*SALLISTFIPFFPL*TMKQEQSHEGDSYSTEFINLFGKDTATHPSSNNGANNNGMGST
NSLDQFVATASSSSSLVTSSENRRPLIGDVTNRGNTNLYDHAVTPEILLEQLAYVDNFIP
SLDNEFSNVDWNVNTTHNNANNNGADTFSSINANPFDLDEQLAIELSAFADDSFIFPDED
KPSNNNNNSNNGNDDHSNHDVLHEDPSTNNRQRNPHFLTQRRNTFLTSQYDQSKSRFSSK
NKRNGNNGETNNFGDNMQNNHPFEPNFMGSPSQFPADATNMTSIDHGGFTNVDITSTENN
TTGDNGVDALSNLLHRTTHTPNRSSPLSNVTSAQNSSSQQRKHSESKVDSNSDNNSSNKA
PNITVPDYSIIPTSVLVTLLPRVNVPNGAYNSLISAGFDNDQIDAIAAIMAYHHQKKIRE
NNSNNNKNINTNDSQEAPILKNINELLSVLIPPSPAETAAPTTLSTSPSFNEHGVVAEAS
FLSSILELGIKHPKSNNIHNQRQPSRNDHKISRESDGNNGNDNVHHNNAVIKSSTTRGDE
IAKIRSEPTLNASSSDHKENSLKRSHSGDLKNKKVPVDRKYSDNEDDEYDDADLHGFEKK
QLIKKELGDDDEDLLIQSKKSHQKKKLKEKELESSIHELTEIAASLQKRIHTLETENKLL
KNLVLSSGETEGIKKAESLKKQIFEKVQKE*NNRLYSLIIYIYIYTCIFLKEI*LFSCTA
CNLYSSFITHLFKRVKIFLLAYK*NASRVSNFTELNSLLIG*YISSWSRQRTHTNSDSRE
KKLSSLCY*KPNSIKA*NKQWKMSSKSEKLEKLRKLQAARNGTSIDDYEGDESDGDRIYD
EIDEKEYRARKRQELLHDDFVVDDDGVGYVDRGVEEDWREVDNSSSDEDTGNLASKDSKR
KKNIKREKDHQITDMLRTQHSKSTLLAHAKKSQKKSIPIDNFDDILGEFESGEVEKPNIL
LPSKLRENLNSSPTSEFKSSIKRVNGNDESSHDAGISKKVKIDPDSSTDKYLEIESSPLK
LQSRKLRYANDVQDLLDDVENSPVVATKRQNVLQDTLLANPPSAQSLADEEDDEDSDEDI
ILKRRTMRSVTTTRRVNIDSRSNPSTSPFVTAPGTPIGIKGLTPSKSLQSNTDVATLAVN
VKKEDVVDPETDTFQMFWLDYCEVNNTLILFGKVKLKDDNCVSAMVQINGLCRELFFLPR
EGKTPTDIHEEIIPLLMDKYGLDNIRAKPQKMKYSFELPDIPSESDYLKVLLPYQTPKSS
RDTIPSDLSSDTFYHVFGGNSNIFESFVIQNRIMGPCWLDIKGADFNSIRNASHCAVEVS
VDKPQNITPTTTKTMPNLRCLSLSIQTLMNPKENKQEIVSITLSAYRNISLDSPIPENIK
PDDLCTLVRPPQSTSFPLGLAALAKQKLPGRVRLFNNEKAMLSCFCAMLKVEDPDVIIGH
RLQNVYLDVLAHRMHDLNIPTFSSIGRRLRRTWPEKFGRGNSNMNHFFISDICSGRLICD
IANEMGQSLTPKCQSWDLSEMYQVTCEKEHKPLDIDYQNPQYQNDVNSMTMALQENITNC
MISAEVSYRIQLLTLTKQLTNLAGNAWAQTLGGTRAGRNEYILLHEFSRNGFIVPDKEGN
RSRAQKQRQNEENADAPVNSKKAKYQGGLVFEPEKGLHKNYVLVMDFNSLYPSIIQEFNI
CFTTVDRNKEDIDELPSVPPSEVDQGVLPRLLANLVDRRREVKKVMKTETDPHKRVQCDI
RQQALKLTANSMYGCLGYVNSRFYAKPLAMLVTNKGREILMNTRQLAESMNLLVVYGDTD
SVMIDTGCDNYADAIKIGLGFKRLVNERYRLLEIDIDNVFKKLLLHAKKKYAALTVNLDK
NGNGTTVLEVKGLDMKRREFCPLSRDVSIHVLNTILSDKDPEEALQEVYDYLEDIRIKVE
TNNIRIDKYKINMKLSKDPKAYPGGKNMPAVQVALRMRKAGRVVKAGSVITFVITKQDEI
DNAADTPALSVAERAHALNEVMIKSNNLIPDPQYYLEKQIFAPVERLLERIDSFNVVRLS
EALGLDSKKYFRREGGNNNGEDINNLQPLETTITDVERFKDTVTLELSCPSCDKRFPFGG
IVSSNYYRVSYNGLQCKHCEQLFTPLQLTSQIEHSIRAHISLYYAGWLQCDDSTCGIVTR
QVSVFGKRCLNDGCTGVMRYKYSDKQLYNQLLYFDSLFDCEKNKKQELKPIYLPDDLDYP
KEQLTESSIKALTEQNRELMETGRSVVQKYLNDCGRRYVDMTSIFDFMLN*VSILYVLCD
LMNILYSKKRIQLYIRILLDT*CTDIGRSARKLLLLKVFSDILRMFFRLW*SVLTCIIL*
*THALRFALSARSDKRTASSMK*NA*IL*STVISQFDKSNTHNIVGYHLP*SALAFEVT*
HF*PSDSLGSKALIIPPLKHISTSFIIWNQHNNILEHIINGH*QWRW*APWDPKKRKFKA
SFQ*YENSQKGSINSSQFKPIL**EVFYVYLNAEGYMSKR*F*SICGYVFSQFSDSGGSP
QR*DYKQCTA*LLEQ*QKKFRLSWK*SNP*G*SD*EFFSKYHSCSKC****R*D*PE*RW
RRHNA*YLQVG*SRGS*TAQTPSVHGKCNT*N*APY*IVISKWFKCPRWLQKGIYCQQKK
ARTSIK*FR*LRLHFA*KRFD*PVISIF*PRYR*GPLFNKKLFGISIRVWTFCW*ILRG*
FYP**LKHDDTRRR*KECIAVSA*PYESITFSQRYDFDKEGFFDIA*IFHWNWRFIFT*C
LS*WWFVFLSKYAGLFWNLFILVLLHIGAGQIFMRCILLW*YWFKTVWTLDENNNSFLPS
NNSSWILWSLYDIYCKKFTSFS**RIPCGRPTFILPDGLSNDHFYSTFVY*KHFEIVTTI
FTSKFFHHGWFSHCHYFYSQKVVF*PDGDPSNGCRLWLKCRPLDAVYRDGNICFRRNRVN
YSCSRLNEKS*KISFSTCFGDSNGNHTFHFHSYIGIFGIRLKCSNGYTVELTSK*HFCKL
NPAVLFHRNYVVHTFAVVSSY*NY*K*VFSKVH*NICQAR*SNNKSRITS*FRKAELEN*
MAEELYSFYNRNHCCINCLLWV**FRQVRFSYRIPRLYSFGIYIPIDAAFTGQ*PSRD*R
GILEIQTNVRYHFNFLRYCKHALYVLPEYIRCLDDICCCFIKNLFGIEEHYFAIVAIDSL
QLQTSS*FTLYKQGPPGHSIIRTKLCSR*KTLKALPLYCYLMFHLRLVGGEHV*IYTISY
LLSSSRLPEFYFFFQSANKLDPITPLNAPTT*ELLNISRSRVGLMTM**FHN*SKQSKTE
AAHHLPIQLPKW*IFMMTWMSRNHTVNSH*YPLCFKIHQSYQSELYLPGMKSLSQCT*PN
GYGNIETHLPVN*IVMRRGGNPR*PTLGSRSNMLSIIRERIFSMLILKINILWSRGH**R
*VPFLLEA*L*TGLIGELKG*YLVTNLVSSRNYVRHCHLGYCYHGYWQQLHSSIGLHRHH
RIWSMPLKMIYCQLISSSHITILGNEFMRKDMLPRNVI*NVKSIRHYKKI*GMQGNSFMK
SWSKHDIKRISFFVHYHVHSKYVHI*IG*LIFYKITH*INFIYFEFHFV*SLEVGSRMGR
AS*NISNFR*MVIKLSAFSLSFAFFFSCLYSKAVSNQLGALFLSIFTKLVSKASISNSTR
ILPPLLPVKRLYSSDTLAKFQPIILLRHPMTVPVLCLPIPQHTSKG*FS*VTIVCSTLII
ECSVRPSHGLSSSPASGLMAANCKFIL*VSQNSRRVS*GSSLDSHIIVFSFRFSKKGKFT
GEG*PDL*RYLSTGQKFKGGTIRSCGACDTKTFSRPDSVSSLIYI*SSSSSSSSSSSSTS
SSGTDTFSSVRRDSSSGTSSYSPTLDVILRGKRSLLFQVEHLFLVKMDVIDDSLQCPILC
YSDVVCFFLYPATI*YCPKFPMLTRMKRK*QMAISNIKTVTFLFTFVYIYKCVYSFQLYR
VLFVLAFLQLFPFY*LIIQQPPDPLLEASLVLPPGAACCFLACLAFET*PALLLLFTRLL
TVLAL*ALA*PAWPVELSILVRSVCVLPFVAWLPANPVLLSMLAFLAFTTVVLLFTFLPL
AALLIFLWPPLFLGTELAPLPFVS*EVCLELSFSVKVLLYLPPSSLTKRARV*NASSTLI
ACLADVSKKGAFICFAMFNPSW*ETCFSFSKSDLLPTTTIGT*SVSLTLNIC***VISSS
RDDLDVIE*TNRNPSPLRMYCSLIAEYSSCPAVSKMSNIDTSSSITTCFLYESSIVGSYS
STKCDWVNCMVKADLPTPPPPTTTSLYSLMFDLFKGIFFSVYLLSIRKRLTWFFYP*FSR
IFLLK*FSPS*LI*CRRVR*RVDE*NGKKTKAGLRYA*NERF*AIREDNG*NLRCWGTIN
VYPDFR*KCLLM*TLFPVFPDPLIPALFRLCCHVPFNF*RPA*LHRPKCHAPGRDMAQGR
GQGQRGQAGTSKGGEVNEKVLLNKKPKRLATPPTVRRLD*AAGAATP*QVISSFITFYRA
VITIDLNILSRPVGPKYLADPLIRPRPLKR*DIYICS*DIYICIYSVFSRYFLKAIFARE
LFHSFFLQSSQYHLPLGRVSSPIHGKWNHSSSQSAPSHPTISPYATWLQ*Q*SGSP*SLV
FGLDILLLLLFPTLLTPLDAVDVPILPLLTAVAVLIVLGETAVVATLLLRFLVSGSALLV
LAALALFLEFVLLPVWSWLSCLLPP*FASFFESSCWCVLAE*CSPCLLLAAMASLLDSLF
SACDDLLFDLLSIFSISS*WRCIAGWLSTPSLKPLGISVFLIATSYANSNRDVNLSRLSS
IMDETCIFSSSDGISSS*ILLILLSSLTCVW*SLLKSFFKNLSILSFKFGIECTHFASIS
CSNVKYLEVASGNSSSTSVMSFNPGNRFAGELICTYFRL*TWLLFVILQDYKLFSFRVRP
VVNA*LFSLGSFFVFSLALSFFFMCMHSFLHIFFSRAFLTFFGNRLRIVNYNCKYAISSI
*NTEKKVCHSQLDVPQLFQVYVIWAFDL*NILK*NSDYTKLKHVTRHVKVRVEVSR*CMD
NVLGEEADLITHTWDHLRFQMVMLMLTCSTPFSFPSDK*SAYQCERTNGC*WTYRCLAIN
NAFSSTNKWLFGRAV*GA*FKKYLDRS*LWEYSGIVRCKSSNLLATIIFFPFYLIAARTW
EINPICIPKCQNTN*SISILTDTKYI*VYIHNYFTRIKKAHFLETSFCILITMFLFLLFF
LNIIFFKYDK**E**LSHYLVGLAWNFKNNLFASQLVVDSLERFQLVVDLLNILGV*QNL
LDLVTTNQISNSFTDNFSWENHVFQNLVVNSSQSSGSWSLLDLSRCSRWFWQDSSFSQEN
NMTVREFLFQFTGQFGLDLMVCRQSWNWDKKD*CFLTTGDINLNNKNQAALK*S**LNWF
IHNKKGFVILLLGVRSFSRASILFIDIGTDQGGLYSSKAHRNVHGIDSSRNYYFSRTHEN
FIQILLKITLF*KNYCKEPL*KKSQCCCFQII*LLTYFSDRFDLQWSQVSL*FWRGAF*I
DEGLGDL*FQLTWSLG*DLGLDRGHWSVMCLVFSVLVSLLFVYTKSNNTYFNHNQ*HLVF
PPPRIMNA**AHSSLKPGWKPKLCGT*LNCIW*VTKQRLAGLNHILPGRSLFPKY*N*AK
Q*CTDLKRYGWRP*KIDFFFFFVIFCAFRNYYYAE*QVVVVSNCYFHAFNLINISL**KV
VESLVVSISRCFLLVLYKNGEC*F*PTLKQ*LGVVIIFCLMD*N*RFICTFRK*DTKNGK
LTTISGYCSIKKNETHSIWIGAVVSGGVKLAVKYIRVVIVGKFQLIAITNSSILSSCQLT
HPAFTNRSHHRTPKIGMTHCLKMTSVTAAFQNPG*RLPIFNLPKVAPNNINPNGTHAAPT
*PVKSMKKLNGGALSGAWLM*GVLAVVTNKALTHGINATVRAMITAIEHGLKQFFRKNTS
NGVNENFLIHCGNDSPDVSISFLLTVASDVKILVRLAVFIVCKVEFELIECTSFISAPRK
LEFLL**PYWSTLEYSLIRWCIF*EGNARISMERIGSNAAIDIFFGHFSSKQFSSRSVVV
L*ALGWLAVLRALIVSMLLS*LSDVL*ECIVEADDWLSNGFEPRVACDSSL*VHAIVFLA
FT*TGFVIFEFEEVSGSDRGAILFVDLLEIGGTSAFSPFVPIASVRLSRAVYLLLKSCCS
FEKKRSLVSVLVVFALTAGCVFVVSETLTALSSSLYSKSLSISRNPPKLKMQIRNIVRNI
MTLATPLLPSSSENTSPWSIDCKYAIGKSLIFGNIPPARIPPYHCLGTGRNSLTTYAKKN
PEPNIRRADRQIIPTDLMSLSSILATILLNDREGSKTVSTISEIILVASTVRIPILAIRK
PTPIIK*ILIIGLTDTHIA*PRVMCTI**KFEVSIPFSV*FYNFSKKIALTLISHCLYLF
*R*FVTICHKSVL*LRK**ELNSFIQKAIYPNMAQKGNLYAQNEHKSSGRTLCS*SKG*K
SSSRKIL*PSRKPQPQRVTWSRK***GRGLTFQTRLPTILGQIKH*NRVATPLRLACSL*
LVCVSFLGFLCPRDIKYTKLLYYS*SRAKI*HH*GIYIANSGLHKAFNKQCHMFL*LCRF
VGYKEFV**SPSFLGTINTDKDIETWL*VPSKGEKIALEKE*KDE*SRLR*KLFLYCCY*
RSYFWRPTNG*ETTVYESHKNHKGCLYS*PDVIHFSKDNGWHQEHYEFLRRL**LAYGIA
T*YHDNIFSNVYHN*FG*P*RFECASERF*NYCQMCCFLSRKSYKQEK*VVAFSL*TIS*
NWNGGGRCCTCCSPSSRRGFWRFKRLPIKYRKFFVFKERK*VFTYGHPRGRCSE*ENSRI
PVQKSS*YSSGG*PIAQR*AQRGYGFLFWYHGLLW*FTNQGRNRFFTVQD*YYIRYPYRR
PCRSHI*NISGQLCLALRYWFNQ*Y*RHHQAYWRYG*QEIDVS*CFHP*CSIVGNRWCSS
LVQNFT*CRRR*FLLCF*FTHPNFYSFETIYLRQFSSGSNFFETILW*FLFHYHDFKCE*
KNSADCKYLKGFSQKKIYFGR*FW*T*LRSVYHYGFTISEPDSGYLYKMLL*FHE*CPIA
**RSYE*SEQYHRITTTAHANDQVYRTYQEKTTTTSHSFHSKAIVDRRANRKYKNVTP**
R*EQC*KSCPTTVAEQTVT*LRR*YLLCTILTK*LWHVWCFHG*KSR*MEEKSNGLNSKI
EQSRHHIDVLFGSGIKFGRQYSQN*GEVFKLNTLLFIYIGREFKNCIH*SDLMNWSHFQR
FRVMLHPFHQIGKLKKRL*KG*M*ICKFYEVKSKENLRLPIKYTLTKYPKLSLSFHSN*L
SRTPW*PTIP*NVNFRGGRGP*TAKPLPM*IK*IRRIY*ILSYYKSGKAF*MHVY*PNRV
RFKLFITFFQHRS*VEWINIQQLFQH*LSK*SYSENLLSGSPQ*SSGLYLTILKRAKNLL
LVPHF*QRELQGMARSLNLKYGIRQARRDLLL*RLCTTEMLKLLW*FLMLLMKGLFIRLK
TGSKNYTRR*DMISLLPWWGTKWIC*IMMTRMKIGL*KHQLYKISVKERTSYISKQALRL
VRIFTRYFKH*AKKYHVLNKIHDKALLMIAQLPIINESISNQRL*KVLGRLGVVTAKLQA
KQQQTRHIQRLSEACH*KEQFVTTAGRIVLEIFNYFCKTSTFLFHFH*PQEIHFF*GREF
SSPDRESQGLYVL*FVIYTKSATVILVYQRQKLVRI*KLIRGEHISVILTMDENEFDNQR
ENKAVARVIISFLKYEEYALKEIYNLRVKKWASISDRQKDMVPNYTKYLANLKAAIIENG
KFFRSVAEYALQSISFEPGEIVQPNDLDMSKTCSLLTQVYREWSAEAISERNCLNSRLVP
FLKTLSPPKADILIPGCGTGRLLVDLSRMGYNCEGNEFSYHMLLVSQYMLNAGLLQNQII
IYPFIHCFSHWKKIEDQLSPIKVPDIEAWSSNKGMGSMSICAGSFVDCYGRNQGTKISSH
YTFSRRMQLSRAKAENSKDVVVTNFFIDTGSNILDYLDTIGHVLKPGGIWCNFGPLLYHF
ENDHGVETTYEVNPYSGFQDKINDYTPLMGLELSSDDIISIATNHLDFELIRRESGILCG
YGRYAGPESCAMPGYMCHYWILKSNPTNES*AYTII*LHYIEVADTAVLENSECYPRGKF
FLLPLAMFCLPY*QYWLSA*IQ*YIKPSI*TIYQS*KKSDLS*LIHFISSFIVSVSRCIY
RLRPLLSTISNLYK*KIGEIAKDAPKLQE*EKKEQIQATQQEKWQL*S*TKYKSYTASTS
NGARVVSYRIGLPNFKSNKKSAQWRCHRGTNKYRR**ERTYGELDS**G*YGFCFFLSFY
SRFSLGIIIARRKENYSTNRKGGSI*CHKELPGRS*L*LLCLWTPPFSNGSRNGAYIQYT
LCHG*G*RP*NQSYQIPLRHNKGATDFQKSTAK*FIFYKGRSCKKFPFVKYSWLFERGSA
AFQTKATFKTRTSA**NGG*YLIT*RKFEQYTHQQNF**NFRKFQFCER*RVATKIFQLH
KNVYFITSQNSRGVCTKNDDVSEY*STD**LNE**RARIS*CNRRLCARWPDTSIEKRRQ
HH*R*SI*YRFD*SKGVYHNAA*WKTTYRR*VCRPPAQHC*KDD*CVRYRK*EIQRCVTI
REGAIYTIHVGERQKIFQRVDNSIL*K*I*WGIRSIRSSSHFKLVLFISIEGYFVRY*FY
I*R*R*GRL**LFRIC*R*RRGF*V*RNRGSRKTRA**KKQRDT*NITFKL*PRS*TTEP
PSPSLP*YQYPQRR*TE*RRVYFRYRITA*SS*ALSPR**YIRWG*R*ARGRG*K*RR*R
RRYL*QRS**N*PFRRRSEIDSDSHYKVASKSNNGFLS*ETGR**QTKTSTRTRRRKKKE
KREGRKKAEKKRKRERKEEAATVS*RGRKTKKGRRERKAKEGIRRA*NEKTRGSKEKG*R
SQTEERRGEKA*IGRAAAERRNARKTTETERGTKTQEGRRKETY*RTEKARTRKATERKR
RRRETKINCRGCAKKTEIKRRTNICEHTFRQTFY*EWSWQPCFISITSQHD*LPRG**LQ
YQR*NT*NG**RGCIQTSFTHRL*RS*STSSFN*QPDACYGTITLATAR*SKQPFWNYNY
SECVRLGYKIFFTD*KQLFNELTNSGKYKSIDA**FIAN*AIAK*LWFIILGWSDKYNVH
KSYM*TTGYSNFRNGITSP*I*SSSYNAIFWTT*WWYSP*IVYRRVEHFN*HAFFFRVRR
YITFIIRIPPITAFCVE*SKKLIFGTVDCRKL*QQQYTKRYAARTYIRKR*IVSKSNFYL
GQQHHSDDE*IRAFRSQYN*YCAR*PCVHGIKYLV**QSIQFTIFD*QRPSIPSNFEWSG
*KPHSG*HLQYLFSYFPTR*FKPLHCYRDTIPKFSRT*LGLLDVYQQIDKHARSLQLRIL
Y**QWIHYPRSICETNSRWPLKGVAESTL*WIERSNCYTIYVKASYLHKG*FSNCLFNYA
NVLNLLRYAGPKIFTYIHNSTKFQKRH*TIVHLSTRCEPRVGFSYRRGFRGEAATPHTSY
PAFNFHFSQECEYDNRLRYTLF*V*HISIVQQQLFKAQLSKGSYSDNLNQKSPD*VLIKL
PLHTAVNDLCADINC*NVLLWLCF*SRTMSEKAVRRKLVIIGDGACGKTSLLYVFTLGKF
PEQYHPTVFENYVTDCRVDGIKVSLTLWDTAGQEEYERLRPFSYSKADIILIGFAVDNFE
SLINARTKWADEALRYCPDAPIVLVGLKKDLRQEAHFKENATDEMVPIEDAKQVARAIGA
KKYMECSALTGEGVDDVFEVATRTSLLMKKEPGANCCIIL*KKLTLK*YIIFLAREGKTI
PYYNFNQIS*I*WNKLKRLIDSACIKHKPIRYVCSLMSYRFLFESLYQKQNFRRI*ENGT
SNHSSRYCADELNGTA*FDYFSFIYLFTYLRYLYSNSLRGDE*KTRQ*DASFFFQYNVNI
LLNCRRRQKEKKRGDHLSYNPTTS*SKPRQF*LSVSVKGVYNDQHG*PCQLNR*APLINI
RKFLNWNIS*KDQTLISVLLKLKSSCNGYTMKRPIA*LKKMSQLYQGCSKSLMKS*SMRQ
IIKFVIHR*NESM*TYMLRNIL*K*KMMEKVFP*RFITRRIFIFLK*YLVIC*HHPIMMM
MRRKSLVVETVMVLSFVIYFPLNSY*KLQI*MLARNMFKNGKIT*AFATPQK*HLTRRVH
HIQR*HLSRI*PDSE*KS*IMIS*E*CEEEFMISMVLFVTLMSI*MASP*R*EISKIMLN
ST*NHSKKKDN*ITVRTVPLSLISRLFFMRE*TTDGKLLLRFLISLFNKFLL*IPLQLPW
VVPMSIT*QTKL*KKFQKF*RKRRKKV*SLFRLKIICSFSLIV*LRILHLPHKQKSN*QQ
ESKILGPVVRFLLNILIRL*KLIWLQECLKLPTQMKKMR*RSLMVQGKAELLITLNWKMP
TKPVQKKAINVL*F*QKGIPPCH*LLQV*LLLVEIIMVVIHFVVKC*MLEKLVLIRY*KT
RKFKPLKKLWGYNIARNMKIQNL*DMGIL*S*PIKIMMVRILKV*L*TF*KAHFLVFWIS
KVSYLNS*LRSSKFPSLNQQKTLLHSTICRTMKNGERKNRTNLLGSRSIIKD*GLL*HKK
SENIFRTWTDI*KYSILCRVMIKITLI*LSPRKRQMTVKNG*DNTNLVLF*TLL*KRFQL
ATSLIRN*SFFLWPIIYGRFPMF*MDLNLAKEKFFMVVSKKI*SRN*K*LNLHHT*ANVR
HITMVSSHWHKLLLG*PKTLLGPTIFTCYYLTVLSVQEPLVVKMQRQRDISTQN*TN*LV
RYFTLLMIHYTNIYKKMRKQWSQSGIYQFFL*FLLTVLRVLALAGVLTFLHSTHWKL*RI
*DI**TTRSLSKCIRGLGDGPVLLKKLSLCVTECTVGLNKLEITS*K*LSCQPELGHRL*
RSTYF*V*AVTIK*NPGSKIWRSSTMITSNS*SRYHLRKWLKQGK*VFMKDLN*FRL*V*
*IWSHLILTGKSRSTIP*MKY*ANFTTSD*NTIKKEKTI*AKGYSGR*RNTLSK*NLLK*
LLKRS*QSPISLGTLLSKNLRI*GSPDLIRKVNHIMEVLTMR*LNKLTT*KAQLLMKKMK
KVHTKILKML*MVLKNYMAHMNIY*E*EYGH*PRKDIKSC*NKNKKRRQSWKTC*NFPRK
IYGTLT*RLLRWDIKNFCNEMQKLAVVMFPIKGAKRKVKEKESLLTTKTTTHQKKTRKVL
LERAKKLS*RIRILKGFC*NKN**PKARRLQRLKKRKRLLFQKQKQKKKRMLLLPRVLLL
FST*RKKIKMRAN*VRFRTSLKKLARFLTKWVLLPLHRRKIHQNRTM*PLKKIKQPLKKQ
L*NLNWPRSQSGNNKKLWNYLVKAT*KF*IHTLIGKIAIKMKMMLYHNDQGDKDRRELRR
FLRNLTLKL*NYLTTVSSKMMKRKTKDQMFRSMKRIE*YLSRESAILFICLYQKQIEVDR
ND*II*SEIAFGDHFHFSQHNRKFNYALFYIPTKICPRKFFEKTTTTKKIKPGRKTSCVY
IIS*KANRYINRY*NYLFKYSPRSLVSSSINNRC*VKLL*LFVL*RISLKKKDIYKECLQ
TRRKLERTR*APCLVLMKPRRWKVRML*RMLFQ*NLKLKPMVHQ**EKNKIHRTLVGNKL
VVGRKRTS*LPKTF*WT*TRTLFWGTFYQINSMVIGIMKSLFSSSLVYVPLCWAILNSLS
RPSLS*C*PQECYIELRPKNIGNR*GI*PRKNKL*RKLLVIMNLSNG*TPF*INTGPLSN
LLSPNKLSMVQILHYLKMWQFQSL*KPSGWINLR*V*SLQELMP*RHSKIQNLMS*SWTY
VYHSLHTTCLILMQNNAGIT*IPMSY*RQRYSEWTYLFQLLIFFFKFLLDFVSN**QLCL
LLKL*IFSYWKFLKLILLVVYWVTPSLIGKSWLFQA**D*FKKWHLNT*ALFYSHLSLCN
LIYHNFFPRLAYL*VFWKSKSKMPMD*ENLWA*SRKQLTHT*HLSSLVK*SVKLRFLKIL
LILFGMNPFTFCCNLLLIHLQ*PYMTNAKP*ATKKWVQ*FST*ISYMQITITKMKRYIS*
EILNLSVS*HLICDFSPLLNQKNY*TVMRSLYRI*IQVSPKLLFANSRDWMN*VTKNSSL
QSCMSMQNW**PQRKRKELPI*NGTQIIILW*QTVERLSVDLF*RIRVVK*FHLRYNH*I
I**IEQKSIKNGFL*GMEREN*KSPLTGGR*ISTSD*KV*DILLLSVC*ECLSIRLKT*E
IQIA*ER*VHTPKYPSMVWQEVGQMKE*RH*ILSGTNQFMCLSHLPYKKSQLTVSV*IQM
AMIIISGALIFKLRIYIIKTMTINIPFLLTTLQELAT*LERRV*RGPLRIIYHFIQLFLF
*AWKRRRKLTRLMRKKIS*KSRKVHWMTKTSQRRRKKELKRKSSGSPKNMTCIVTK*SLT
SMNCCNTMLVY*VLLY*AGNYPSLGSMFKHFLIPVVTQR*LVQKMLLGPLKQAGRAIS**
KSWNGP*LHLG*QRLKTRIRRKILFAKSTFQQLNW*GTVITNLPY*I**GKRVPNY*FKC
HGSP*LPRNCLNQT**LTLVI*KSPLKVLKI*LVLIRMVIPIHMSNSF*MKRAHHPSLKP
QFKKRH*ILPGTKAKLSKFQIVSMTT*QLT*KTTNPLTPIGVLEKPLFHYLLLIQRAIPP
LIYR*WDQREKMAVCYILNLSLNPAILPM*SNVKPGLEILPRKD*VQASKLVLQFSP*EP
ML*APD*EQLIK*RPESLVARSLQPLGTKNPKRSNNSIDGKEYVSRNHLDAAMYEQKKKR
EINLNNSTMPSATIVLFFITTYVNCNKCVLLCVFLNGKLLSVLFISSVK*EE*LSEKNRR
SRT*NKNGG*TTKTAHQQLKHHQYFQKKEL*I*SH*YLEERGFCNGRG*YKR*RHWRPSS
*TVGVFSIVHRFRRTVSIDQ*ITRVASTTHPYASEGSR*TSKRRSSPL*PRTIQTNHG*T
G*LICPCAHSLTKIRGASGEC*SPQQLSKHTHV*HNLRFLLPIRRWHRQCTYNTTVRNDI
KNKTKNGGKSGKQERSTLELF*LVSSTV*LLLLLY*H*RNNH*TTLKK*LSRLYLVYFLF
FAFPFKFFITLKTKNHIGKLQSFITKFVH*LF*RD*LIKTVSLSLFIHNKNSDILNYKVL
KAEKLIAN*AMAIKSLESFLFERGLVGSYAIEALNNCTLDIDVNHYVSRLLTNKREQYLD
AIGGFPTSLKMYLESDLKIFKDFNITPIFVFNGGLTYNQLEASGHFTAASASASISSTTT
SSSGTNATTRSNTESVLLQRSRGWTQWNNLISSNQNSYIDQPIQPQEPFRHNTTIDSKAY
QNDLIAYFIEHGYMYQVAPYSSWFQLAYLLNSAYIDAIYGPTDCLMLDCVDRFILGMEFP
NKEFRFIDRSRVMKDLGCTHEEFIDIAMAVGNDLQPTTLPPLQIYPVPQLFDIALEMVLN
TGTNFYAYQLSTTLQNDSKENIQNYQRGISALRYMPVLKDTGKVELFVQEIVVSEEDSEK
NNKDGKKSNLSSPSSASSSASPATTVTKNASEKLTYEKSSTKEVRKPRDIPNDVHDFIGQ
MLPHEYYFYRSIGLVTGKLFDAIVTGVYPEEPPLGGGSSTSYKKLVSKSVEIFKNKEINL
LTQPINRYYQIKQIKQVKWYAANEPTTLTNRMSPSMFETINHLIVKTETSDEKEFSISEF
ITTINGSSNMAKDFISEKVIFPNSVPIESKLNSPFNLLSTNFLRLLVLLEFFTFDFKEKL
LEPTRWGEVFLKLNELNIDSKYHESVIIFLVFLKCDVLKLDEEVQPPAPSALSQATLRSY
PEESLYVLLITRVLTLFQVDQKPSNYHGPIDKKTLIFRDHLSFIKENLNELFEAVLISSL
TSGEFNRLSLDNFGWARKIVRYLPFKLDSPNTIMAMMWEFFLQKYLHNGNAKNDALSLVA
TEFNTYKSTPNLDEQFVESHRFLLEISKVMQELNAAKLIDENVFKLFTKAVEFTTTALSS
*SVRMSMMEIVELFKKHPIKKDSYCKEVYYHYSEGSSTIIKI*HKHSE*QQLKKKLIKIT
VEIGEKK*NRN*VTVSLYDIFYYINM*RTLNSKNFMKFRQRRKGKNKYTPHRYWID*SSN
QKSLQVK*QTVNITHSCT*N*LSVSIDFCL*CLQFVSLIVQVILQYFNLLFNVIQVISYR
PDVNPLRKF*ASLSFFTLFVVQKAF*LFSHVRNLIICQRSIFLLYTVFI*KHVTATAIGT
RVLPIVTQIVHFVSFFFSLCRRLRGP*IIAQLFFIAHLRQRIW*TCWNFSTQIISLS*TV
NKIKSRISIN*WQILWVN*TPNLI*ICLTDVKKFCGKFC*QFVECNSTIG*FCTAIINFF
ILIQIIWRHVPIYFDFLLWRQVCVFYLLALLSFFD*IHLTPWNQPIRQFIWNRANVFINH
IKY*SHANYKFLKV*IVVVINIS*KPNLV*NR*I*FGIIKNW*NLVMVYLILYWFQTRED
LPVFFYFKLFQLGHFSEIPVIFTGLSNTH*LYGYITIV*L*QAINLVFLTFFSFILDMLN
HRGPTRSSNMIFKK**IKMQLFY*RWEILNI*RGK*RLIQSNDGLNAAEKLRDGQAARYT
VCVFVQGT*C*GKWSSYSR*SDKCF*EERPSAQGK**GNQNAVYCNGC*QGLCS*FKRFQ
EVCFQCRISNLERLPEDRFRS*R*DWH*RNK*VFVRPRQPEHM***T*S*TFK*KDEQIL
EVF*MGVSKEKSQHCATRPG*PQKEY***SVKENHRLRFIRYI*SMERLFAAGTEKAGFE
TSYCLFLFLPIQRRCRSVLRGRCYSHKRFHSRVRVFYCWWYFRCYFKDLYRAI**TESVS
HRKNGSILDLVKFKNRSPC*KPQC*HKQDIISISKGCQKLI*ARRDKGFLCWERFKRHQS
FSRKFDKVWFFRGHQENNDQIRRLPRHKRSFKVLYLHCWWFSWYGSSVFRLSYRYFEIQG
AVRSFGHKVEGE*FALSDCKRYVSRGGGSDYFTEVSQSV*WAYFPMLH*IWGLFLP*KNG
ILPNRQRP*TYHKIRSL*ATWLYFQWVHSVEL*ELLLFIQSIF*EQDYKPKEHMHILMCI
TALKMFC*RR*KGKVIKVYLKV*YQL*QKYVQQFPSAIYVTKI*KNS*IWSSDNNICICI
N**ILFNYKPLLRFVGVLSAKLSL*YIFFSTCT*LEL*KAQINTDSNTDFNDLNS*LIFD
KIL*KSSITEREKKRRVSLNNHYAIKCFTTSKTY*LRQKKGVSKRNRGISL*NIYLA*HK
FIR*TI*MFIELHLDKLSPT*QLQ*KNSLIIV*MRTQTRSK*SLKIMVLNLSNVLIMVMA
*TLQIMSS*L*NITHQKLRNFKMLLKYRR*GLEGRPYLLYVA*LN*V**QQLHHQKRISW
SMIWSVTLLQRQRHQEIKGRPC*FRSYFITCPLDRKNLAKLLSASLPNVSQLYKVMQS*M
LPLNFQFGISHQRVKKI*FYQQ*EIQV*ERIYPQYSVQVVCVGLKRLI*CLI*IPSRIEC
LGNTPMILIS*TSIIKFE*RAIYHRIRLVVVEIVRIGNSFM*IKGQWNTLRF*NAAMRFT
KRSIMFNFRLYFSILNYP*A*LM*TSLQTKE*YCCTTNGPSLIFSKQLSVIITIDKN*LF
PKECAHNQNNKLRKDLKRKSLMIEAQHTNPIMKTIIPPEAKVINPIMHILIVLLA**TKV
MVQN*LL*WTVIILMSLMSSVRSVKFRLIHQLYWMRATQVHRLRSCQVSKQILKT*VI*T
*IIFPILNFKI*LVQIKHVAWKKLLKNQFILILMVKSSKKKRFYHKQMV*FL*IMNVMSI
QMTAVIKKEEEVLTQNKMMKLTLYTQRLSQLKSM*ELL*RTHVNRFPKIIIGH*VMD*RI
ANSKMRYWSTI*AQKILKK*VKMANK*VAS*VKENQKLKKTLSKIRTN*RISNKEKSI*R
*QFQKMILKKWRLLDNLI*DLS**PEKLITNMICLLSISMQVMKSIISKHCRP*QFLNRR
N**YLSR*N*VSLMNLWCWTIYQFLKRMDSN*KLTKKKSLAPELSC*AYLLPNKPFLIWV
ILMN*YI*SKKTVGYEETTSDVPRFVLCLL*EHVEVV***VNR*IRRL*PESFIISVNLI
SLGIVPMDVQQ*DI*WNYVIGAHFRRITKYDLALIFIHYIINKYIIYRE*QHKIYSCIED
A*WIYVLRHKA*PLRI*TWL*FVYMWRV*SLAKDTRPKGRIMLYFCLRKCVNSTSIDFIK
LPCSFRVVSCMLAPNWQMQCMSHTAITPNFSF*SYIVFYDCSSVSFNRHCRQFTSYTHDL
GF**LVHPHPRVEP*LRAYLFGCCFTYAVKFRGQCDFNDLFTFETFTQDVNDHGFDGRPD
LICS*IVSSILK*QRILA*YMKEFF*P*RTNIFHFYNERHVVNRDIVSSAVM*HINFQES
*LNDYVGMIL*RKYRYIVRAVAAYTYTYILYIFLLFFSCGGMHFMQYSF*LLYIQSLDEQ
VSQ*T*HGDKTS*SHRDDTKNRDFI*IYRSLSGKIECFFWIFFGSFRAL*MRD*GPVNRK
QSAITVIGETVVGRNIYCTFVGYHNM*VFISVIFTILIVFCFFWNISILLYFAFLVPDIP
QIRGKITLPNVHCC*YTTNEYPCMQKIVEFRRQRRQKKEF*GDNDQ*HGKHS*NGGHSRV
LDDPSDHQRVENGIREV*RHQAPK*AKEIFRRSCCSECG**E*ILTVAIHSLLRSSFK**
VIVVSAIEFLPEISERIS**LWLVKRYAGAHGDSPSLPQRCEDVS*RR*KGYVPA*GHQH
MLLGS*MIQRQRFHRTVRLFKGRSLMLGILVLMRAHTST*YPRHLVF*NPEESNKII*PK
EGKGREKKLKEKRNEKPWCVHVDAQTVGNPKLSLPINFSGSCTRGNARYISHVAV*YENA
FVHVINRAKLNMGAGTSVSPTNKTPLG**RPM*KHHKSARKR*RTKTSSREKYTDV*SKL
LYLYKWFLF*FRLPMSV*FAQEQGTKTSVLGKRKRKQKTKVDHKFSRDAAISSSSFFASS
YLTVNSSFFLSHSSLCSSKAATLLSN*SAFKSDSLNFSVVSFSLVSLSSKSSSNCWFFLE
KLSLLDCKW*ESSDNCLDSANSASNFSISSSNWWFFTVKDLI*FSFSTLSCSVCLESESP
ASSFSISSSNCWFLTVKDLI*FSFSTFSCSKSLFFSFNSSYFSCHDSASNFKLLSFSLIL
SIVAFFVCMGCEFYYVDFFYQPNLLQYQKGKTNLLLAKYAVCDL*HFSVSRRSCYGVLIF
YFNGYPTSLPGSPSGKIYVLAPRDGWFVFLSS*YLFLYFDFFFFFFFPLVNDSNVLSCCR
AYKMYCVKLD*LKLVLGKGGVVSSPVCAPLYSGIFYVFTSMFQVLLKIVKIVRIS*FMYF
SLFLTRKHQFSCRYVLKYNHTDNGDIRD*HWDSVLSPDFVPTSPGYRWVYHFRLYTCACG
FYIELELELEHKFEHKFEHKFKFRYQDSYSANIG*LSYNTRQLQTIYGVPRCFALEEP*H
KQSGPG*KH*SDGTVYAMVEL*DEVSLSYHKRKANSTHFTTKNRLYQQK*TLQVQQES*F
HFSQRVFEEATLHTQGRQASKGTVKIQEQEGADIRFELYRTGTNGYCKCPGFATGKLTRY
QKSH*QGPCGNSYPIFKKPDVCNQ*SSTVSKEPLHK*ETTQITTR*SPDDYACDGDENN*
TEFNDPNHKICL*QECGAVQYFP*CVVPPKKKRKIEHQIACKKGATAVGTVERILNAGYN
TEDATAPDFALLSGFSIE*KLCLLF*RQRLRHVPFIYSFKSLPDGR*DQKQSYNYTRQSR
R*YT**RPLLSR*PPLDCIAIA*P*TSNFI*SHYPSMYLFPPLDFF*NITENKGKK*LEH
RICRLKR**RVLRSHKYVKSFERFYILIGIDYNSIQHSSNSLYR**TNLTIQ*LFL*TTR
AVLYLR*SKTHFSFATSGHKITENATKHVFI*LFERYCRCIHI*D*ESLQERCIKISS**
KQSYRRIQAKVSRDMPGIRNT*RQSFKSFV*PVRYHR*SPDSRAAGAGATPTSRAVQFIL
KFRYGSNVIPGSISR*SFRAVF**FCYPLF*WLQKQF*F*LQ**LYAELLLC*WQWREQS
VLLVSKIQLQR*GPSFG*RP*YQT*SKVHIEGTLHG*DCKVGFE*DKDLQCL*WARWSKE
MHL*NMQRARYSNPN*AYGTSSTKLVSNLCRLRGCRGFCQK*RYLPTVPRSWLH*GEEDS
TSHRSTGIVS*PTYSTYGRR*RSY*Y*GRRSRKGNTW*RRYHHFTFKRSEFPGYQLLQFD
M*EVQNRLHDQFMWRRSLY*RAP*R*VDQT*YYTWRDTEAWLFQDC*GHGDAQVYQRCSE
RFRSSICQIRCDVSRETGT*KC*ENTKYSG***IH*SRTFHHGNRRFRLLLRFGEVI*QC
GRACVK*L*GP*FKQ*SY*RRRPW*FD**KRFSEKEQPSIRRK*Y*****NETK*IFFTG
KRFL*P*Y*WILKVI*SCSNVIHFLFLFFVSVLYL*GHSFF*AMRKDTLFFLWMVYRGLG
GNIIAALVL*QFF*RVIHCYSSFS*CLPRDRGRLLNRKAKKKTD*NVHAVVTEKQGKFTT
DHISKFIKISFWFQQ*GSLTQVFIFFPFCFLFE*SEQKEKHILYYCVKTNRAQPSRKKRT
TP*FHLIYLSNTS*LFSNPNKKKELMSREAFDVPNIGTNKFLKVTPNLFTPERLNLFDDV
ELYLTLIKASKCVEQGERLHNISWRILNKAVLKEHNINRSKKRDGVKNIYYVLNPNNKQP
IKPKQAAVKQPPLQKANLPPTTAKQNVLTRPMTSPAIAQGAHDRSLDNPNSTNNDVKNDV
APNRQFSKSTTSGLFSNFADKYQKMKNVNHVANKEEPQTIITGFDTSTVITKKPLQSRRS
RSPFQHIGDMNMNCIDNETSKSTSPTLENMGSRKSSFPQKESLFGRPRSYKNDQNGQLSL
SKTSSRKGKNKIFFSSEDEDSDWDSVSNDSEFYADEDDEEYDDYNEEEADQYYRRQWDKL
LFAKNQQNLDSTKSSVSSANTINSNTSHDPVRKSLLSGLFLSEANSNSNNHNTAHSEYAS
KHVSPTPQSSHSNIGPQPQQNPPSANGIKQQKPSLKTSNVTALASLSPPQPSNNERLSMD
IQKDFKTDNESNHLYESNAPLTAQTILPTALSTHMFLPNNIHQQRMAIATGSNTRHRFSR
RQSMDIPSKNRNTGFLKTRMEISEEEKMVRTISRLDNTSIANSNGNGNDDTSNQRTEALG
RKTSNGGRI*LLS*INQIQYLKFFQKKIMSYILLSTQ*KSSF**HTIHFG*RILCTEKYK
KFYPGNAMR*KCMK*RIY*LHEVGLERAYILGFIIDSSVPINNKTVKSKC*EDKPVKGEN
IYTEKRKNYKILNCNKNVK*LNKR*LRGSHCQRN*QKMRVYKRISDMTKV*RRAKKQMIY
RLMMNMLPQVV*WIQESSSQHLVTQALVSRNLPKKLNCYFQMLSG*TEVIM*CQI*WMLV
KNPVLQIWWYYMNIEVFQLL*PYHIFHMDPLHSLVYTMLL*DMIL*MLVTKAK*IHI*YL
ITLLPL*GKE*SVF*STCSMRGPKKIPKE*SLLRIGVISLALDSMYM*EQERE*RLPKLV
LDLR*GCLN*GWEL*KIRTLMLSGS*EDS*GLPIKKTICEFFYRFVKVKIEGR*GLM*V*
YGILKKKKKKKAS*REYKRKEEIA*HMIYFYFCVFFFS*LFINVSVRVST*KK*PYEDIN
LKEQNERREEVQKGNLCITTIKFS*KSTI*NFFLKHFTDFFNS*LMFGG*RIRRRHVRRI
C**RHGLAYCCI*RRCR*RRLGC*FGITCQVCT*TQRRT*RKGRI*HVHG*IFFFAVT*F
YLELGILVHVCNRVNV**NGLSLK*YRR*PVFWGFCIVISII*ILSRRLLRRYIRRSSW*
FCSFDEGVGKCRCC*R*RIGLWWGPLEDERA*VRLGFHRWSRCRRIIGLCKFFIIQHIDV
RVES*YSGVWFAI*SCGGHPGVIDVIQGGTCSRRMRMRSRKFKIWRCWRRF**GKSGTIR
SSQQGHV*AHSRGRSS*INHIDIAQVSVLIVHY*ATSI*SWSHRVF*RTTAMVMILHVAN
GVQDVLLMC*RACGGVRRRPRRWYDVI*RRGNIIGVLPQRWSSNLATRDRYRRNGLQVVK
TIRS*AMRCVGGGNRRLKK*IV*TCLLHGSFEDKRRVAVVRI*LVHAHTVFFGSFL*QHL
DSPQALFTVPVPI*NI*ICERISLLFVIKAKI*SPGRRGVLFAEINILKERL*LVPEMTV
NSGILL*WCYVT*LPMNVLLKRRSLTFAPRWLWCKCRSSRSRPYSLAHAVDTSKMEATRR
NGQIVKDLGRYYPSMSESALHDLCQEYKEVTIADFNERFLGNPATLHHEDNPNLLLSING
RIKSIRFSGQKIVFIDLYNGSSGLKNDTQLQLIVNYNKIGGSSEDKANFSEYMNFLKKGD
YIKALGYPGFSQSRVKMLSLICNKLPIVLSVSQLPLPSRLNDETKIKSNRVVDYQLNGTQ
TLLVRARIIKLLRKFLDDRNFVEVETPILSSKSNGAMAKPFITSSKDFDHLELRIAPELW
LKRLIISGLQKVYEIGKVFRNEGIDSTHNAEFSTLEFYETYMSMDDIVTRTEDLFKFLIT
NLQKFFQDTRLPVPKTFSELHLALSENNWKFRKVEFLPTLNKELGIDLMNSGLDINKPSE
LLKALPKDIAKKYFPSADNTGQLSSLQILNKLSDVFLEQRHCQSTLPTVIYHQPAILSPL
AKTDPQNKQVTKRFEVFIKGKEYINAYEEENCPQLQLQKFLQQKQINELTGNKTETLSPV
IDYQYVETMKYGMPPVGGFGLGIDRLCMLFCDKKRIEEVLPFGCVDDVNRQ*ILRRLPML
L*INQTYTVNN*NGI*FFFFLYTNKLRYAKNPI*IFSYS**ECRKTLKTTTAHQIDTIKW
YPPR*KHPWSLLTLSRTFHLSQARSWNRMTLQ**WVSMKLAEGPY*GQWSTQ*PILHRNI
RTKL*SLTTSLTTLKNLQIPSEECCFPRYTRTTKN*PRSATQLRASLRWISLEE*ASSHR
RETIT*MSRRTMSQWHSLMA**SRT*SSVTCMWILLDHQRPIRRNWSNDFLVSSLRSPRR
QTRSTAWSVWRVSLQK*PEIY*SNP*RGIPMRSWVLDTPPTRRQSHG*SATRQVLWAGPP
TW*DSHGRHARLC*MTPVRIVSLSSGKNNIWTAGRTPHKKPSNCSSRWSLSLLEGRG*EP
*IIGTGDHLQFAHTIYLHVILHMS*LQ*LIQVICYYALPFLLSVKRDRPFSPPVLRKEQQ
EVETTNRND*KRGCYVSCLFTLNIFHCCKLHPVKLIVISVLCLPLSGWFQEYPEVQYSPD
H*DCN*DATHRTQSTPLLVCRHCLLR*RKVILLLGLRRKVTNCLPVKLLPK*KQTRLKWT
LSSKKMVT*PRF*FLKVQRTFLSTSLLPSMWRTKLMCQLLRTLSWRIQVLIQRPVRRLSL
PNHRQKRNKKRQLKRPRLLHLKLRNLTLLLLKVGFLPLHLPRLSPWKRVFL*RMFTALDP
AVELPRLTLSHI*KSRLSSLLKPVVLPPPLLPPLPQALLLALLHRLLLQHHMRMFQFQP*
EASLENVYCNLLKAFHHTSFPPRYPSPNF*N*DSP*TLQQTTSTNCPLMTY**KPSLLRL
RGCQMPMPTGYLMRTLSVNSRMSMSQSLLPHQQDY*HQLSRIVRPRACRKSLTKSRN*SS
VPE*TNWHQRNSKVGPFAYPIWA*IMLLTCLLRLSTHHSLQSWPSLLLKGSLWKTPLLRT
DSPLITRLP*QGPLIIEPLMAPKVQNS*RN*KLLLKILWKCYCEVRMKIKFASKCVSWRK
YQFVILYI*KIKKKKKKILKYSNTYTLY*NTSLVFESKSSLSSVSK*YK*ITSNGASTSL
FFHLMWNWLKLTKEWDIGYNA*SLAYYFRILLFGERN*FPLISQYLPKLAFNK*TMSFLP
SFILSDESKERISKILTLTHNVAHYGWIPFVLYLGWAHTSNRPNFLNLLSPLPSV*KHQF
DTTWVREEAHISNFELLDRYCK**KLTCT*SIYIIKYKIHFAYCYSFTLCFDMVKIRSL*
NVL*VPFFKMWFIFKKSDQLEFIPVF*YVYLSVIDII*NVKQNK*K*LKM*GGLLFCKK*
KIRLITNSFHEI**PKEANCLATSDSEAAAEAEETFLVKALFLA*YSADLTFLLSSNLAT
TSSYFQPTEVDNLPKVVYFLPGFNLKTLKA*GTTTLFFLSYGGGIPSKIFKRSKAALPRA
VLWETIPRIAL*RILDGALKWNGPRVLLKAVAFLKKSWYFNLFLKNSPEMFKASALTTTI
F*PFNTCLAIVEAKRPNK*SLAIIKGEK*S**MLILVFFTEWIEYSWSQNID*KLPLLFG
VMGHIDASQG*HWHDAFKPPLFRRDARYCKFMFSNITHSIKYLEFQVLRVPFLL*INEHP
N*LILFFIVSILQHISQDYFLFQLLYSEMVFATSSTCILNHSC*N*KFFTYHQ*QRLVET
SFMVGWLFNTLTKCT*WNIYMCYSFKNQFYQYQNNFPEFEIAAVRSANV*PEGPSVCLRR
DHHPPKLIQGSNGKSPTWGQPRRRFSGQFQVLGAFSEGSPSAAVFHPLAEALRNSQIF*F
IGNF*RRFGCV*CTD*ICQGCKHSSENKVQLHKLE*TLRGVQNHKGQMIKRMRKSKIGNA
R*LNIIYERQLYMYFVT*IRTTIE*KESSSYDWLQLSHFSFISLVLVIHLVSCLSC**Y*
SLHHPYLVLVPWHWRCYHLGFSKVKN*YL*FPDHLS*SPNLFLK*HSRFLWL*CPDLWKI
LSCCLRYLRQECCLLS*TAINSIHLENF*HSAIYLLMVSAVYYHCLIPCFSRH*NPILDL
FVCFPFR*SVN*NYLRRYY*YCCYYYEEVT*PY*RFLFLVYMLPSQ*YEMP**EIVIACH
MVEKGVDCSLPMRKLLFQFAELS*NYRKTW*LSAPNYHFHQVKK*IWRVDSFWYRRYCLS
ICRRYR*CCLLFWN*HMH**TRLERCLEIAYSFVILILQADEVTLCILSYCFDLS*HLNW
ELAIVAS**VLLTLYFDFGYPRR*IESLDVVPVVAAAVTDFDVTQGAVIVAMQEGYLWMG
HVVRTLL*CYCWMVLAHCEIVVVV*GVEPC*AITYSPFPWVNC*ILPYVTVVALLLRIPA
*FSPLFRYSTCLEILADKIR*FSISYLCPAHWVFSEPFQTPYLMINYA*WSFANRI*QTC
SMHNWKKYTCRYRLVK*LPPATTVWPVLS*LRMNEVV*RSCFRHGIGPK*NPKLEDRHLM
TCMNLQNLQR*WYLEDPVEKPLVD*WYCLLL*MLYSLGLWT*SSHSCSYYYYCC*RCLVR
*GPSSLRYQKEHCHHFHKA*TL*FVD*RLIAFA*HN*TVL*CLLAGGCCCLPIRTCLLN*
ASGVLYK*EQQPGHCRAG*TSFVFLLCLAGFRKIIEWEDCWVHYESFESLL*RRYGPICA
IPNRRYSCCILLWRAF*KRLWQVRDQYSLYMSFLHHLNFPVVHCLRDQYFYQ*KLPNPSH
NRSSLVRRV*HKLVFPSPCSCRWNIVMIR*LADLGLSVKR*WHLLHLDDAERYILCCHNL
FESYLVRSSR*NCCWTFLAH**SFNKGNGGSTPIFMCIVLFFFFFSSNDHLCEGIGKIGF
EVFLAFCSLV*S*LLSGSIQWKRTAL*CFKFYRNIVIL*MSLFCLPLEMRNHWHFFSLFT
NLPRKSKWHRASEFFFPLLMSEIEDFR*CCAKGSGAGSGISHHQC*GNDYMAQKETGRRG
HQNVAA*GISIKRNQ*KTACTQQAANF*KPVARYI*HKLLKYVELIFSSYS*HDPTQMLM
FLRFYSFKIAFYFLLLDPFGPAEGSFFSLCLALFSSLLIRK*KGKEDSNYVKIN*YVSNK
KKR*QR*FL*TFLRRLLMPGKFWIYCSSFKKTSV*YRSGRNQFCNRFTYSQENLFSCLAL
PFLLCHTLCLPGTIGETYTSINVTNVRSRLHLMCKLMWCTGVVSKTALLTGNFFFSSSEF
FFKATHRKSENYLNGRQT*KKKLPTIFLFPFPLPILFLK*FIFSL*NDNKPNSSLQ*SLK
MKYIQTEQQIEIPEGVTVSIKSRIVKVVGPRGTLTKNLKHIDVTFTKVNNQLIKVAVHNG
DRKHVAALRTVKSLVDNMITGVTKGYKYKMRYVYAHFPINVNIVEKDGAKFIEVRNFLGD
KKIRNVPVRDGVTIEFSTNVKDEIVLSGNSVEDVSQNAADLQQICRVRNKDIRKFLDGIY
VSHKGFIVEDM*MEQKSVFALRGA*ICTLFLLFYLVLCKD*GSLSLDVPHFQ**IDRLSR
ECCQGETLLVLIEIKSHFTFSQIAFVFSSIDANCIFFGKGKKH*KINIL*YVTNDFLFS*
VLQSYP*LSLVLRLLL*IKMISGCTSKFRNENIKIWLPDIYAGLILVKLNRSISFLY*DV
NDNVFFYRKSKQSAVEGSERNLHSAKFINNDFSRSRIFFSHVPFSMNLI*TLTFEKNNSS
FPKKNSTITRILNIIAVLFTIFNFNFIARKGKIDSFFYHYPTTLHSFFAEEKNSSN*FSL
L*AFFFFTFLQVVCLI***DLSCYYILSLQIIPLITKLLCFFRFGASSFFENKANFYMPV
IFPCTTSFWLFWPSDLRRENKFLTSRDIAIVETKTILIDSISTNLRKFAILLFSQ*FYLL
THPKFILVI**NETVRHHSYRGFIDRL*HNRFRFAVCG*Y*HRMYYYCSWFTPA*EGRCS
YIRLRNSHCR*KWSDRHSNLN*SLFYSCFHYYSDFRIFGHQVFFQSCFFF*EY*TNRYHL
VFGSNNSDIFRNFY*RILCAYFHIWVSFHIFSSFQCNWKYLR*FG*LFRSI*KI*RRYHS
LRPISIWSRCYPHQLVR*RWLVWC*KY*HFYGWLL*RRVLLLIRLPTRYVQDTMAF*PTI
*RQIHWWFAM*GRLPVPFKYRY*LFMRMGR*CRLRRL*IEQRCCYLQDRLPGYRKHGDSY
ICASR*LFTLDCR*SGHLLHLARIEDIRAILR*QCRYFCRRCLCLGFFKFRRR*LGSIEL
WRWFF*WCRLPFFDSQPKQR*RIEFQCQNCRR**LFYSQR*MYL*KR*LQRWL*RLYRFR
YCWQS*VCSIQLNLGASTVE*VDCIITPFFSARPFYCLFNIH*NPRRININFFLLCFYLS
FFQT*IIL*Y*RHLKTYIHRTPLLSLS*KPPKKKKKTSNLFFFFL*FCCRMLSTPKAFFY
YGNLFTMCN*AKC*KKKKKSGAPR*LLFPFYTVQRRPHFLRILLTGKGAYTKTKGPVMTR
KLHRSVNTGSLPVLHRKISHRFVPVSDNL*ITRLDGTVFVP*NARPALFSSDEKPFQRFF
FSSPGSCGHLRARKKKLLCPHRGYS*SYSILYNA*HCQGYTLFTNFLLLILSFYIKLWIF
PGLQS*HLYGDKFIFLRIQARFRKSNQQCHEVTVYTQKILRCILLTMSSI*RENTQNQMV
KRKVKN*ISKALISTVTGLYPRLPQGK*KAI*TLRLLLTPVMIKLIQPNR*LQRQKRHIL
Y*VTVRSGEWLQF*QCVAFGLHWDHRSIIPL*GSWKSNLMWMKIWLTLLWLCICCFKVYL
PQLAVVWRIALDGDL*F*QVC*YTLLHPSG*HVLHHTVLLSS*GVFRVLVFPPQLQSVLV
LSGTSL*SMKEVHLLAPPQGLFYWVNVLVVLLVPS*LQGGIGELSFGF*PLVVEVVF*LP
FLFCQKQSEPLQVTFPLSLKDSSTERRFSYWAQLEGDSSTIILIMRH*IPPFRN*ICHPP
GRSLYCQKLFCLYFHQGSYLLCGR*CFPLFHPVYQWRHTTIIWSLLVCVIYPVVLAV*WV
PSSQVELLTCISRERSRNSSKTKLTG*FHKTQRLICSKSV*FVFCPKISWPS*PIFYLVG
V*IRAGGSNLF*LLHLSVHTVL*VHYQHQLRYWSICTQRNHLQQVVVSTLLGAV*VPSSW
VALPK*KLR*L*VVLLHFYVRWYFSSTS*CLFR*NMV*SGGRIDY*NNKDSLG*TPWQSK
PKREQKETRTIIIINWHSSI**TLIPAYFFYKQLIDFHVNFS*LMYYLLR*FSVELLTC*
RCTKYT*YKKWFSVANIYSGNFSI*SLLYSFLKISS*LELFLVNCIFYHYYFTYV*LQNC
ILK*KV**INES*IS*SFFIKKIIEMHIEHLRHLVLLHRNHSLHHPWRPVFCCIWLGQSL
RVHIRPQ*LSLEWLGQFLEAKFLLTSSSFLLM*NGFLGT***I**LNYHSHRILELAYLY
LR*PYAYLGQ*LHLEQYRPLTNHQKHVPMQIHHQR*QSIDQFQPHILNHHHLS*SSCVVS
QKL*RQHHLE*HLGLGQLHL*KRFFDHLSYLVRHGLLGSSFRFQLSYRYKIYNDP*DQ*Y
HQYRDRHHTLFGIFGSLDPFVLLQI*YLDHYSWYTS*RRLSYHHDLHILYIGSVC*GLT*
LSYPYIILQVRQKFHA*YLYLFGDLLVFVRHQHQRIGKRYRHQNRIHHLGIRQRHQHHLD
HLHQIGHIYLSFQDLIKFHRLLKLL*TFLQLPHLDSYLDGILRRIFYKLS*FRHQWQLLE
HLEYRKT*FL*PSLDVYYCCWKM*NSVWIIFNYVLSKDMVTNNKKINT*QLSNKTLVRA*
YIWGKGLFVTLIYKNELHTLSNKNYLTNI*T*SKFLHVL*VRGLICKLNTFHTCRCSIAF
SFLEKEMKKFSIFSMAFYNFVRNIIGQVYITCSNQRLHILFYTNILIITMYSIVEYTQLK
RV*TTLFCRLSTVNVLLRFQVLLETLHSLPLNS*TRSDS*MVGTKKKRLERTYASNIYII
DKKSFENTTWFASFASRM*DSRASETRVQMAHRRAASG*INPLGLLTEIQTRPIAVHLKI
ATVWGLGHSLQAWCSYTKMGNRGMGDGHNKSSKQLYAFKAYYTTAYL*YVYRNRVYCSRF
ESWYSKLHVHCH*RVNKSN*VG*RKYAEKQGEWW*ARAT*YIVLKS*R*ISIPYRYINR*
PPLHSKA*LQ*RC*NFRKAVRTKASASG*A*MLYKSSKLLAAEDRLLLL*DWRR*TV*LR
GEAH*RRFISQPYLVYWFEI*LEWESKSRIWV*GHSQRANTTPDFCILWDYKTFSNRTQW
AQS*LQLSI*M*IYIFSGFFVGSYQTEHSVDIYIFCFLAPCSASFSLESAAVAFSDTGSG
AGMTL*HHIRYPPPPFMVIRGCSLPLILWYGLHLVSKIDGAKNLRSEYKV*ANSNKVSLN
*P*HTIGLEPWIFSANFGTSVGKCSVVAITRPSYRNSPVSSKICHCVLYHLSFR*YEFFL
PPFNARASSLGNGVNLL*ISCSVGGSKKSNREMVCTCSLINFSE*LANFSKSKLACSFS*
ITMTLPLDLLSLSPPNILSNRK*TNNPPVSSIQR*LPSDWMFARFNSIPIDS*DISNTLW
ISPLSIKNCKRLELLKYSTVKYLANFCFFLFTYFS*EYTVLL*KLL*DLIILSIISLLDK
DSCFIFSISSTVNSWALLPMLTRF*FVALLSMLDNSRDTDFSLIDKGGSL*PSSLSLLTS
LISCDNSLTFPMGILFFGFESLFSSDETSSPS*YISKVNPKG*PIMSLTSKAPNFPNDTE
VLGFSSTIL*FFDGSRTITC*LKSMVVKAFIVH*IQSFFVQFVCNNVSRIQRAKEFKVEY
YYCYYTPHRLFFFF**NFSDFTKPLPSFTFSEKNFHLIAE*V*DELSCKYSCR*GI*ICN
SGGIPLVLANIRITYTYNRKWVVDVIRTSKPPHQPWRSFRQERKRRLIES*KKERDLLPR
KGMKFLIERKRSRSHSRNLEKRRKKLLKRIRICQKLILKNYQKPGNLYLMMKKMTMKQDW
WMKN*KMNLTWNKNMITMKMKIMTPTQFFQMTTMRLILKN*MHKTWKLFLRNLMKKKLKK
LKKPKWS*WKRRTCNQEQTYCPLRSRKK*WHKKLLI*LPQEQE*LKL*RFWKILRLLVQK
ADREENTLTDF*KIFVSTLVIHHFWRKSYSIYSHQQRRWSFSKPMKLQDQ*PSEPTP*RP
EGET*LKLL*IEVLIYNLLVLGLKLVFKYSIPKSQLVLRQNIWQVTIFYKRHHLFYQLLL
*ILMKMSVSWIWQLLQVVRPLIYQL**KTQVVFSLTTPINLEQNL*LLISTV*AVPTLLY
AITMPVSSLR*LEVLTEFYWMPHVPVLVLSVRINLSRCLVPRRTSFKFHIYKNNCFYPPL
ILLIATRNMVV**YIRHVLLQWKRTKLS*TMH*EKDRMSS*SILV*RSVKKRLLVTEAKS
FILV*N*RGGTIHIRTTSMGSLSLNSKRSVHLRLMITKQVQKKRKLLLERKLWKKVSFTL
TSQPSRTKKTISTLKSL*KTIF*KRVSIQKLKDLLTKNKFPQT*WHHVSIVFSL*SFSVY
IYIYIYIYQFQICLTVY*IQNRNNKADL*TALRKKAMILLINIRCQYSITYISIYFSFFV
FKAFQFAVSLVFKILRIP*LMLFDVLWTVLFVFFLTDNCFPILFFVSC*SCHTLPGIQ*R
I*RHIYSDIGTGRKESSEFLHNTFFQSWHLSITAGNKNVVHHVYGSLTQFSWLRTKLL**
NGF**FANTGLVLSAHCRLKYHFWYPYTFYIQMHLMLFMYIFAIMRSRSS*KQVEDRISP
IVLCFQRIFFSKVWIVF*K*SLQFHDVFVLVL*CFFKSLRILSNISINKPVFIISAKSVI
WIIIYCRLVSITFGPLFDIILSQ*S*IFHSVL*NLRFSVLHFVT*F*LFFSPFY*FV*FQ
SFVLYPTI*VSFTPLLLF*FFFFFFLGDSFLFFFSLLPGVLTGLQKSLLPFLLDLIFI*I
FVCNIKQIKFLGCFVFIHFIQVTIIFCFNHLGFF**LF*AMKILFKITFVIKTSVLQNRE
YFLLRFVN*LVSNF*EVFKFFLLLNQFFHSFQTCLFLQAFPSFLSFFGLNS*FFFCLLRL
KDFCKRGFHYHIICIKVLQGEDFFNIFIIISRNIAIIFIHRFILQIRHLCWKIWILQSHQ
IIQVVNCLMSSPINPFCICQDTCTINYGNYIGVLMATTDDQTCFISAWVIIVKTKQTVYS
ESNAWYIVSFKQNLVPICPL*LNSCQSFGK*YWIRNSVIWYHSQMMKSVVQYFFSEIPIG
YKWSVKGASRLRTHSLIQQGVITDKSEIFV*LSVSKLGQCIRKNMCRGSMVNESCSQFA*
SKINGNGRLGIVS*LFIEWFWGLSQWRVVYHYCLKRSQRGVSARHYTSYVQSPSKFHFYN
KFLLRTAAYIDYYILPKVSIS*AL**CIIVYETR*MLNANYS*EFTTM*VALSQELLSMI
VIALSKLFIVSFVTC*KLHRSRPFYIVTFHL*RQHFKAKVFNIYTRIMIA*LLL*LSTCG
*NFVDTCTHFGSSCVGVS*GSERYVRKDHMYIFNKECIIRLVDGYDQIR*SSSKITTEFY
LSNYHSEKFFISWRVIFGPFKNMIKIYLGRCTDDYWCVRTVWP*KE*KQTSIFLVLNYTI
FKD*KKKCLT*TTMYLRCQGI*IISLPFRTSSKNIDGACLL*AFLGELVFEVAEATGMRP
KEDWFLLW*PSIELIFFSFLSGDAALCGLLRFSFLSSSSSSSSSR*VPTYKNGSSIKMLV
SFD*WRL*LFSYCDTCKVGDINKDLLLSVNGS*IGLNGEAASSYWLDSNWLIESQSSCIY
DFSSLMSKGLLCKEELCLWCPLYKFLLSFA*EFVIVKRRDK*LDTNHHIRILIKMAPMTA
PTAMYTVPFGLSAAFKINGFPAVDGGVILATISDEEDVAPLEVEKAEDVNDGRDLELVSD
TTLDVGFDRAVELVVVVTKVGRSLLTSDTDGIKFFLTISADVSF*TFDKV*V*LIIIQEC
GYVINKHYKLLTHIAAKYN*KSSNF*LYIFFFYKCFMICLLFPALGNHIKGFMKEFCRVI
IGNRQKVRREAVTRFPYTIHVSGSMQSKDPFSFSDSSMNSSWC*PRFFSNFCFFF*IFQN
*KKDQKKARVYLRY*SLVDISTSEGKIPIECTFLDAMKYIPPLNFSPVVSTDVSLYRSGY
PMPLNYSFIKHQLHLKTIIYIGDKDRPLEEYQSFLESEKIKYYHIFMDSSRDEGIQERMN
QVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLLQGWSTAGICQEYGLFSGGMKDGVD
LEFITMFETNLKIPRNVIPGFAKHCLYLNELEAAEGSDDESGSESILTAKQPI*L*EPAV
TKNIFCH*YICINKTTSLKIK*KNGNKNEHIYGI**TYIY*IYTFKRRRTKTNLACEQVQ
TTSKHRKRNRHPE*RQVLTIACKPK*QYRNRTP*P*LGKMHQANI*WRIRC*HWS*VVCS
SL*P*HRPVKRR*RFGRSQR*LFARCSM*RPRSSLWRNNLKPWHNEKWNRR*YRNQTLRH
QQYLRGP*LSHQQMLVTSNTSQRHLLR*RKVV*T*CLRRRTWRRLESKK*SIRSLDQGSS
WQTLIWFASCLC*TSLELDPSRFACHSTLLPR**TVDRL*QAV*PSMRT*CHWRLLFAHQ
RQLG*HDRNPCSIGH*YFWRYRCKLEETLLRGWFDFCFGYAWLFRVGRIRSTNE*WNELG
VVI**INSCSAGYKRGSLLRNGRNGGV*LGRSRQKAPEP*KKLV*RGNVRQKISATGN*T
PIWHATSAHSDH*TCWNKNQLSSTN*YLRY*YIIIYGVRR*RK**EIVI*ISGS*NARID
NVIGSMNINI*NDDNNIYRIV*NYRFPFMDS*ILEENF*YILYT*YYSLYQQWNPNNYLN
IHPFLMVAPVLRLLLRKSTQIKIR*TFQLPKFKNMIRLPLRLTLNRQQHLLHQLFQRTPI
MPLLKLLSHIHHRMGRTHSSA**PKTKPIHLIGHFTDAHL*FRIHLIKCRLCTFHLGHIH
SFRSIHHQLERL*ALHHLSQVIHLLIHPQRTLI*HPLKNMSDHHQC*PHLMTF*IGLKHT
SNFYKTRISVVLFRQ*TENPYVRSLMMNSPSCITLFKYLLHLNSYLPGSKTSYPLIIRIS
*KFFPKVLKKCNLIPKRQTTL*PWQICNIMAVHLQMHLKQKSQTLSTD*TIMAFISITRS
HAN*L*EVYLANINFYATHVIDI*I*QSLNCS*ISMLFMKNNRDRETANLITGEIRVMRR
MILAAIQIQPNPKL*LGILKKQIIRNRKQPGLTMYPHLITLPARTTIPSVNQLLNRFN*T
ISTTFILGQKLTESTVNHTNHSDDELPGHLLLDSGASRTLIRSAHHIHSASSNPDINVVD
AQKRNIPINAIGDLQFHFQDNTKTSIKVLHTPNIAYDLLSLNELAAVDITACFTKNVLER
SDGTVLAPIVKYGDFYWVSKKYLLPSNISVPTINNVHTSESTRKYPYPFIHRMLAHANAQ
TIRYSLKNNTITYFNESDVDWSSAIDYQCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYL
HTDIFGPVHNLPKSAPSYFISFTDETTKFRWVYPLHDRREDSILDVFTTILAFIKNQFQA
SVLVIQMDRGSEYTNRTLHKFLEKNGITPCYTTTADSRAHGVAERLNRTLLDDCRTQLQC
SGLPNHLWFSAIEFSTIVRNSLASPKSKKSARQHAGLAGLDISTLLPFGQPVIVNDHNPN
SKIHPRGIPGYALHPSRNSYGYIIYLPSLKKTVDTTNYVILQGKESRLDQFNYDALTFDE
DLNRLTASYQSFIASNEIQQSDDLNFQSDIELHPEQPRNVLSKAVSPTDSTPPSTHTEDS
KRVSKTNIRAPREVDPNISKSDILPSKKRSSTPQISDIESTGSGGMHRLDVPLLAPMSQS
NTHESSHTSKSKDFRHSDSYSDNETNHTNVPISSTGGTNNKTVPQTSEQETEKRIIHRSP
SIDTSSSESNSLHHVVPIKTSDTCPKENTEESIIADLPLPDLPPEPPTKLSDSFKELPPI
NSRQTNSSLGGIGDSNAYTTINSKKRSLEDNETEIKVSRDTWNTKNMRSLEPPRSKKRIH
LIAAVKAVKSIKPIRTTLRYDEAITYNKDIKEKEKYIEAYHKEVNQLLKMKTWDTDKYYD
RKEIDPKRVINSMFIFNRKRDGTHKARFVARGDIQHPDTYDSGMQSNTVHHYALMTSLSL
ALDNNYYITQLDISSAYLYADIKEELYIRPPPHLGMNDKLIRLKKSLYGLKQSGANWYET
IKSYLIEQCDMEEVRGWSCVFKNSQVTICLFVDDMILFSKDLNANKKIITTLKKQYDTKI
INLGESDNEIQYDILGLEIKYQRSKYMKLGMEKSLTEKLPKLNVHLNPKGKKLSAPGQPG
LYIDQDELEIDEDEYKEKVHEMQKLIGLASYVGYKFRFDLLYYINTLAQHILFPSRQVLD
MTYELIQFMWDTRDKQLIWHKNKPTKPDNKLVAISDASYGNQPYYKSQIGNIFLLNGKVI
GGKSTKASLTCTSTTEAEIHAVSEAIPLLNNLSHLVQELNKKPIIKGLLTDSRSTISIIK
STNEEKFRNRFFGTKAMRLRDEVSGNNLYVYYIETKKNIADVMTKPLPIKTFKLLTNKWI
H*IYYIMGGMLE*KSTIIY*LVFTLLVYYHIRC*KMTQMMRNSHLN*WKLKRKD**CNRI
NEY*HIKR***YL*NCVELQISFYGFLNPRGELLVYSVYLIL*PLSTMESQQLSQHSPIS
QNYHGILIED**RTLRYSNNVTRITLVVFWKDNCKLYVNERRHTVQSCNNNHIYKW*SSR
KLHCKIRYVEVKDKLKFGSEVPLIFG*VSSPRGRNGEYLLTFVLTTTKNCKSGVRFTFRF
GCKSSALV*ALCPTLVSEGTVLVSMSVSRGGEIHSNLG*YICIYLYTRRDLVL*FPFAKS
LRGHS*S*FSTKVGLLDTRYTLQSKCADFSDNCRRTRLPLPSSDRHKIRFYVYIKMYIT*
KNVNPS*I*TL*VFLATLCDIL*CNILIRSSYFFVLRHFRFRKFVGWFLRRVSPSILHND
LQFYN*NQVDTGKYSINYSVNRPVYTLSFHLRQVKAFGKRAR*QKKIESSL*RQKQLRHP
WQIIFYCRITVM**HLILLFPLPPHLPLRYTGK*LMILSLLLTPPATLYSIICPP*ITI*
WIPMPRHIIKIIGIQT*TGQEHQCQRVISQQIYI*NISALFHQLIIIVTMP*STTTLCHL
IFPIRHLHYETRRALCW*LLTLRLLQMLNSRRRNLPSSPIICLQVTLPFIKQRDRRIFMV
HHQLPHLKRSERLRPSPITRHPALVITSARIHLQLLFYLYLHYHNKISQK**RGPQCTSL
IQEKYF*VKTC*MIQRRRMLPRIQPHTIMVQ*QMMGCVYRITRTQMIMKITTK*RRIKTL
IVGKMNVMMTPAKYALHLLKQRLQPHLWAVQTILRLSLLVSPAVMLTITIITRRKPAATT
TAITVIVHPIKPMPISRILTPT*ALLPLTIMQ*MTTHMRVIQKNQQRRIFSLQGWLQL*V
KMKLVILRKHLFMNRQLIRLKT*YFLTPPASSSSSNSNLQNNSNSNKIME*PQR*APHC*
TITKNY*AD*KIQDILALVPY*ITQSRL*AQIRT*ILM*CRTITI*CRDTITWTS*AV*N
RSHRINCSSSNHQWMYNR*IRIPLTTQTAMLLPSRLIRGQA*YPYLKFLHIYFHPHQATV
TQYRVPMLPQIRRNWNQTMIFQRRNLFPILL*DIPLLIEILIMVTTKGLLEQQCQRYLIQ
TLMELLYGDTLGYRITLI*KITSNSRIIIQQCKIV*KRMNFITAGTISFPMV*TFMVITM
LLKRKIMVTRLM*IDRNTLTFSMSLFQKITKVMKTIFTPCFIIIIRTI*KQNR*YPIMVK
MKT*MIMIAQMLLSTVTMAQHPTRTNFHYMEGCLQDQIMITTILWLATILAITTN*MNIP
P*E*NVVKDTYQEQTIA**MVASI*MVTMTLPIPISIITILLVTHRTTFTQGSPHL*K*R
IFFILHLLYHHY**QDSFWDFYWPLIKNYKM*TW**WIM*FQVRTS*SSTSQ*VLLIQDS
SV*AFPKSIWTFLQKVLT*SAILMVTVQ*WNRNGKFYK*RQIFR*LKRVLIMILVVGT*R
RYY*EPLKN*RHH*SSRAAHLIGTTMCQSRVSSF*VLGLVKPSTKTTMMTMMMATMVTMK
TILMKDNTKANQMLEMTKKMILKNGSY*SSMITN**SVEA*SMRCPFSIRKNLRLFKRIP
WSILVRSEC*ECSFFVKAGYFSFYSAGAEGNFQNRNVLSKKGKCSLFFDVFFSLTISNLE
VKKYKNVT*DSIQCNISLLLLLNKAFSKQE*GLCNSFSKHSFFFLHLSIRQQ**RKR**Y
IW*R*VHMQFHSDKQHLDSKTDIDFKPNSPRSLQNRNTKNLSLDIAALHPLMEFSSPSQD
VPGSVKFPSPTPLNLFMKPKPIVLEKCPPKVSPRPTPPSLSMRRSEASIYTLPTSLKNRT
VSPSVYTKSSTVSSISKLSSSSPLSSFSEKPHLNRVHSLSVKTKDLKLKGIRGRSQTISG
LETSTPISSTREGTLDSTDVNRFSNQKNMQTTLIFPEEDSDLNIDMVHAEIYQRTVYLDG
PLLVLPPNLYLYSEPKLEDILSFDLVINVAKEIPNLEFLIPPEMAHKIKYYHIEWTHTSK
IVKDLSRLTRIIHTAHSQGKKILVHCQCGVSRSASLIVAYIMRYYGLSLNDAYNKLKGVA
KDISPNMGLIFQLMEWGTMLSKNSPGEEGETVHMPEEDDIGNNEVSSTTKSYSSASFRSF
PMVTNLSSSPNDSSVNSSEVTPRTPATLTGARTALATERGEDDEHCKSLSQPADSLEASV
DNESISTAPEQMMFLP*GTASPKRIFMTIRSAGRPPPYASK*NVLSTSAYIVIIHHCKCH
IAKIVQ*TFSSFVIGPTFCADTSGGEKLKRTIN*IRTISPRILSSVCKQCTKHKIN*ERI
YNVT*HFY*SWWTITYYIRKIRSNTCSFQRCCNGSAIQMGEHALH*AAGYCQ*VE*TSKI
TMGTAY*A*KASCVVHFLRRMGPKKTCIE*G*FQFYCQRCCCRPTIFSGTFCCRQDGGWP
RRKDHE*GVAAKE*RIFEVEEC*SLGWLFSGPI*MNRPEILKGNQ*GLTIVMVFSASL*P
VRK*ISYYIISVSMGIRPIQCQHIKHKIG*LPLSHFFFIYLLKFCNFLLDI*FYIIILII
LIFKGTPLE*NKLI*YEGILYKWVYLVILCLPFKDVFLKNFSIWLNTMKKKKSTRIDMED
KNV*QKRRKELEV*Q*RQWQTI*KILSLCWSLILMLNNLVMTY*RLLITMTQPF*TLTRL
LKS*TMIYMRLTLE*TN**IATHWR**S*FTKMNTSIQP*LVS*NQVWDI*ICRTID*RI
KF*ILMKERGKSN*R*VKFTKHLFSCAEHCFIFIYQTN*THCLKQPN*AHQQLLI*PPYT
TNLKLLWKKIKI*NPCGKLNN*IRTLFPPTKES**HFCLYKCVKSA*TLLKSNRTKK*YL
SWPTPYIYFHLKNSSLQ*TRLYYLMLQ*AHKSYQKF*ILSGCFLMRSMKLLKKVITSTF*
KHYYRTSKRIMLRIPRDLLLLINHALAIFYQNIPQ*RVKQVLVHREICFGAKFHLPSKRT
LIYLLIEEALWASRC*KIKILL*TL*SKV*KNLLIIVITKATWM*C*TQYLFL*ISETVY
IKLRMLMK*DESKAIFNSMCICLIKIT*NVIFVYIIKDYTSNSYYEKSNIG*FI*SINMY
IYTFTWSFCPKLRGTASFCQWVQRYLFFVFLSTTLMKLFLQLFLYLTSFGITLLGSFKCQ
FFGCTLLLTRSPLFNLQFLLLL*LYSRIVLIQIYYSTLAIWPFITNT*IILQNFCTFLYY
HIIVDRALLELQLLVCRIACKVVVFGPFLVDYFFFRFLQ*NFHQTYFSLWRILLLS**TL
FFLSWASRCFNHTKRK*RELEFFLFFFLLFMCAVITFFEI***VGSFNFNEFKFCWRY*Y
LYMLTIIFTTTIGIIIFS*SLSFIIKIFS*YSAK*LEY*TIR*KVSKKMKLEANLYLMSK
HTS*IQTFLY*ISMFFFFFH*RRFFHCCLNETGRILSTSNFSFSY*SDDLKILIFYVGTE
WHF*ST*LSHAKAKIFHDLLLFLSVLYIKIYT**SVNKDKD*RKTDCYLLILVFILCKYS
L*LAQFKTLSSTRVLNTHSLKEAISFSEFRLAGSLIDGPLIMYND*NVIVSLFSLILPII
LLSLSLKGESFKRGSSLFPTGI*DMVSVLNTSISNSGTASPPTHKNNSAELSIKYRPYLS
KRDIVAFIGSGRTVFPSKSGRPTSSGMSCRE*TVG*MLFIK**RGSVSNLFNALAR*SLG
TTPGLRAICLLSPFINRGNILKFAHRLSEVTEFILDIEISFL*AFKISSSDFVIKSLAEY
MLEFKALVTAFCVMKSVMAS*SADANTSLADSDVGRANVMTLILRSPVFRVNNVDTCK*Q
YSAINESSMDIPKR*D*SLGIVEKAHKSEDLLKKWPKNDVALKPVEQRTLITASIEISMD
KCLDNSLVNLVTSFKLVALKPG*KCV*PPEKRPR*DRVATSM*SSDARNMSTVICSLLHS
IVNVL*KESLHDSS*ELSFGVFNMPCSLLFFNFPMPVFGKVDEMTSTLPPVLFIKFDAAF
RAGPSANLLLCVS*KISGIFFNNVSRLFLQYFSGTTNSSLGIGKNGSSKSPISNI*IVSE
LSTSSSSSSSSSSSPSDSSSSSSDTS*SSSKGT*K**RL*STHIIAILVLPS*FGRNSMF
SKMVLAEVANKPFLTAF*ETSKRNT*TDGGGSLTEYSTGAK*STTEFLISFLSYLLIGAP
CKF*SNPNGTSFLKRHILHCHFLPWLMKTTKGFIYERQRRQRTMTPSVFSGTWLSESCKC
KYGLITMANGNFVFFSREFVFGTAFKVDLTYWYGTFEYSDGVTMLS*EMVIGRGGKDRSR
IGGGNSVNKSTGYS*LTTFPEPGNC*F*ASCVNELALLFNCRLPIA*AVWSICC*DCCCS
ATIGILAMYGT*A*GYTLFL**DIIHCSCRSLMEEGSSTKHTANEGLDEEFDEDPFN*RI
IHRCHRYIYVLRVS*TKSEKFNK**D*EVSEVKIDVSIQV*PTCSGDCRRKWAVLGQTTI
LKRLSLILGSKNMLYHL*Y*CMD*LRFSRGSSVNGCIPA*IRSPKNLHY*TEQLPPVVRR
M*KFLVFFIRIVMLVVVGKKCSGKL*ISL*EKMLRTLLSFIQGIL*MERMLLRRIF*IM*
KRSSITTWIRIEYFSFH*S*DTWWILQHGSISR*LDKQLDQ*FSHLNPLFSVHLIYGLIQ
WGTLSAILLLLGF*GEFLSSHIRIIR*CQKTC*ISCSKCPRRVSKFTVKYYTGKFLC*FI
NPLVLKLIL*SQTQHGQITT*SKFGNPIRVKLYILHALLRN**IGSKSLVLQRVRD*IKQ
LCWHNFVLRNVIS*SLSPLQLS*KIYRILYRQLN**WRGPLDPSKMKIMLKVYKTGQKMY
*KFLNI*YHSKKICPSIRLKYY*TNLLSVLMPCGMSTLELQL*SIWLPV*SP*FMPRRAH
C*I*LLHGMPTGISEKLHHNGSYKRNILQNSKMMVKLLDFSLKSRVILIITQPKIL*DTL
ICPTFSYKLRNWTMTA*G*WAQETSSIHCINSLI*SLIKIGKTLY*ILFVNY*KRRKGAD
VF*K*KPCL*ENLYIILHTN*SITI*LTYLSQLIAFSRGIYIFNVKFRNPILNL*IIRFR
YR*RGVSDCQIV*FWNGIQGKIATTHIIVSRMLLISYLGGHALRGVFITLGFFFRQFGNF
THIFAFVVIVGQT**GFDISKPFYHIVIRVYFEYPVVTPMY*SVRIRTQYKLVLALL*VG
FRLFGMLSDSTFH*WY*H*RCGKFMLIWCLKFM*KAWSEDIKPT*V*L*KF*SFLQKPRF
NFKSKRIVLIAIRDLFKPPHG*IWRHKIGNIP*NETIPFKIRVFVQYRGI*FRDN*VKYN
LGFFAKNSSVAGQSVLYFHYNNTF*LGP*ILQVIECLVQIIFFHQLSFDLLFQLQFYQKW
VTLWCT*FTFF**FIKKLHQVFSLLKLFVTGIFKIRLQSLNFFNLD**ISSQIL*PGYNF
TGQLLGTFRCQRGQIIMILGQHRGQILNGSTS*GQKKFLHGLVFIRDRLILVFNAEKGEL
HSMGQPQLLSNYFVLY*GGLREIYQDGTNNISPGRKPSRQDISGLRRSRYQYRQRGPRIV
LVRIILLLVAM*RHFWQR*HGRVSEGTNIIDIVIINIIIL**WNIIRVQRVRRIGASRSI
DYRILPIVIIYVQLSRDSGIGSHSVDRVRYRIALRKRRG**QGYVLAFLLLLLIGGIKMF
*PHSAFQLLILTSEVKRGSCTVPLVRHGAMDGWVKRITLS*TFACAVIFSCSRLHRLLIK
ECGMTRKKEAGIG**LLPL*VFTSISAIIRRIY*HWWT*ELLNIQASP*CVIYCSFILLE
CLPYLLLLLAFFSPMLARTRNCLPFELFIYKYTNHT*A*CDNFGARY*WSTYQRGQLGNS
LRGKLQL*MEANHRNAEPLTNCGSCCIKEGYRSRQCRLNPSTEFRVILGIIKA*ESKTLC
TTAHRQ*RHLRIISMKGMFAMTSTQGLWLLCSRSQLYFLAVSWSSRTSSSSHQKTS*VFP
NGKS*GPPSWVRPTQVFSRGSLALSCHHFRLFRRGFHSSFDTMRLQFPGALRMENHVTFF
LPLFRLTYINAL*YSLLYVLGYLGVLIDVLASICHSSFQLYLPAHASISRFTYCNLKKHT
HFHPS*NVASFN*AEKTFPLPRIRSVYFIKL*GLRSSSHRFKPVCFLRKVSHFRERYIPI
EKTARR*K*IG*ITSGYILFGCPGGSY*WFQGRFSN*AKKGAIGLQVSHQ*RFLQR*LYL
EYSISYD*QVHRFAMVEQQANQGR*TVRVFTVGSYSCEVFVPLL*YSLCEVYFHCIYRVP
TTSGFFRHQD*RYKQGY*YLQI*TESPYPSLPDRYCFR*FVKRSNWTSFHSLH*TISFER
LSMGI*KRCREIHSNCRENYL*IRVGHL*YLS*RRFVPLRRYGVSEYDFCYAHLDCT*QI
QH*CHRP*TCSLMVW*LSDQLFVESFLVE*RLDRLLRKKNYWCHSWRTN*TFQCSDWLER
FAEFY*FYERS*KIFHFGTKLER*H*P*RCLFHCSVRKGVQLTISLGNYFGW*G*I*SIY
*TLFQEVCQKIIGYFPVFGYFV*VLSRKERNFGFR*LGNLAV*TRYATKASFYYGFG**C
LSIG*QVGRNGSTFENHRGFPV*I*RY*H*GF*FKSIGFVLGNFDTKWPFQQETKRF*LG
QVSRGI*GTVRYLSR*HC*ITERGSCFQDVQISDLCQAARRI*AFGRLVGNCR*NEVCPS
RLQTIKLCRPSIGTCNFRQIQGHVSSNL*SSCETRFRSLKRDVS*HEYVNN*I*PTNEPS
LLLLWF*LVAEFCVVRYEFCTFVTCNRGKKKK*IITTNINTNRKNSD*IQYCRALNTEFG
TISRQIRIK*HQILQ**IS*EL*P*VLNCKHICIIEKLY*RVNLFSIFL*QVSRFTQNFS
MENIKSEFQSLQSKLATLRTPQEFFNFKKISKPQNFGEVQSRVAYNLKYFSSNYGLIIGC
LSIYTLLTNLLLLFVIVLVVAGIVGINKLKGEELVTPFGSFKTNQLYTGLVCVAVPIGFL
ASPISTLLWLIGASAVSVFGHASLMEKPIETVFDEETV*TLLQVLGKGVILFYCVFYSSS
IFS*FLSFILFLRQH*YLIVYRHHS*LQLASLFFLIPRIYNAVLPYLFMFFSFIKRAINY
*RFTCQNVKIIIT*PERGKIRINSSFQTNGYID*AK*LDGVRRRYSTVTNYMRL*D*LAN
RIPLLLLTTDGI*KVKRVNVDEVEFELRALPSFH*KTSTTLQNEIPLHHQIHQPKRTRRM
KHV*NSCCEKNKIKYFQSPGCLDEPKRINS*AISLAPKIYASTL*SDLDPI*IIWDK*HS
VNQAALLTGINIVKTASID*LHDTTTVVSQNEICQYDNTSP*TFIKHI*NNLITKRTT*D
KTRPSLAELPKV*MPEQLV*IRDSALPPLSMIHILYNI*DK*HSVN*SDKPF*QLVTSLR
LFILGLSRHSGITRARNTTTTRNNRACGLVV*FSLWATSCLNRKTKHARGPGFNSQLAPL
SFFTIRAEFFCLASINLTSHASPS*KK*THSMYVLQHISAKRMKVGSEQTD*KETSKTIW
GGLFFPPPSGIMKTR*SAIVQRPFRLLFLVRNIRNSRINYFSRKGIPNTYRKKIAALKGR
VRLLA*REAGQH*RQTSH*ALQVGYDSIFKFWSSSYSSSSKPLTLRPIMS*FTNKPSSPN
P*K*AN*ENFLLVFFSLVSITLLGTSRRTRRRGPEEDY*LSSSLVSFGLFSKLQMQYWLF
*KRKREGKRKLVLLLF*CSCCLFICFLITVNEKTCACSRKISSKLHYMENLQPSVSTGDQ
*VLSTVTASQRKAMIIVIIMSTRANRC*I*YLVLMYRNGLFLRML**KLWI*K*NKKRLS
SNIINLKT*IVR*SCLSLLPVQVCP*IKYINYSTPTMAYRRLRR*RQGAINHITIQKARN
LQKICPD*MVL*SH*NL*I*TQCHQLQ*VDSPLHISFQHHPLPAVYHTPQLQMYNEELIL
LQE*VHPQLLR*MTIFPLRRKMWLGEFPLVQNLKNRL*TRSRLLFTAVTCHFQ*ESSPIL
IFLLQ*HPY*VSIETNSSRYLNHCLLLHNSNRISTRTIYILYQGNLEWFKKSIGVQDPHP
PLE*SI*VLSMKQKKNKYRDHHPLYILTCP*HLPHMTNQLNPI*RNNQICCNRFVKDVKY
TMTWMTEHAVKAVVETKAP*EPSQRIIL*ARF*IVLE*SLFSF*CSPYVCIHPYII*IPA
AYQHKKGNKYLRYRASLHYGQDASL*DDFKQKLFISQ*SIPINMSNSSVEKFKISNT*SF
LFGYK*INSFLKIL*NSDNFLKHSSHISSAIIGDVNLNSKLP*TSVNA*GR**FNLSCTF
FLTMSNSINELSLRAKYIS*SNSSFTESTGKIILTKLL*RSKPVFSNRNFICKVSICLVY
SFSLSQTQMVIFRLSSSCANNPSKG*SLDLIKSKQFISIVSNDAFSFSFFFAKGKDVCNC
FNRTSFIGCSTIVCKFLDESNLLSSDSSSSAACVFS*ISNNSTNLFIYSDSHSGGSKSSE
EFFVSAMTVCFI*SS*YPIILFLEMSSNDFKLLIIELSS*IPFLSNITL*SFSSLTISKL
MIGFSSNLTICSIRIRHELDSDWMISFSNLLSMPFKNVLFC*SIEIGVSFKSSS*KSNSD
FTKSASFAMME*TDASTSPIYLIGSCADNMMGLEVVEFISN*DKNSSRILLDLSVVTLFN
NSLNNSRSLDRKTRLFRKMFKLSCSVVPWSFNKFEEDSKLYKKSIK*LKIFLFVFSKISL
TPIIKAFPAFKLGSVSKKLDSSLILITFFTTSKKMLSIVPLVITSSST*FKVNLSLIDNS
IFFFSFNCSAFKRY*SIS*STTLFVGTSFVSLLSNFSLVLCIFSTEEDNRLILLMIGLNS
SSTVICSFSS*DSKSVLNALLAKVPTYSGFMSFCSSRDNLSLFSSRTFRDFLSWTVA**L
INV*LFNILDSLFERTKFVVFLLEPLDGDTNFDKSRFFGS*FVKF*DSCCDSFSSWEFCP
NCLLGFESCILSMEDIA*CVIFLCRSFEPAPSLSTGKVALLLE*R*RSGNLNCRSSLPVG
CDCASEVKFSLGSGSGNSGVAVSAIA*V**STTKSIVSKLHWGFCYDNVQYTSDTTAFG*
IFTRMNYYLRCIFCMKASLRQLYVFCRLRRQVIYK*NGSINEQKAIINNLLIDFD*HTHR
*D*IPVFEIQFFPRIWNVLRVFLRDMRINKREVVIHAII*RFVSLILYVVTYNPVILLIF
RFQLILLISLYWFRNSCYPLRRS*RHNHTINCYVTVW*TVGFLLRHF*LKIGSC*ATGIF
LYYQATLDMAPECNRSYKTISS*RKITGKRVVTYVDEINKKDVNLIQMHK*SYRLLFFTN
SMHIKNCWNKN*PLLID*WPCY*YTYHTQCKKVT*AMRYNLKSSKSRNTRTDDVTE*CIT
TCNAKEEIIVLLRRTLISCHDYYILNERI*CILYIQ*YHLIK*RIPSIISKFMYHSRKF*
NSAH*EDVYISLLLYK*LIASNLYEICLHFSLVKEPTTHH*HLFIFYPYRVKKT*E*TSW
*RISTKAHNSVKN*LKGKLSCPHL*RLSRSAL*PARGTHFSSMGSKHWLFLANQRRIKRE
RLKVMRLNYKILFCSPKVGANQVILVF*KLLKGIVIRRKLRRY*FHTFLVSVYMQSIMSM
TTLSPEQQWKWPWTSKREWIICNNILVNTC*VPFWNATTK*TLYLGRWVVSSQRKNLF*S
LATISII*S*TGN*LSTK*RTYQMRLIS*SSTFLRKLL*RKESVKKQ*MKLVHPKFQTIT
TSPKVFYVLSTSVTLILTHVVVHI*NVPLK*VPF*FFPINQP*EVQTQGSISCVGSGFLC
MQNLLIKFYWILKTY*VVQKLKFLRR*QGKPNKFNN*IKENSIG*RD*HVPLLKN**TH*
KPVERKGLILWKKNTEHWNCCYRSTRKYLIF*KMIQKVTKLSYAVMKDKRTLAHC*FFRN
RVKKLPIWLLT*VRYYKT*KAVVVRKVASGKVKLHPFRMPSLPPSLII*AMISHHVEKCA
ICIRRFVVYIMVGIYRDQVSGSQ*AWSILFFYVVYNRQL*CSQKTRFPLLIIPKKKN*KK
TTSNMQTQSEGNYNFDF*PIKEIQTTGKEPLITRYL*VVLLIKVVHALPLK*GSVEPPLE
EHQLQSQEPLNFSFPKVKK*KKIIVITIKVLMKMKRLLLRNLR*LENAL*KALP*PALMD
MIMK*VMRAPLTPRPRTPKQTL*KIM*L*NRHPCKPTETRRYRDPAD*LH*VRTTKVVQV
LNRHFSILPVTVMGLRDVYLQSPISFLKR*GLEALQKTI*I*KLSKDIGFWANLLRLRNQ
QVHTESVLSPKFLHLRQ*PILWTGMNFRQKLLHQEKLMRMKIM*LAKSKISRKK*EMGSL
LNILSMKRILRWQSCVSQTFLLVKYLKTLKNLKWQKRQNWKREGILENSECAHDKNLNHY
TH*LKKNRKKKRRRERKKEINYSTLTFLSQTAKHIRRSN*SLTLMVLWQLMKRLWLLTDT
KMLVSKMNIKKKLMKTLLPIFIITGRMVGVHTQTRGLWKK**SSTRRFLCGGQISI*SHN
YTLIDQENK*RPNSLMRRRNVQY*LNWPFDLSYRLILMSIAAKSRRTLVQ*QTSTRN*SN
YKTSTNII*RKSKKQRIRQRRKTKLHKG*MMLI*IKRDLVVL*QMI*KFIEKRKLFWVQL
MT*KGRNSKKGIMMTMRIMKEVKKSLRLINKRHLYAYIMDK*HNFLLYYIIFFRCTAASI
NEAMFGRKNWQRKQYYESYI*GSFYKQKKQKDDMISKEYEFGKTSILNRKKYTLVIDEDK
NGNFIRFTVLPVSNRKFKKVKQNGRVEINMGIQYHQIVLILLLNILFYVICLRSRFLEHI
NRTFEVTIARSFQILIIMGLFALGTIILVRGPSVETVTIFKESGLQLSRVKGMVIFPQQW
NRKFFEQVEFISNERIIDVVINEGFCRGFRVIFYLAAIVRKSSTLKLLFPVCIQANLRLF
LTSTI*LEILTQQCSQICPVSMTNV*YTTYLENISVSKKNP*ADQKIEHQIIITENLETF
WYILIF*CMFIYNYR*EFEHT*VAEQKKGELFSLHGR*FVDDFIREVSSRRGTTNISSGM
LTFCDRFMNCL*DSSSIFIQTQMVQH*RGGKDHGSWVSHILAFNI*TNMSGTWFEDSIVP
AKVGTCHQSWTTDQSSANVA*DGTVH*RGN*DIKLMRFGHRLHGGIVDNDGRYVNIRIFF
LANFSYYISEQTVT*LHDICLMHSCDRLSVVFLGEVKGKSGDPFCLRSSHNFQRFHYTRD
GFMFQA*ELTLRVFSNDNQIYVWNSSLDTLQGFEKGHIGVDI*LFTQSNV**TVTCLVSR
SVP*PLKTNLISL*RLNSFIDAFLMICLLNVYSFPVDRDIFSLKNGSH*ISDFFPNTVTR
YQSDGETTAILLG*GAFRLSGSG*SSLSNCSVKHFSLTIMEEKGEE*G*GE**TLIVTSN
IKVLLK*IYGRVKKSINQE*ANEAEENKKKDLWKI*IVLCAHPHKTLIYIFSVGMYCTGI
YI*GSSFNR*ITIPSYQKK*KKVSAIWLVDE*PMTPDARRRWSGTRDSPKLGAEKNLISR
TV*LLSRDSNVSHVLSNHHPARTFVPVSMLTSE*ANLTPLN*FALSP*RLSSRKNY**FL
PPPLSMSNFEMNK*ADIEYYKYLGSNDSRG*VRAVLF*FLFVFF*KPQPHQLQLRLQISI
ITHQNERYRIFIYIHIESQLKPTRYLGRQCQMGLPDEQHTANFVPRSQCEGPVPSHSFHR
LLRFALQRKLFRCLARRSVHLEKCC*HMSLRGFNFEGHFRVCHYLSKS*QSYYLWPH*LW
WYKDMFN*PKGSLTKS*LFSSVQVLRRY*HHVP*RVTKFDPFENAT*KISLPVAL*RQKA
V**DY*KPYCANCCTKWRITGIRSALQRRGRSTANS*HLHKSYPKIVLASPIYLYNIH*N
RKTFTK*TGIFSPTHINYAL*LL*KKRNHT*INVLIAHSMFRYTLSYLLNRNDGKKIMLP
IGFEPMISTLLVWRLTNLAIEARYYGL*SSKCQI*RIEVAFPINVCQVETL*HTLSINDY
ITSKASNDYLKE*SQTILKLAKAHDPNGNDNNIYEK*CSRKLR*GRKYVKKIILSWIRSS
INILDN*VCCVRDRQIRLHRNKLL*FKGTC*C*HYK*EKVNSGSVAFNRNNI*FTFKQFH
IPL**NIFAYVFICFLFFFDYFFSKTKCEQRRKRSIKE*IIAVLRVLEKES*IVNGLVFV
LPVLL*YGS*EDNIKHRNSCQILAQF*HSLSYYIINPCISTFHQI**FVFNLYVFFLHRI
*YCWNESN***HELLW*QSNAYIVY*CTTRIRLSVIAPIAEGMLNEKLRQY*SCVKDLLV
EHDMVGTYMRNMSRHINV**LPESLLYWS*LI*PIGVCFIYLSYLV*EDQYSLLH*Y*FL
TSNYQQIPC*YYK*Y*TDDVRVSF*KECGF*CNCWDSIFYKAIILGM*IY*KFSSRI*ES
IKGNLQFYTIL*ILLSSFYMLIFIDPITLSILAFQLPLI*MTISHHLRHLLTPYMIIY**
RKY*LVDDS*FLFQHTTHNVIDLMNPFVS**FKCFYRKRFCHHISNVLLGLDVVYV*IIT
*YFISKSHCLCAKKSVSKFLFICRLNYTDR*STISK*AFNNWFLVKFLHKVTEVIQ*RNS
FTDCVYFCFCS*SAC*RSLCRLSSNHFSVE*ENVTNL*LVIWLVTI*SIAYCD*FIIWLG
RFVFVPY*LFISSVPHELY*LICHV*NLPRGE*YMLSKCVDVV**VKSKFISNI*S*TNQ
LLHFMYFLFVFIFIYF*FILVYIMTWLTWSSKFLSFWVQRYV*FG*FFCQGFFHT*FHVL
ASLIFDL*SKYVVLNVVITFTQIYYLCIVLFLECCYDFLICI*VFAE*YHIINE*ANCYL
TIFKYA*PSANFLHVATIY*I*FNGFIPVCTTLFQTIE*FSQT**FIIQT*MWWRSYV*F
FFDISI*VSRGYVQLCDIIVVV*CD*Q*RHQCIVMYGIGLHIRIICIGVLNVASCNKSSF
VCTITFLVKYKH*VYYFFRIYVISIIIFVCIPSVHFQ*LANFFMISFNISVFFFVVFIIS
NCFIIS*GRSNWFDRFHSFYCCN*IYAFLRSWWFQTSHILIIPCVSGYLNFSFIIF**SF
LTFGSSQNIRIIHTTQTGISLTRVYVWNIF*NIRSVRRRLMG*VRKWEVVKNRISRNIF*
GFVRHYIRSRMVRRSIFWRIRINGGCIITYSLCFYGDDGSSGFTVGRTVIY*GRTICSPV
FDICITISLNIWFLRTTQTCSFDVFKSIINSIL*GQINHIIGTTRSLLVSCSEGRRVSR*
SSI*FNGTNHFGTLFINDMGCTRSYSRWKNIVFRYVGINFFWCTYFLDWFLV*L*RVY*L
GREVVH*RIRVYFNLRLIVMIRFCILII*LLRFILFNKRLVMGC*TIEIIIKSECIVVEL
VQFRLLVL*YNVIGSIYCLF**WKIDNIAIRVS*RM*GVTWNATRMYFRVGIMVVNYNRL
TER*YSSNVQSS*TCMLSCGFIVFW*D**ISDYSRKFDC*EP*MIW*TTAMKQCATIV**
STI*SFSDTVCSRICRGCIACSNTSVRKELMKSFVSVLGATIHLDN*NASIELVLNKC*Y
RCKNIEDRFFTTVV*WVHPLESGFLICKRYKVRRCTFR*VMYRTKYIGMQVLKRLI*FLV
L*S*SFDMSMFRAFAD*TVRTLICASVRPFNIRFLQICNCILLKRLLNTSEVSMSKHSMY
*RIWIFIYAFAFVDVVYC*L*NVRRN*VFFR*PVKVSMFDYGS*YCTIRSF*SVSGKAGS
NILISQLTQT**IIGYVWCV*CFY*CFGAVLKVEVKITNGIYRNVLFLSIDYVYFRIGCC
MV*IMG*SDKRLRSS*INKKVIR*FVIRVYCVCWLRFFLLLA*D*VRCHRLSIVMKRLIH
*CDHCSPLRIY*M*QYCELLLLLVLNYLFSDNYEL*PLC*SCLEMCEKHFCIRCVVCIGT
VYLDS*FYFRHILTEFQRIIGKVSCSFWYDIDYVGI*SHRIDL*VLVDRPICR*H*YCFL
LASE*SY*L*FQMYQQMYFRRTQGWQELSNPLILDC*FAFWTHFYKGL*GCQHN*FLKFV
LPMLAINEMGQMLGRYCIYTHVLHKSFVF*FHPGHLE*CHRD*SSSKI*CKI*PM*KSFL
LMLKCVVVRRYFPPLS*LEVFQSVDFLNRLDQVRKYSVVGYTVATDSVGPVDNTQVTFDN
VNTSS*MVVGNVPS*RP*LCLGSSCRAVGTVHSVEVVLKQVEERHDDGSLEQLMSQVLSL
VEN*P*WNLYQIPVNWKLKRLTDLDLMGLP*K*PKHRRYHEEKCGF*CNCWDSIFYKAII
LGM*IY*KFSSRI*ESIKGNLQFYTIL*ILLSSFYMLIFIDPITLSILAFQLPLI*MTIS
HHLRHLLTPYMIIY**RKY*LVDDS*FLFQHIPIPLISTFCMSIYKTFFKTNMLFIL**Q
FPVRQKSP*NNRACGLVV*FSLWATSCLNRKTKHARGPGFNSQLAPLYFFTINVVFHLFL
F*YFFSTL*KRARLMLEIKKKNALILYIAEI*LL*HCTNKRSPMKINYDLEVSTCLECML
RFLSYRVVLPKSLADVRHLFRCIVFMKLVWFETTFHGMFLGFLVFLLPWPRGNRFFLNNK
RFV*INGTFSVVIS*DVHFFRVIPKIFWNI*RPLFVFPNFNATIFTTGV*HVAMLCWYKN
ISDDLVSMGVWDNNTVFSIHLLIFKW*EAQLSTIFLGFTGCNESRVNIYHVVTVPYFSYI
TKVQGLWLFQFVRFVVQFVNCKCFHM**CKYPLWGQPSTGMY*RIINNLV*SVLLLILFQ
VINVRVTIS*TTEQNIDVRRMKFNTGNVIMVRVN**SQWSVPFANIIYVYSSVNSLQFGT
TGQ*TMTRI*GNKGGVGLVLNLSNAVIRPYIENFHRVDRGATN*MTSREVATDDLHIIDC
SFARLNLLY*FTSTPV*QTYFAIT*SS*KTMFITRL*LKTPIF*PERIRFN*RITSHALE
VNLRFSNLSSFYLHSKTSQCLCPNDCVRAL*SHLTFLQSGLRKLL*ITLPMQKKRMVSSG
IEPLIPALLARCLNQLGQETTVICFPPSLHTTKPTSLLCASTTAHYPCATKLNLHCHSNF
RQTPTEKCSYYFLSRAH*GKTH*MHPLQILISLTFVLY*PSNPPCASRSPGSFVVVK*TN
TNKTKTKTKTKRHSNNAELFKAGTLSACLSQLFPLSLKTLFKLGLHHRKKNHPI*SSNIN
LRLKKFAKALV*FCFSPT*CLHLSRSSRPFATRLG*TFNGLICNPPSLFPKAVPLKVSQP
SVIPYKKTSDQLRNHLTSTSPKILSATFFMMSRMLRSGTCIRGIIPVILLLRLALE*VQG
KRQKTYPRQW*KRQSFLITTMSP**TNYCQRLLPCTRKKAPL*QPPTSYPTP*MIVAT*C
FLPPPTTVLCSHLLLCKEITLPHLPQQTLRQKTTNRYPH*PHLLAHPHQFIRHGILLILP
TYRHFQTAISHRLTQK*LALISAAPRTPEQKRRMNLSFQLKFTAQ*IPLITTNIIQAKNL
NKMPALLLPAIKI*AAASGPQRNFPSLTTR*LL*FLHTCNSTLTGHRTGLKAKWENTVHS
F*EVQRTLTTIPSNLNLSAR**LFNTCF*TNNLSPEGTTIPQIKVFHSGRDPSTSIQCPA
TTNLWRKQSAVFIHTNTNTKVSRGLSPTPFFVPGKTHKEK*IWFLITFIFLSMSARRSL*
TEKETSLSIL*TVRSILTFRSSRIRFFRPTT*YTKAYRIPPNNP*F*VLAPPSLRGRFRH
**TYARNLFHLLMTVLPATIIALLSLPCQNHLNHAGYYLFVSLAQQQN*KLTKSSGSTHR
EGISK*PYQCILLSMGQKAGYENGSQLLYISEPSEVPIVRTVWHG*RNTFNEQVSLHITS
YLPPFSSGAPLQVDYHFPLVIVVIYVFIV*FKFYAYSSINPMHQKGGKEAVKQRPLPSLL
IDRSSLKRFLRERRAYLFTSRITGPLK*RRLFTTSATETTVQLS*QQFLHNGINLYKTLA
RFFNNKSA*GTQHKL*NRHCFPDTAFLTRDSFLNYFFFQASLFRWNH*VFSSIFNLYSAS
FPKHKLIQRGCQ*QERARDHALLQRIKDNRPFPCVGYLPNRTLSLGRCNNCIYYVNNHRN
HNCDCRTATTKQSGNRFEYCY*HNSNHAVSFQLRTI*VEGSFENNFLCAELYCPTTHRLG
LSSEVSAGK*AE*RC*YGKNGRTGIWGNGRQNLRKGCRESFY*NGYHSETSVPVRRKQPA
EMSTHDRRRKLDSAIPRFVYRDML*PVHSGLAIPPQPWEYFDFRCWISERLGVRGYFIEN
ALCKRTIHTFWRLYDRSTGRHH*TGFNS*QRGLAGGKKRVRGFIERPA*PDVTKRPYVLF
KLAIDGAAPGCTHHTPTYPYMYIVSVSISL**VLIKISICEHSNLFPSKNIQRH*VLRLA
NLEAAGNDTTAMAFYSTYRLCQLHKGKINV*KKRLHPSCNCKIWNAQYVRCATG*VFIDL
*AFDY*TMLSIFLMTRVKNSRQFPPDGKKAGL*FKEWK*K*FCVS*LERQEKEILNNDTG
KEDSIEDSN*IILSNF*ICYSSAFYLLSSGSIFLFHLKFKRRWVYIKQRMMREVIRKAAA
RLTI**KMRQKSYD*SRKMASY**TMAMVEISIT*FKKTSSSV*NLTKY*SDFTGKKSQI
FLGRSLMKTRMTDMILMSTIKRL*K**TH*ITSLIKR*FLPKTLATSLGRYTVAVSHDKR
TFRFCMKD*S*NPSWY*FRKNIRRKI*IF*S*RV*NYIKLE*AVIRSHLLIYRLIY*QRH
*KSC*ILRINRY*YIVIEANIERGV*LVV*ENYKIGR*R*FLMSTDVSHFRRPGRLISSS
SRCMTMTKLRGLLVKTTGCLYNGNM*TVITFT*LVSSKMMFIDNYYTWFLAGYKITYTI*
ASKN*PRNYVCKR*ITAYIPSSCR*KHCE*IDE*CIKKGDVCMMSPQSKCIEKKKFPLYI
HDLSPLSLLANLISFFWIVTRLA*IAARLVSSNKETKYASTDSCKAPIAED*NLKSVLKS
*AISLTNLWKGNFLINSSVDFWNLLISLKATVPGLYL*GFLTPPVDGADFLAALEANCFL
GALPPVDFLAVCLVLAIVECLLGSFSKRGRTVGRAKVEVTKQWSYIKEQEKDYLYTTAVT
RSNAREHNTLLSRKLCFDTEP*P*LCVTLGDNER*MTNSHP*EPLRACQ*FHALNAKCSE
RTTVVVWHRESGTRPRVSHLYGRTFWELRVSSFFGREMQTRPEQNN*QEGV*FNMLFTRA
WAVVIRLDTYVFVRM*LYHI*VY*DEAVKEIFFFSLNLFFSLSFFLHLVQKSSKNNNQYN
KIMSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAV
LKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG*TIGG*TIGV*NYFH
AFQKIK*RSFYWEYNRTLCMHFSVFYYFMYYIY*K*VSIKETSFRTVLDSLPLCAPPFHC
R*VLRRGVRVPSVG*ADLPKYLRRNPWNPQFHAFSWDICTCSHTQIPFPRRRPRFYV*IL
SHWLSRRIPHSPWHYVDNAVLWSVYIRCL*NSVHRPNPELATIQ*SEQERPPIFPSKIHH
FSPNIEKNCCKCHCRTRLAAQSQNYSRNGIDCTLH*KICLLRYAS*SEPYVSNSLFPLCH
HLSVGNHHPFSKAARWLSFRIS*PWPENHS*SSPVTPDHRIQKCRNPL*IVSIMTQA*RL
FD**SF*CV*TNLGLSNTIRG**S*IHISY*FGASPKRDRR*YHRKTQHRVPISNTIRTS
VLAGACKIILNKTGTSYDMILSFRKVCFYHLDPQLRCRTRTYPLRHWENSKISHR*CQIP
PARPL*HHVLLL*SPLQTAGHLRTHMDSGTTD*NALLYC**S**HLLAPRSLLA*QTRHS
A*CTMDSTNSPEYSHNSNKRVCPSSSQDPSWKTEENFP*FRLRMQAQIQVPHTWL*RRQS
GCTSP*DCNGYIPEMHLSSFLLATSATL*RCAVLRHIY**HLH*TRLFVHGSTHIYYFAF
F*RPFLECLPKFFNFLGIIHTPHA*SVLSKK*EKKQIPKSTPPLPYPT*WQLAYMLGKGN
YWS*YSATCNLPGAL*SHLIMLAVELQL*LHFSLVATSPLCWGLKSTSAHLTIAKLS*IT
LY*LISIEAECLLRRGPYPCICALHERAIYQRYVFLFSFRPSCLPSHFSHLNFFYHISPI
LSL*TL*SAR*STIKRAGNSHHSSLVRLYTLNASKTRLYF*SRLEVSSDSTRKMSFSNGN
MASYMTSSNGEEQSINNKNDIDDNSAYRRNNFRNSSNSGSHTFQLSDLDLDVDMRMDSAN
SSEKISKNLSSGIPDSFDSNVNSLLSPSSGSYSADLNYQSLYKPDLPQQQLQQQQLQQQQ
QQQQQQQQQQQKQTPTLKVEQSDTFQWDDILTPADNQHRPSLTNQFLSPRSNYDGTTRSS
GIDSNYSDTESNYHTPYLYPQDLVSSPAMSHLTANNDDFDDLLSVASMNSNYLLPVNSHG
YKHISNLDELDDLLSLTYSDNNLLSASNNSDFNNSNNGIINTADTQNSTIAINKSKVGTN
QKMLLTIPTSSTPSPSTHAAPVTPIISIQEFNEGHFPVKNEDDGTLQLKVRDNESYSATN
NNNLLRPDDNDYNNEALSDIDRSFEDIINGRKLKLKKSRRRSSQTSNNSFTSRRSSRSRS
ISPDEKAKSISANREKLLEMADLLPSSENDNNRERYDNDSKTSYNTINSSNFNEDNNNNN
LLTSKPKIESGIVNIKNELDDTSKDLGILLDIDSLGQFEQKVGFKNDDNHENNDNGTFSV
KKNDNLEKLDSVTNNRKNPANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFA
RQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTESGRRCITPLYE
EARQEKSGQES*LFLFF*ALNRNFFFLYNKYVIS**QCRNYG*SNPCKGIIWLLFL**NS
IKQ*YSYGLIVFTPV*IF*AAENNGK*QKVIV*GCVLRGKSFDAK*TKVAQFNMTSSSGV
DNEISLDSPMPIFNESSTLKPIRVAGVVTTGTDHIDPSVLQAYLDDTIMKSITLGQLVKN
ADVLNKRLCQHHIALNAKQSFHFQGNTYISDEKETHDVVPLMEVVSQLDILPPKTFTAKT
GTNFGNDNDAEAYLQFEKLIDKKYLKLPTRVNLEILRGTKIHSSFLFNSYSSLSPQSILN
LKVFSQFYNWNTNKGLDIGQRGARLSLRYEPLFLHKLLHNPHSNESPTLFHEWFLETCWR
STKICSQGTSAPYMYSGTMLSQAGDQLRTILGHTFVLDKRDHIMCPTKGSMLKWSNELSP
GKHLKTQLELNSVKSWMNDDFITFSTTIKTGYLKNLSSQQSLPVHICDKFQSGGPSDIRG
FQTFGLGPRDLYDAVGGDAFVSYGLSVFSRLPWKKVEKSNFRLHWFFNGGKLVNHDNTSL
GNCIGQLSKEHSTSTGIGLVLRHPMARFELNFTLPITAHENDLIRKGFQFGLGLAFL*EY
IPFNVKVKLSPSFPFNIFHMLYSNIFYKSLTNSCAARMVINS*FRELRNPIRLP*NGGAT
FSVLKVAAHVLKA**KKPNNL*NKMADNCARR*ILIYRTIVILSFLLVVRVIAAMRSLSS
TSFHTKSRL*CCSILLVRVHLYICKSIIKHFRKGRKCF*NKPTCSSILTWGAFNISVSLS
IWPAIRISDKGFVVAHTLKNGEV*ATVHPS*MCVISGLLQ*TKLKGFFEHWRKKH*VRFF
KFNTCQGPTQLSTSISKQFLIMHYNGTYSQYVLTFQYHVKQR*SRTKHFQNGSSPP**LN
LQA*RFLNLFFA*LNCRCWSKIQSM*QKLYPLFVVLVPMIV*CNLLLNRIHNLLKIYKRF
CHKTIKSYLNRRTRIFRISDGFRSRRC*R*SFGWFPMNGNRNE*TCNSDNMRRVKQMNII
YITVVD*GPTVL*II*R*CYLKWRLL*DLNNLL*GLIRVVDN*VTFQFF**VELKLSNFS
RVRRNKFGP*GTGFTYQSSDILRAFFNFAC*IYTRSNQHI*VYFSN*SLY*KP**INMCC
SQCILSYI*SPSKLHYQEIAVDP*IIIFIIV*VSVSYWYILCDGLFDAVLLRIHYNIQTL
RKQLALQ*P*LLPLFSQ*CLGILPMMPLCRCPEAPRHV*LLRFRCLIALQLKFERAFFVR
TI*VLTRLLPHQ*TLLLYEP*FSFMKNEFSMFFRGFYIFSNI*RSKKITLFILCCGKELN
SGLHLFSNFFSFKVLQSMTKESSQIEAYKME*NFFYSVICFGLKVSHQFVCGKRNEI*KF
*IV*INSLRRMPLGILLLDLVPLLQGTGVFFGTGFRLYGI*TIVMTIALSRAGSSNPMEL
TILGPWIHPFLFF*QFVVYTTF*QCKTFA*LNMPN*SNKKSE*LR*VIYW*TCVRRRWNS
E*FIK**NTNATESSSEFQKETWTRLLFYY*P*LFITYHCSSFYIIDWAPRKFLSLFGSI
QSQYGVVYGSAVNDV*NEQLCVLIVTMNSLLKSL*RSNR*ILNTKHYKIKKNTKVFIFLL
CVLAHSTLTCTLSDDRIKETLRLNPLILFVLKGTAPSMTLICVTLNPYD*VSSNQLLN*L
MAIKIHAKLTYGLALSPTRAIFQKAPKTS*FL*RSRRDGHCP*T*EHEQISNNITCRRER
KLNNADIFCRGKRTQLCKVNRSGSLVILQTMFTAVLSLSLSCRCSLY*RSKFRSRRAVPP
CVHHTTKMNVISFFHELQMSIEKFITKYNKIRIIKR*IHCVRLLPDKLKQVGSFLKIMFK
FTKICNFKNVKISFNLVEKMFISFSSLLVSHQDYRWVYAVSEIK*CFF**WKSFLEIHTI
SCQN*INVICLHSTFLR*EICRQRLTPPKFPRKNFILNFVQFYISFQ*WYQLVNVRNIYF
SAIVECVFFQQPHAQSN*TCTTTQF*DFFKLFRTIDRLT*QMVN*FLEYVLAQQFASDPD
FTATTTFTAIFTNFQCRQ*FSTEGKVCLTEMLLWPRNN*ISKPTKYTLHTQYLTSRVFIT
F*GKLWAIFLHRACSS*LLNYLNTKNYFQCLGVRDFSFGQAKKA*EKRKISSGFT*LGFQ
IIISVLLT*HSVFSIRLRER*YVNICRSSYFSNDREKQEMR*DEKK*KLDISI*LEFRVI
NNDTLL*FMYYYPLQDYPLELRAYPTFFQVLLQLNTTKWNRPKMPLWP*NRSVQPKAPCH
VRYSRMLFRNFQDTLVLFCHHQGLGIEDSLLTYA*DVVQKISLDLRQYFQQPNFEPKNHF
S*PPLL*VPYLEPRS*LV*LWCELEILVLSFPSAIV*MIHIVGKLLLMIRLVYCLRHYLL
S**IQISWALCPETRNIGRKLWLVHG*SGVEEAS*V*NASLNVFYRPLIY*E*LQFVNTI
FLALNILIMLPL*TVTAVLQML*QQRPVFLTHLVHYL*NYWFLP*FQMPPSIPLVVSKLH
ILHCNPARKIQLHLLYHFLRHK*HFF*SFHIYNKFSLAWHKVNRDTLSYHGTV*DIHDYN
*AFFAHRSVYTPFGNFLVNDMFFGRYDNSKRVVSHILFHMIRLFENKPFSL*FSSHIYKV
*IRFPYMAGTTHPRNDRYVALVYDHT*IRHAQL*YMDDYM*VASCHNARVQEQLYCHMGR
PDRSNHSLNRADTFLGDIFSDIYEFHMIGSSYTVLGRYVLLPQETHPTNLAF*TSFSSFL
SPMAYHCSTYRCIYVYGMTSGIRI*YCSEAFLEIHMELKMYFAHKHILHYQFASRVPYRL
YHDK*RGTNVCHILVVYRILSRRLVSDHHNAYEA*SVPLGLSGHRDKFSKS*AKMGMPFL
H*LWVGLCKIL*MNACDMSSRQLYYLHRQTRLSTCSHFHPSTTYRTWETLFHYTLC*HEC
GYHSSILFAFSDYLY*LSFLDMAHISQGGISFYRCGWSKIKAIHILLDS*SFFS*L*TGN
KRYFSNAYHSGT*SRPF*YTLDAALDDKFWNNHAYK*KHCRFVHMS*DPADSDQD*QLYR
TNMWADFLPELFC*HNSSLDISIFYLRFFPLILTPILLCIRNQTLYNISCKQTFGTYNPS
LLYKSYKHMSHR*KFPGSHVRNIAYHHHFPLHTN*AARWRLQHSKYTHRLGCDVYKCHRR
LDFAPGLKTHVRSFVMPTTANRLEQSRLTLFHLVVATVARKNFYIYDLFTELIDNFYNSI
LPENLPLCAGCIDY*NVFSVVLQQKCNNTYQIYTYIHECSESLISFKTDSKETNTTVTFW
*CPDTTLGKLLRVIGDSISKNLFELFYLASSRPRRNNFSFWRYFPTPFSN*LI*KKVYDD
SFIFFRMNGTCAVYYFFSRWETHCMLYHLELK*TQLR*PCL*FFLCYKLLLLIRHNATIV
IFIINFPSIK*VKKLTTKYTATGAARIYNKTSNVLIFFRSSELCKITYIDTDVGRTASYL
DHFL*NFCSFRILLESVYSSIIVLRWFGIYIRGRMGSLITWSRAGIYHNITWSWIQNVGW
KTRSTILNDNLPMLIKLMCCNFVRRMNSKQVWNKLIIIDRPRN*FRPFVYL*SKLLPQFG
*HRLSLTIWMAF*WIDSNPSNRRKVIGNILA*YQLR*LSYFQFEFQFDHFAMQWALKLQN
IIFDGVFAHLNSFLLRQQQIMAKQ*QS*P*KEWFALFLGYIFQYVCLFHHFLQIWFIFPT
RIENCINMFWITFQLISFTAFQYQRLHRAGNPFFCSLLLNIF*HPCCIPVEIHAFS*LTS
Q*NTW*RTSSSLNLIEYFRPVFFFLTCHFPAPFGNLEENASFQKFNQVTN*VNRAGRKHI
QCFVCGRNFYFS*MF*FLVT*FT*QNIEKGKVEHCNTPNRLSMDSVMVKKEVLENPDHDL
KRKLEENKEEENSLSTTSKSKRQVIVPVCMPKIHYSPLKTGLCYDVRMRYHAKIFTSYFE
YIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKE
HLEFIESTEKMSREELLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLA
VVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQ
DDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQV
VMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGY
NLDAIARSALSVAKVLIGEPPDELPDPLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANS
GCNFNEPINDSIISKNFPLQKAIRQQQQHYLSDEFNFVTLPLVSMDLPDNTVLCTPNISE
SNTIIIVVHDTSDIWAKRNVISGTIDLSSSVIIDNSLDFIKWGLDRKYGIIDVNIPLTLF
EPDNYSGMITSQEVLIYLWDNYIKYFPSVAKIAFIGIGDSYSGIVHLLGHRDTRAVTKTV
INFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRVLRCDTD
GLNNIIEERFEEATDFILDSFEEWSDEE*GKTGH**FFFGNLHAL*KLNNNKVVTMFIV*
SNISKIGKRNEQMH*AVFY*VLWENVYIKVDAYIYNTL**RFFEHVTSLFRDRSGSVEPN
THLSKDNFRPARSSGFGGGLGFKCEGLGGGVGFVFLSFEIGPLDFSIVGLSISPFSCSLT
LDIFLALNDSSEELSLSIIRC*MEFFKFCLDTSKSS*DGLLRSSLELSIVLTNVDLKGEF
SCFKFTFVDVGVKLVPGRLDEVRDSFTDWFFFMLPRVE*EPRDRVFFNSSTSPE*DSSEE
EEESSYWGIMFCSGKSIELFCLKVCASETIACFNLVAEFALSSLSLFETLLASGSTSGGS
NAWYIFCDLSKSG*EPLAELLKLASYAICDGFLLGCICAVVVLSAMLI*NVAFGIVFSMV
VGEFKLRIFCVAES**SSVKFKWLLGA*TTCMSFIGHGTFCIIDILFSS**TLGLWRGS*
TNISRIKPFNCSL*FGYNGNSNFPLNMARSPPFSNGVV**QSLYRKIPSAHISDFSSIGR
PRNVSIISGDRYCAVVFFKMSC*TYDSSCEFLGGLIIPHTEPKSQSLYSLLAEIRTFSIF
ISR*INGGCKACIAATP*VTWLIICKISNS*SLFCSLVFIKSMRPPLSQYSIKTNTSYEP
LCNIALAA*ESM*DTTYLLFFSNLIASTSALKVFRLGLSGTMTLFKHATLELECGSGGLI
NAEYT*ANPPLVRYLMIST*CDPTVNCVPTL*VPI*G*FMLIYLVA*NT*LCRVIFLSQG
KKLAKKI*DHEGETISTFRMFPWPILILLS*KNYFFCTLIYQKNS*INKA*NSDPIAARR
KRAMHKHEFEITRKS*TNLNKPWLAAFFRYYPKINVQLL*AQHTYLLSVSGTVFRNPRLK
C*N*EAGLCSPY*MKRSYKSLAWRSLPRVYIYNTK*LY*GLTNIRE*GAHRVSLFKLILW
RPWPFESTIKSH*SSIIPGCFQVGEPQDSMPLYIFTGKQV*VFTD*NFY*DLLSEILTDT
MYM*G*VGVWCVQPGAAPSIASLKSTYGRLVTSG*AGLSIKPRTRFFPPASPLC*ELKPV
**CRPVLLSYNLQKVCIVRLQRAFSMKYPRTPRRSLIQHLKSKYSHGCGGIASPECTGQS
ISL*TNRGMALSSFLRRS*VDISAGCFLRTGTLVSE*YPF**KLSRHPFRRFCRPFPQIP
VLPFFPYQHRYSAYFPADTSEDSPKR*VVGQ*SSAHKKLFSKDPST*MVRS*KETAWFEL
C**QYSKRFPLCFVVAVRQSQL*FR*LLT**IQLLHRPSDKVRLGR*PTQGKGRLSLILW
SKA*SRARSCY*QPRCINLCLGKEAE*RLKMEEKTQWFQRNKDV*KKK*FRNESLVRKAV
SGKQCLFYSLCCVLQALLVLKNLAKVLYRFIPLCKNCC*DN*TVVSVADVVNRRLYFKGP
VIRDVNKYARLSRRNLLGLLLSIRKLGKGLTWHLSKAFALLLLSRLFGALG*LMNMRKI*
IRL*KHI*QLLQERW*ST*RGAPEENGGKYEVMCRLTCLLKSIWSAVPNSSNYQNF*RFT
DVQKLRAIFVTSFLSHAQKDALVRSLRYSFFVSGARAFY*FLVQLLCETHEQVAAGMV*M
VLAR*AEERYYYCGYYSH*KMEWIPCICLSVPETPSQ*GRCQDSKLRIVRRDAVSLRILG
CWTEKSDTA*SEC*DRPYCLKYRE*CFLFGLKTSSRRHREKNECDQEPDLFLFVCFSRDK
KWSRAQSSGNLRICIGMNKNGTLLPP*VGRSWALYRS*RVSSRMEYFYLKGCSTFWAQIV
RLKAGIEQLSSCAQI*IRGNRSQCSLYFSERVDSIFPFCFQTSSVACQGTVACMKELQ*S
TCG*TGKIPLWTRRCSLYFDCREQERRHLV*IFGLDNVCGDQWNLLGSKFQLE**IHSSL
LFWSPWCGGNQSKSLLR*AMRNCRLEMTICVENEEDSMTNKLMRMC*QMRLVRVPIRCFL
MQSLLWEMW*RYFFAQEKMGA*HGCGRRKKTSRCKYRLRSGIRGRRLS*RCFLPDAWQKK
LAVIRLLW*HCRD*KGLSLLPLPRVCFLAPALNLLQNKPQQKNDRNDSSYTRSRVEHS*H
HKKSC*QDLWTG*R*VVP*LV*CFLVRYH*RLRNLQRNRFREQTWRIAN*AIESLAQPCC
RRP*TPGKM*TLCGRKTKLDQRFSKFFQPQIDI*RLDRMVFFPVV*AKLKQGFK*KWK*L
**TCGKSASLK*FRIVAMSFCFCFCFRLIGICSFYDHKGSRASTCTGRVAWLIQCKGQRY
*DL*RVHSMSFSFNVP*KGSSTNISQSEFAGNSNDSVS*FLWHRDNERWFWHTFVTLV**
CGGRVKNR*QWSLGPVG*GTVLITRGSAVRSR*RPFFFYISRNVIYFAYPSHCRYKGGER
RGLLA*GLRVAVVSTMFLLNL*RLIILTYTN*FKENIYSFSFHHFVT*FFTYFHFVLFST
FFAFASFLL*FFNFFFSSLAVFPCPSFSSRNNHSTTVKHAFPFFYSAVIFIISTVSISCF
KLEFNLPFYHLNSRFIIRRLPHLLFVRFQCLKITKNNINNNNNSNLLPSKLPRQLKLQHQ
QILLLNRASLSKAILNKLKTIRVKMILP*FLLMLLPVVGKLPIEFYMLVT*TKLSPKTF*
SNISKLADQLLTSKS*SIRIIRTSITLLLNTINLTMPILPYKH*TANKLKTTLSKSTGPS
NPNRVPPMIHLTCLSVI*MLMLMTKL*GMPSKTSHPT*VVMLCGTCKLVVQEVTVLFPLL
LKMMHKMPWTACKVKI*MVDR*ESTGLLSVITITIIIINSVVTTVTTTVVVSVNITVTTI
TT*IWG*I*T*I*I*TTAGACHQVQWECQLAPCHYHLKANPNNPRPLVYLLK*ILKLLTT
SLEVPHQELLLPISVIFRTLPLKLI*FRCSRTSVLF*ISSTIQKRAVAS*SMTLMNRPLF
VLLPWQTSHFKAET*EPVGVRKDQILCHSSSNRAVSHL**MTNNNRLCLSNNSNSSNSSN
NNKYYEEKWNETKRKNKERQPTNPKIK*KKNDKNPFIILYYF*KKNYYEKGREKEEETQF
TIARKIKGPINLLYFFSFSVSYFLPSSLFNF*YYYFPLKCESHC**CDKNKERIF*RLSL
LYFLFPFLPYFF*TSIPLYFVESIYIIFVFIFYNFC*VYKNAT*RYGDMSVLSPGT*RQQ
PLPLRTRDAAPTFSLSTELCFEQKNGC*DQKKGSLTGTRLVPQDFSFFRERL*K*QPKSR
DAKYQKPR*YYFVCQTPPFPLSSPYFFSKSFICTPESFRIAYVAGCGWHLSQKETDQYHA
SPSSWSFFILHSPKNKMGREKGGISEHRELLSMQYIWHI*KILASLC*VQRFRLDQLNGN
QKVILNIQTKNKVHNDKEFHRHFEKEHSRCGS*EVLGFSSSRRWLYCTRIRHH*RVHHQG
TRCSPLEQVEGKAQ*CHRERRRRQRSSYKLIPEINANTFLLGNFLSPIVNLFLVYYNNSP
KNSRARPIYIYIYIYIYTYIYTNIFMTV*IVAPVQF*RSFITAVAPFLWHLRCVSGLSFS
GHLAFLALSLTELNCVEEVVF*IFKVAARALRGWMSFRGAMRLHKRIALISAINGYILLT
I*VFSPLVSFFFLFSIHILLYFSG*YICAYIYIHLNIYIYISFVLLSSYFCARNSFFFSI
**RRVDSVVQKKSLLNQK*IKKRNHKMSDSQQSITVLEELFRKLETATSETREGISSELS
SFLNGNIIEHDVPEVFFDEFQKAIQSKQKALNTLGAVAYIANETNLSPSVEPYIVATVPS
VCSKAGSKDNDVQLAATKALKAIASAVNPVAVKALLPHLIHSLETSNKWKEKVAVLEVIS
VLVDAAKEQIALRMPELIPVLSESMWDTKKGVKEAATTTITKATETVDNKDIERFIPKLI
ECIANPNEVPETVHLLGATTFVAEVTPATLSIMVPLLSRGLAERETSIKRKAAVIIDNMC
KLVEDPQVVAPFLGKLLPGLKNNFATIADPEAREVTLKALKTLRRVGNVGEDDVLPEISH
AGDVSTTLGVIKELLEPEKVAPRFTIVVEYIAAIAANLIDERIIDQQTWFTHVTPYMTIF
LHEKTAKEILDDFRKRAVDNIPVGPNFQDEEDEGEDLCNCEFSLAYGAKILLNKTQLRLK
RGRRYGLCGPNGAGKSTLMRSIANGQVDGFPTQDECRTVYVEHDIDNTHSDMSVLDFVYS
GNVGTKDVITSKLKEFGFSDEMIEMPIASLSGGWKMKLALARAVLKDADILLLDEPTNHL
DTVNVEWLVNYLNTCGITSVIVSHDSGFLDKVCQYIIHYEGLKLRKYKGNLSEFVQKCPT
AQSYYELGASDLEFQFPTPGYLEGVKTKQKAIVKVSNMTFQYPGTTKPQVSDVTFQCSLS
SRIAVIGPNGAGKSTLINVLTGELLPTSGEVYTHENCRIAYIKQHAFAHIESHLDKTPSE
YIQWRFQTGEDRETMDRANRQINENDAEAMNKIFKIEGTPRRVAGIHSRRKFKNTYEYEC
SFLLGENIGMKSERWVPMMSVDNAWLPRGELIESHSKMVAEIDMKEALASGQFRALTRKE
IELHCAMLGLDSELVSHSRIRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGA
LSKALKAFEGGVIIITHSAEFTKNLTDEVWAVKDGKMTPSGHNWVAGQGAGPRIEKKEEE
GDKFDAMGNKINSGKKKSKLSSAELRKKKKERMKKKKEMGDEYVSSDEDF*FEVEYISFS
E*LIYF*S*HPYSFFIFLFFLCLFSITDFHKER*KKTYFSGYTTIFK*MHSEKVYK*KT*
VKT*ISQNNAKTPLCLFCVIDSSTSNSTISGTMS*LSTY*GGQSKLNSLPL*QIWAKTNR
IYQNFVFLCLLA*TLSRRNLVSEEKKN*NEE*TDSVFKILDRGKV*FEVL*TRVERSSKN
WDCYIWRRVQIHVSRYRIYFPNERLWPF*IFGLYCWIIRRKLDLDGFGSSKF*SKIPATR
VGP*RGSFIRHTGIRYFRRRNCYQCKKGV****FEDEEASGGFSDYKLFKFL*TNRGDHE
FHRRNPRRLYDNEEKLESISKTKKNILS*QHFHWN*CED*NL*KSARLLQKFAFEN*A*K
NGGFPNIVHRLLG*SNRSKTKKKFR*RSQPFLFVFEACKLV*KI*GMQCADPNIRCKLQK
WTSFKRYI*IYAL*IWILGKYPQTFRQVALFGLKNCFWKGREVY**L**SRFYYCDVFFN
IQQCAHLHLEFGFSVLQRSNESFEYGYGNFWPR*RGNI*YFERLLEIRDRLCRISTQSLL
SLS*KRQCPN*QKSFIPCRRRRRRREYSTQNIGDS*KGTRCNFCSGF*FGY*QLSKRLQV
KKDIRKIR*RERSLPISEQCKNIHSPHCYRMQCYQKNWT*FIFANYNLSCQCESWKRI*Y
VDIQNNLQSV*S*QYVTHWKGSV*Q*L*PLL*KLLRLYINQKNNGQAPKKKEIFAILLTM
L*RLLLLIRE*TFSVKFNEFLFTFFTFLLCHMVK*NMVQTRFFFIIYVFIM*SSL**PLM
SDIVASVFKANLIQNLFKFFTFHLIRRRDLVASNTMLLEYRFINFNFTIF*VNNISNKIL
PFKVIIL*MDTLRLPIACYCPTHRIYDHLNVV*TV*TKNLSIIFIIYEQNFFRIIRFQNY
FSKITKNKDWE*TCH*RTDRINDHVSFFHLGNSSWISHWFYLFAIWVYIQYPMYRSR*IL
*FIKLVKMQLGVFQFWKNIDRIGILLFRFFFLIVEENFQMVVIRAK*MNKFS*MCYAIIF
RNRFRGMRYL*LASYHLTIRQQSRDMMCVIGIYTWNNMN*RTAPSYPHH*FNRCV*RT*K
QSSTS*EKISNGCTLKLKWIRVFDFFQEFCLHMDNKRTTHFLNFYRNIFPYGMRTFHYFI
PFFLS**LIIR*PMAKQLDKLFILK*SHYSRSDITNCWATNYS*NFTCGPAII*YWQYIR
QLMSF*DRNIRKARSQ*ICGSPTGAHNDVHLVNYLTTLCYFVPLLPRGNKRFRFLSFIVR
LNSLRNKPKHHTLAFFRKYETG*YNSSNFPHNI*ALHAEKNSLLDINNPTHCTTYSFIVL
LWYPVQISFSKMSEIFENYRIIFHHLKLKKYSVLYCLSQQNAHILETCSHNISWSDIAFI
YIQGKWSKLLFLPISTVPLLWKILTII*PIL*VSVRKKD*RSSKAC*MILSLLGKVSWKC
WNPSTPLSLSVSRS*KRKFDWILVSRIHSNGLKKMMSLSSLFPAE*NQLSRFY*PD*LDK
SLFTKLTLFPMKWKSMHMINGKSSIRMKVPSDMTNPEVSMLIKRNLNLP*KQVNKDPFTF
TVVTVFLI*VLQKNVICYLPKEVKIWSLIVKNKTSHSMNSIPSKTSWLA*NKFWLVKRQS
LN*WKISARLLRNIKV*YRVTASYICMHIYVRTIFFLYIFFIV*EKEHQKIKEDPPRI*H
A*CRIFNTKRMIFQVY*LEINQTYQKGQ*REKQELSFRGKVKCD*YFVACTSQLFLSFLN
LH*LPQFCIFVYKSVPLISFLLHIPAVNTSNTLEIVVQVKMSKIKVVHPIVEMDGDEQTR
VIWKLIKEKLILPYLDVDLKYYDLSIQERDRTNDQVTKDSSYATLKYGVAVKCATITPDE
ARMKEFNLKEMWKSPNGTIRNILGGTVFREPIIIPKIPRLVPHWEKPIIIGRHAFGDQYR
ATDIKIKKAGKLRLQFSSDDGKENIDLKVYEFPKSGGIAMAMFNTNDSIKGFAKASFELA
LKRKLPLFFTTKNTILKNYDNQFKQIFDNLFDKEYKEKFQALKITYEHRLIDDMVAQMLK
SKGGFIIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFESEAAHGTVTRHFRKHQ
RGEETSTNSIASIFAWTRAIIQRGKLDNTDDVIKFGNLLEKATLDTVQVGGKMTKDLALM
LGKTNRSSYVTTEEFIDEVAKRLQNMMLSSNEDKKGMCKL*TNPPFI*KDKSGLGL*CSD
LRLNISKKKNSYDVLNTYT**NNSRLYSTYCNPSPHYHS*RM*QILYNPEISYNHRIMQG
IYRAKLQYFFY*LCRLGRRDPFPPLRRNYQRQNQT*TLICHRPSYLNVCTYTWSLYDAEG
VQ*QHRLVHLVGFFYHIVI*STVH*PYYGHPFHNLK*TTWRCSRLFPLNHQNRQHYLINV
LILFLHQ*STDFPYHYQTLHLKHFHRFFWGESSLLMNRLQEAITPGF*DHSQY*AL*RPV
YIKTFYSFFL*HICLNPSFYAFPLSVSYLYCSQNFYSTEDFLGV*NTSK*WFLLIQKGLN
MSSQNLVTGNR*SFPYEITDPLVSTGVGLNVH*PHNYY*KQRLHQRILRCLIS*IFYSHS
TLKVDTMKELFR*TPLLHCNYLISTIFPSFYILNIMIGTDYW*TKPSGKCL*TPVIWWKY
RKSQGNNCE*DRC**NLIRSNRS**RMR*KNPRLI*LLHIIYRLLYETILPNELLICEKP
LLVVQHYRQYAAAPRAFWI*YKDSMINPIWKNQSILMKERSSLKK*KFQCSQTELQINRH
LKHKNLYHSRAVHA*VQIDSEFVKVL*PVKEWLLNGAKFLTKEVNECL*NLISMKTLQST
YSK*WRY*NIEQHTYLPNRRKTF*FLP*LVAKW*SYLSPSMLEKSPKLGLKLL*NLDLQK
LPVSELCYLGN*DFQSCCEKS*IHLCYGAIA*HVAIYL*TSVKLLKIPT**LFLTNCSLS
VTFCQVNHSLHTSFICQRAG*CRHTKTLIYRAPHRAI*DY*VKINDVYYMISVVINLFEF
IIIFA*DYY*KFSSIARF*ASFSDIG*STLYFTIKLPL*DGFFGVGIP*PG*VEVCEGWT
GCTLDKGKVLPSIVWIVFEKPNNDSLKDSGRV*IRSSPSLLKFGWLFSWMTNCKVFLRPV
*GL*SPWFLYVILVPAFQPGFN*MSICVFSEAPCGPFLPILNDFFLPTNKSSRLTGKLT*
TVSSSGYVGELDADLKPPGIPPMPPCIPPIPPGIPPIPAPPPDG*LEKLKPLSSAPPNGE
LPPKNCEKILKASSLLNACPPENPPAPPGKPPAPPAPPGPPGPKLGPPDLAASRPY*SYI
SLF*GSFKISKASDISLNFSVSPVGLSG*YFRAAFL*PFFSSCSLALGDTPSKS*SFVSL
TIISSVYYTLLY*CECIKKKILKCKQLILYPLKSFWMVIQF*VVKRIRVRA*IILIRIFD
KKAHKFKKGLTIR*RDEKSIQYILNLELPWQGVCADSG*KTRKRISHSFSRSFWNVHINQ
RG*HNTLRFRKVTTSYY*SCYRRVRQPYIISAAINVAVLSSI*KRSSD*CLLS*YLLAMT
TQ*DFGRLLLGFVQEQFSIPTHRLIA*KSPTIKSCWQQQAIKTYGFMTFGRQIPIQ*HPL
RVIGETLPPFLFNRTTDGW*PLAKMGPLKFGMCVLRPFLEITNITHQ*MKS*FILTKAS*
YLVIEMVI*EFGT*EKISVPIN*HLRTIPLSSLYLWQVMVRC*RQQILKVIVTYGKCQII
LTHPI*NR*QNSERTPHI*LEFYYHLM*NIWQHVQRITLLVCGRLMMILS*KRHWMATKG
GFGIAHLVLTVRI**RHRPIIT*DYGIYQLEKLSDSTVDTTRELYVSH*TMYSLQFINYQ
A*RTEVTKNIMIFSVCLSAFL*I*ILLSCAF*LIDCSQNESNRDAYHQ*KEDENVQYKHI
PLHVALNFKFRVDERFSYLRDKIVIFTGILKHFICVHTVRKERKSKLAQKSPPTSSNDFN
FIFGVIKTSRHN*LLPAFGFNRTICFGEDRL*VFPTQMYFFR*SQKITSVLEKRLNIILV
FFGF*VLGFF*VL**FCLQSLFFLFRNILV*L*LVIERCR*VQKITTLINLG*TLRQFLI
RPAFSPCLQTLFFF*IISTIEPCIFYGVSILQGSPYTN*V*RCQFDVFYI*LKFIPKNLT
QLVL*LLSFRFPDL*LLQNIRFCEIVFSRNRIFFLICCPFIC*LKTAKPPYGRLKMRRWQ
FQITPQGNTNEFSFRMKRIKIVTNNTRF*GEYGMIFPYTNVFSRIKLCSSLPHNNFTCGN
ILAFIFFWS*PSSCRILHTCSRARSPFGGITHLKEHTRHMFLE*KTRSI**NRIPHILTL
G*A*NIMTTQTGEFYFYNEPTSFFSELS*MSLQRKSFKIQ*RNVRYRNTQS*QPNLHNWY
KNSVYNITEKPLCENLFSTYSTKQLNLNTKL*PSLSSSGHYIYLNLRLSLGRFK*LSLFS
EGNEKVEYWLKNFIIMFAHEFENSLNEQIERQILS*QDMSDQERGSENVCFIDKGGEEKF
VK*DFMRSLELNRHQRMVSHHLMLPSKRLLQCDSTG*RGFFECIANVYLLAMKVRISIIN
KTLIFYLPCYNVQFIPTLKRNDLLVSLIMKFSYFY*CYSLL*NNRSRSRSRSPVRRRMSD
DHGYERDNHLSRRSGNYNGRRKFADTYRGSRDRGEYRGGRERSDYRERERFNNRDNPRSR
DRYDDRRRGRDVTGRYGNRRDDYPRSFRSRHNTRDDSRRGGFGSSGARGDYGPLLARELD
STYEEKVNRNYSNSIFVGNLTYDSTPEDLTEFFSQIGKVVRADIITSRGHHRGMGTVEFT
NSDDVDRAIRQYDGAFFMDRKIFVRQDNPPPSNNIKERKALDRGELRHNRKTHEVIVKNL
PASVNWQALKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDLHRAIEKYNGYSIEG
NVLDVKSKESVHNHSDGDDVDIPMDDSPVNEEARKFTENVVGGGERNRLIYCSNLPFSTA
KSDLYDLFETIGKVNNAELRYDSKGAPTGIAVVEYDNVDDADVCIERLNNYNYGGCDLDI
SYAKRL*NYSRSIYFLTYWICDKYLFILDLFPGFLTL*CHCVYV*SEKISKTLKKTVKRV
*FFQYSENGFNKYPKKYFEQIS*IDDFFI*ITKNKQQTRGLRRLT*ST*TIYLLQLVVAF
ALCFHYALISPAVGKLFDNNE*TVSYMPRKIAPPALIHIVRGPTPLKNTAGPSSL*ILII
TLPSEAVVLLSINLVFKKSNGVVVAAAIPPAIEPQIAPFHGST*LWPLAFAQVFFRYSYK
GNCIQVNGISLIMVVDHPL*RFFLKPSLLSFRRIDCKVCQEELVE*TCVLCLTTSAGTRT
RQAQISPMEEESMCVVVSINCSDPCE*SLLIYGLDFTFI*S*LIKKSEAPGADATTALPK
PRYMPLYPPLAKNPPLA*SLVLIVSIGKKTKSVEVPAAAPLSKERKKVFIANFSKRILVH
RCV*TYKIAKQFTTSGALMISYILEGAPHCKCIYIQNSAQ*ARKKRGARAFADT*TKNQ*
TCQNTYILQSMRHH*LYAKAQYLLLQWH*ITNNLCTIQF*NTLLINSTWLIKSQCQLR*L
VL*LHLKIDEFLIQPPAVLFSLAYSKNQIQILLYST*MVVRRSYKQKKTHP*WQSHE*YL
QHKLFHDLLIAPRQYCCH*ELFREVQPHSHPYRLFYLSFESRNG*KIKKACQSLRMAQ*P
*ATDIRFWSI*RKHQY*FQLILAKTKS*MLCLEYLQQADLLL*Q*KVKQVCHRK*SFL*L
NHRLLLLQSPPSRQSSLRRH*LFLLFSE*NLSQMQYAAFHSLPSYLLI*TLF*FFPFP*R
*PKSLQLYFQL*QICSYYFSFF*FVLPSFS*LILVFRF*FYQHFFFSSKEFLD*N*EFAL
YCLELKTL*LVYLILFPCGSLFFLGT**RKYQTT*TFLISSLPSFF*AELKKIFFLPKIR
TA**KCTYIIQYSPSFVY*CKM*FNEDPKKLSIRCCIVVILFNYRIPIIAKI*RLLV*KR
ILLTKEEQ*LLFYRRTRKICLLFIK**TKMTS*YSRKNSPLNLMKLVRKKVQIWSS*RLK
*YPRILI*RMNI*NIKVLLLQMKVELVMLTYLSANI*ALPLTTCIPLLS*NKTLINSCKS
S*MKPVISSINQTPRRSFYRKGSPMFV**HPPLLF*NKKLNIVCQKRKGLLMY*SLMKKL
RNFIKQFTVQ*RKI*ILIN*RLLFFALQVSTLRY*WTKFSSMPKRNTIRKYSITKECSL*
PTAPRATYRALMKF*KIHYMLQSCKILNTPKKSW*WMNFCCI*TRMMIKLGMVKKR*LKR
LSMAQLVIYC*QIKFCIQTILHKERNI*N*WTP*RAMEEKHWY*VLCILLEKNLIN*RV*
PVF*NTRSPILMKTMVRSRFTM*EKSNVHIKFATL**IGLFSLLLPYKQVDVKPQLIELL
*NGSS*SRAAF*KYFKTF*KIYIFLLFFYILMLKFIYVFVFRKVK*RSNLVFKDICV*AP
SKKMPN*EIILMWYKLLFTKSAPNGAGLIRMNTD*TAGLCYPAPSFM*LNSKPCW*KYKT
LLLISIKVTFILR*EQKKKRKKRKFYEIAFFT*PYYIRFINFLVYLLL*DR*RCINLVIL
LLLQVHIHINVSYTLT*YIDYRLDFTAKSARQPTTIRFESALQEFKSILFSIH*YHLPSI
*HNR*A*GTQSVKIMKS*PFPYVIYIYINYKLLIRI*KYVFE*SHTLNQKSNFP*FLLSI
FFTNSLYFSVENDFGLSIGAPTALSMINWGNTPIALATPNNTV*NEASVRP*YCNKTPEC
ESTFGHGFLVLPCLVKTPGATS*MVETNLNNS*SGKCFNANSR*AV*RGSVFLKTAWP*P
GTTLPAFKVSHKYFSIVSFE*SPFTSSLNLNSHSKTS*LARPCNGPAKPFKPAAKDKYGE
DKAEPTKCVVWAETLPPS*SE*IVKYSLIKSIKSLFS*PKSWAKFLP*SALGSVEVILPS
LNTLR*ILEAITGNLPSRSNESSNV*LQYSFLDTP*AYALANLDSLSKAVTAIENCAIGC
RSFGRLSKSWITCSGISDLAAKSAERALT*ASVGISPVKSNQNKASGKGSVLPSAFGSSL
*ISGIVRPLNLIPSSGSNTEPSQTRPLIPLIPP*ACSKRTSPITVLPCSFLNFLISSAFA
GIISANLSFNVCSEALL*WRAFNSAKRAFCIF*HCLVEPLDKKLLLVVDNIADIFVNSII
LLYVLPYFLFNGCNCNYLNANKSQNKPGLYFSKQQISPLRLAIHNRGRVKNSCCKF*AFI
*WMDIN*HFQTTRGRISR*YRKSSKGIAILQ*HKSIFGLAGVILFISGRLRRKKT*RLLA
QKCKVNT*KKRQCERKNAHIYKD*LSRSMKCELRRFL*LV*VYFPAKVLLEYVVISTRVF
S*C*MVFDGSFFLRVTGAAAP*RGYLNK*IRKFNLTRESLG*QQ*DELSYIFAQGKIFCP
LKICNIKKFDKNKSMGASRDSNPGPPAP*ARIIPLDHTPGRSCFNEFQNMVPQHQ*IINH
NVKHACEA*VIFEIIVGIPLLKKAIILGIQNILEVLLEDLGILIFLC**LEVKN*Y**RN
KY*SSYTK*EMYIKHTLIGHINHDQYNSDSGSY*TLM*RLIFLIYVPTITCSTNRSLTQL
QYCLSFSFNIPSAIGAITLKRIRGVH*YTM*ALDCYHSNSCHY*LLSFQQNNS*KFTNLA
SWQGLQMIKIV*IMEIEPFTFCRI*SDSMAKLVKACDC*SQDREFNPHWGRFFSYFR*SC
R*QTVKSLSLTCDIISVLLMHYEVRFLFYAILHVSIAKGVNRAPIQQEQ*FGNA*EQCCF
IKDSM*NKTKADLFDICWAFHK*WIIRIYNRGKSYFSLHFCVFRRTPYHC*VMRMDGP*C
TSFVLWQYLRKRCTRQ*RLLSHQGPHQL**RQLRL*SLQWIEVRRSLLRGRIRQKTL*LI
SWCRRKDRR*RVPILGGKTLAHFQGRIPCPYRHLEFQTKGCI*HRSLTKNRRRNTGLYHR
KCSLKRFPKYQQ*VERGHRKTWHTQQQH*G**CLGLLH*TWIGQT**GQNRKVLVEQDLR
IYGLARGLNRDSEYHRMPRTNHPLKIFDGRCKYTRCFCPQYIFCIWTLASGGSDRCFQR*
THPRKNRVP*GSQKRCCRCFVLCQTCLLFFSVIEDCF*LICRMLHS*LWLF*L*VGQFSC
FIYFACSKMITAVLGVRNCLRVKSVEVADHFQK*GDC**STVKLLRGW*HLLSLLLPCRL
VSEFSLRRFRMEPFQPRPLLSVRNWSTKHFSRGDWKEGQLSCIASLSTYNTNDTLNYVLV
*DRGSQELQIVHSSK*TTSLSCFEAGNILK*LKMENSSSSSKALLPASGSPSPWFICRML
SKVTL*QSCVTFSSLSSYTKTSHKDLIFEGVNSTLATCAAVINSKISCVVE*FFTFGA*K
TFFLGPFSKFLKPLGKVFSDMNLQTIVNKLLINSISSSPSVNHGPPVMSTEGCKLYNM*I
FLVGNFTLLTLFTYLWDSKLFKHLRTTC*WRLVLALIVLDHIPSLPLASI*EYTSASSAD
MVAFFCASDSKTP*NFNSSFCFTNLIKFLSSNSCTMDIKSVNDPIPICFWSSCCVNNAPI
PFDIIWLCKVLALSDSCNPFSIIPLIFRILAL*ILHLIKIFCNDLISQIHRKST*KFLIQ
*KI*RKKKVPVRDVT*KQKD*IIAISSSWILNILPNKGLNILINDLHIYCGYGNG*A*VC
YGRRCSE*CGRTVAVTFNAPCLFFSIAHM*AKSSKNLVLLVAF*RCFFFLHTFKTYRNSF
I*NVLVIR*LFIFKIRRKLN*N*KNSGY*KVLKSEKKRKKL*T*EIKGD*MHKQREEDLL
G**IYTITLT*KVY*TD*RT*IEFRRNTPQYWSHIFRI*QEMHI*SLEL*KFVVLISING
TKKVRRQSIRKL*EDALTCGMF*RARNIKS*RILRLLIISLRMRLMSHMLRI*M*SGWNL
TNLVNS*VIH*RI*SWKRSK*MISYKNKPKVCSLI*YARSLPFSFCCQTKPRLKDI*STI
FRLVICIMQFKLIINIKCSS*HAHIQESSPVTMY*TKANCSERPYTICC*INFS*GSFEF
IINQPRYFPDFLVICQNSYFVYIYRRLVSFEPHLYKVTFTRFWILVIHTLLLFLAEQQNH
LARPPFLKISMIPEIIIISRGNLKIEGVKLSRFFFAKVNE**VKN*EQYVR*HAK*VRRI
NRTSH**EHSQR*P*SPHSVGNFRCVKI*KGKSQRFYALYKEKDSQYGR*SKYPIVFLEA
YQYMCKKWWNAFY*GNLFQRVHGYHGTCHFKRR*QRRTF*AGKDHII*TIRSLQK*FAT*
LCGKSL**INLSWH*IP*KANTFQFSDCNV*LEDARRLD*F*CLYDLLQKVFSTK*ETSL
SFLWWSFLPRTLIK*YTLT*FGYI*ASQSM**LL*RLRFEET*RQ*KI*KTSP*KKEGQG
LLNS*G*RRADKESNRTLLERI*K*R**RAYCPRCRIKE*GEETRNRRRRRS*FKSCYSG
KLERS*RSEATQ*ASKSL*TDATPTAITSTSTYPFR*FI**GERQHIHVCFTCRKNEIEA
LERNFGRL*ITKLGSKSICFQSKVELCFK**SSEIQYFDRNERQDFGNYEHIR*IIGATA
TKHQFVSAIHTSTSPF*SVQLPNRKCAKSSRKLSNTSPPATIISSIQTTTGCLTPTIGKS
KFITYH*Y*SLENHRCDTTRTAKASIAR*TCTFGPTLSKRRGRR*RNTGSAR*GILHTRI
PRKAVSSRNREW*NFNK*TASRHYTLRFSNCSCTQIRPTGVNCTTSCKFL*NSDQRGKAA
*SSRGTANRALIL*PFLCICKKKPSAYKYIHTYIYNCLLRNLYIFLSLN*FLR*IFIIYV
SINIETVKKKSINIDKGRTILRKWF*GRNLFLHIYS*FLSSCLSCFLTTWLAANSEKTQI
FTNLPWYSHVVYSV*H***TLRKQSSIGLPVTNHQYRLVNPPSLRHRPALVLPAALSFFV
V*PHEPYLAIFSLH*HAYMDEWKQITLNSCKKVAFQWWLSLFYNLLIYLRTSAQGLVVNH
*N*TPLYTF*GPYKMSSTQYKGRNTFLAPYLWLGHL*H*ILLYRHFHPPLLFPCLVLAHQ
YHR*MSPWSPPQAYFAHVQFQILCIPEHHLHLHLLQNLS*LHLALQLRHIARHVYHRELF
*LSETAYSSVKNLCN*YLTTLRSTSRWETYDINNHLLVQTPQELFDLWLKR*ICALWG*D
ILSNYLV*I*S***NCIYSFVLLCS*LLASLIYVKCT*SFKYLLSFK*PFALLPL***CP
CTKLNAQEGEI*KIRNLLNTDTKKRIVTAITKGSLPTNSATIE*KMGTLFRRNVQNQKSD
SDENNKGGSVHNKRESRNHIHHQQGLGHKRRRGISGSAKRNERGKDFDRKRDGNGRKRWR
DSRRLIFILGAFLGVLLPFSFGAYHVHNSDSDLFDNFVNFDSLKVYLDDWKDVLPQGISS
FIDDIQAGNYSTSSLDDLSENFAVGKQLLRDYNIEAKHPVVMVPGVISTGIESWGVIGDD
ECDSSAHFRKRLWGSFYMLRTMVMDKVCWLKHVMLDPETGLDPPNFTLRAAQGFESTDYF
IAGYWIWNKVFQNLGVIGYEPNKMTSAAYDWRLAYLDLERRDRYFTKLKEQIELFHQLSG
EKVCLIGHSMGSQIIFYFMKWVEAEGPLYGNGGRGWVNEHIDSFINAAGTLLGAPKAVPA
LISGEMKDTIQLNTLAMYGLEKFFSRIERVKMLQTWGGIPSMLPKGEEVIWGDMKSSSED
ALNNNTDTYGNFIRFERNTSDAFNKNLTMKDAINMTLSISPEWLQRRVHEQYSFGYSKNE
EELRKNELHHKHWSNPMEVPLPEAPHMKIYCIYGVNNPTERAYVYKEEDDSSALNLTIDY
ESKQPVFLTEGDGTVPLVAHSMCHKWAQGASPYNPAGINVTIVEMKHQPDRFDIRGGAKS
AEHVDILGSAELNDYILKIASGNGDLVEPRQLSNLSQWVSQMPFPM*MTDIDSLSIRVLF
QRAKRRRVASTRLFRLENKQKTKTKTKKGEKTNEKTNDSR*RRRFLTGLCNWLFAFIDYI
YTNLKHCFLSRLRRGPIAAATYA*RKNNRSCPL*SRGYHWGSFPARRSTNWQLPILQTLA
SLETMEKTTSGLCVFPLSRV*WLVLKYTKTRRVFLFP**GAVAEVWLVPVSPHARMVLVR
KQRLEITLSFPRSCKFVYSSPIINTRLSKQTKISQT*NQSIALRGLPKSRLTVNQNL*LG
EEN*YYLRVIIKPLLGLRSKLHLRFALTIIHLPLHLSAVSAKARALPQI*TSQIPPHQYA
TT*TQSIQTVIIAHCIRDKKHLQASKPLSL*FISLQVTNNPTPNISIFHFHSPSLCI**Y
YCLRISSTLPFHFRFSSVRIIR*NII*NLILLVSIAILLRPLTVTELKKIKEKKRTCING
KKKAKHTSIYQRDTSTESRHKMNLQNNVLNQIHQILLPTNPTLDKPNAEATKEEFSSAEN
RDEKDYLTNQQPKNLSTPSTSSNGEFIPHIFYSLHQIRKDPNNLSNQLETLTGSIRHRLK
LCKSLISENEDTKDLLSKSPSEWQDIIHQREQELQIKRDVLDDLYRKLQR*NLCYLSLVY
IYIYIYIRIPHLQTCI*NGACVSSNTHTPVKKPSPPPPICFIVN*IFKDLWNHVYQPFFL
RDN*TVPDKFLRR*HQLLIKHIFAWSLRLFLMINEKYTGRMNTNVQPT**PTHGLIAGGA
*LYNIHRKPADEASSYSSIYVARYIAYLHPGLVVLFN*SNLFTAPE*LVSNISYPQHRFE
LNFVVLTPTSGKFRVSPLVEDFQIQYVITFHFA*HTCRSISFLTNK**RCFM*HRNYGQT
LF*YTLTLFVRSSCIKHFCKFRFTRKLAHHFT*PSDCPFAI*GT*NV*IFQRLP*CGDTG
LIHQGKLY*VSNAKR****HRIRKICSCDLRLRHKFQLVQI*PFGKNSKTFSRPNTTSPT
GTLIN*SS*AWNC*KLGHSSGGYVRIFLNKSRINDISNTINGQ*SFRNISCQNNFPTIFR
SRLENFQLLLLG*ICVYRSYNHLFCSRT*FRHDLLQFGFCSFNFFLPR*KHQYIPR*TLR
SMNLKNSCYSGMYIVCLRL*CVVDIYRISSPRNVENGTIIKKL*KFFCVHCC**YKQF*S
GPLRQNIFQQTYQDICG*STFMSFINHNTRIFA*FGICKKFS**HTIRHIL*NRFIWGCF
VFKTDLITHFLPKHNIHFICYSCSNRSGRHTTWLCYGNL*LSLISESIFYQILG*LCGFT
RTGFTHYNQNLIFFDLL**LILVLMYRQKFSCLLYSQYTLFLSF*SLC*TCLILKFLFR*
*IVLLISIINHCICVEHIIVLVRAFQCYIIRVIALPRHSISQLLFFPHALSVYFVNFFCI
LYFMSNFYVKFRIRRGVLSFILGVT**TLLCSKFII*RYFFIIL**LFL*SKLFSF*IVL
FWTLVRIRKNFIGVIA*SF*LQGRVLILGLFVFFLTQGRRLYSYCIVILSCNFIRSFHSS
LTGFRCNT*HVLLYTLVIYIDAN*TYSSYPLLLIQLINITF*LSG*LTVFHFQHVLVIRL
YGLVLFWLHLRYEHLKNSCIFSMISL*FSHLFSLFPLLS*YAHISKFFFHAMSFEMKKGN
*KI*IDKIRDVIFFFFRKAVGLG*RLIYYLYATSSIISYV*FRTRIYFIYYVPSYSTFQR
TIFIIYFNFRR*NKRHIES*CSHGW*SRCQKNKRKKLSVYPTMDNSIYNRYRWCFRFRQD
KRCC*DCVVN*CSLDSINIFG*LLQSIRPRGQSQSL*K*IRFRRAKCHQLRFGI*VHFEL
KGGQKDKYPSL*LRPPQ*SS**KYSHIRGQCGSYRRDLRPLRSPIAGFDGLENLC*R*FG
CLLSKKIVERYSFQRERFGWLYSTMGEICETKCGKVCETNNEECRCYHSIDE**CYSGKF
NH*PHQVKTGTKIK*TLKRANQIGLFSFTRCA*S*HNS*IAAHQPSSFAAYYASK*KSKL
RGLCFLL*QVSNNFVIMGT**HSCSTYEHNYTW*AYHGKRYCLSIRSSYSC*YYSIWRLF
YEVFEKDDPQYHNW*IVDSVRFTNWGTSTALRIFTPKYRKVWQGFLNGRSNHKWCGHDHG
HPGAFRSWY*FGKD*RGGLFGH*SWYPTYIKCI**QSQHFCWYDHLQRKVTKSSIQMGID
QIF*FKVFWL*LRIIRGNIK*N*IIVHVYILY**PFILSMDNLKIPLLSICHNLL*Q*RH
NLTNWLVHLS**MYPRSNIYHQLHQSLKWQSRWGNQRLEDP*H*SIIGRL*RSIV*NDHL
KVDWNRSHSLMVR*SLPRRYGRQKWPLQESLDRRSTQ**RLVHAQPAP*LTVPL*TINRM
SLPPYLGWYLPWPKQRLST*NY*NHPKLEDLYRRRLL*V**I*FPFHQRYRRFGLKDTKE
QLL*CKLK*QTIASE*MDHGMDAIAKFSHLAQEGRL*SIAPKLP*HK*STQVAQS*TIQP
KMVKGPLYQ*KKCFEEKRWEKTYHRYWRQERYQELELWHRNNFLAVF*AKVEQLNSKERG
QQH*KPTWKQRAPQTYLLKE*NVGLYRRMPKYA*KGLWQCCTWKGRLLK*THPAKA**HS
TTSLIR*TERNHGETLVGR**GP**QGTLQ*AEESLEKSRKGGWSQWPIIKMHILRWRNS
FSVRNPA*KESN*KLIMQ*NMR*LTETSAGKFGP**IATIAWVVNA*VHGKLGNPLMER*
YRRHHSTLPWIQ*CWHWGAIDWNSTLKTSCCQSWQIGTFSPNSSYLSKRCFFPKLRDLSN
ERIIHAQHPGNRGLLVCCHLRLLHYRCCFRHC*FGQRPS*TY*MVDACPCSS*RK*GWSR
*CDAESYLL*QD*KHANGI*YSSSSSASSSYLRTCQISCRSWRTRSGSTQ*SPSTRTTGC
RSISIFSLKRAYVG*KEKDTQG*S*KATLKRRPGFALSYHY*SCSRPACG*RVQSQSTCL
SERGWSPWRRHY*TFFGVVVT*TSCFLQHFAVDAVAAD*TIGWPCSCFPVP*HRPSIRCS
WR*DLFLEICRIYQFFSILGLRQQQI*RCRIDHLEKHLPIAADFHRWRHVAPQHGAYCYC
TAYLFAKNRSIFSAANRPDTW*TILVQN*IVRNARTSCQSASYRVTFTVFFLFD*VKKEK
KLFLLRF*AAFFLVTYQFSYMQDILNFFFFFSVLKLVLIKKPSRGSPKKNGSG*PEVFFS
RE*KLPYQNKKIQVG**SSTPHQDYRSLTSPTLCSLSARSLLSFPTPE*LRRIGPPEHLA
QNISESSSPSTPYLSPPLISDQKQKNKGPSQKRKVSTPRCRFNFFFWPVKLFDFLESAQC
KTVRIRAHKCIYMCMYICI*VCVCTSEA*TNDLQVSDFFSKNITNKRSMSSTDIKPCAVN
IPVSAHITFHYKSIADRSSSRSSSSSSCSSATSKACSPRGSSVGLPPALSTDNEIVETVL
NVSAPVVADPTRPSLFKSNYTAASCLTSDPTSPSLLPSSRRNSVLPASDFHQCAHHKNFQ
RRASEPQLPSFDNRSSSEMKRSVSYAQHSMMFPISDQQEPQTSASPNDHSDPSCPCNRHH
HRRNSVAVKFDKPLYERLET*LSIRPSICLSSHSISHPSSIHTYIYSSAWSTQPCIYIFP
SFYIFITKIDNAFFAAFHFLYFAHHFARRKNENRLEKLLLFHPSKPHQIAQSHRDHGYIC
WKTGSSSNGKSRRTAHETDGAGPRCRSRLVPRNHRQKANSVRQEGKHCTPNCRLRRAVQG
SNEAGDARFQNISKTRIL*IDFPDRVCIPGSGHPGCFESDQRRQRDRYQCRLPQTLLYTL
RHGLCPLAHPRHTVSHLERTG*ERG*PSQQTHQCENKTLGHQARHSTARQTSVCHGHHKS
YSSLQED*NEKQRAAHHRLHCGDLRDMPGK*RVVDCERRYPRPLSFS*FTSESLEKH*HW
WYDCRVC*TGPYSF*SHF*AFRRRSILGRCLSRVYSVGNEV*QPHRQYKIHVKQNCPRKI
SLFSVLCPLQEPGRS*FRTKAIER*WKRSNRSFRVLGKLQSSRKSFEKRQRHRQAKEETD
RSHRQ*H*KAKGCTPSHRYIIYSK*KERIMKENAHNIYMYVFSNLY*QLN*ITSILFFFF
TLQGLFQSLQQFFFIIGR*HLDNFR*SINSIVMVASDLFS*VLSE*L*FQTL*FIVQSFV
VFFNPCCDLPIIFMVH*SRVPRSNSCDLF*S*CFAYLMAQPFNQIFFVQSSSQSPEEETT
CLGPFQFLRNNTLGHHT*RPIVQISKLKTDLSVNWQ*FSLTIS*LLGYLLMYFWSQTLVG
*LRSQFSVLVIQSVHGVQQFFSTELDTNHTLWFQNTSSSVDVGIHFHLVSVDSWIDNNP*
TTS*FTGRWDIDNNWLFVIHQCVNNKRTILQDFVEHITLTTRETSPVGQNHHWQLFTVVK
VIDSLSSLEGGVWMPNLTRFLN*CFSTIWISWISRNQVLDSSCFNTNNTQWNTTKTGSTN
DNTFGPS*QSFKERPFIKQTIFKSTFSLTTFNHPSYIVSFIISWSEINWSIPCVFSFQDR
NWHITLGWNIRHPFNNLLYTS*IVNSSQM*NTVVIHDLSTTQL*VRSINFSTQHFVDCRS
TS*NNWLAFDLNSSLTQTNQISTDTDGSTSD*GDSEDIVVSP*RCTSN*TRST*TFDT*P
IFRTNNCLDDKSFFTVYNSTFSENRIFFVKFL*SFHTFTC*V*VLEALVRIGSIIPCNLK
*WNNLFSHTNSGT*VCSQVNSWDTTLSSIFSNLIEEFVFLWTKGTDLECDIVSNNNKLTA
SWIFRSLYSNLKGNHTNSVGTRFSFHLS*FAVFIFNQLVGNKEIIC*LNICREIFPLG*R
CLAE*FWEVIDICGTHQVCLITFWLQPFLNRVRSSNRS*MHGSRFTQRLKYPFTFCVLDF
GVHFCFDNITRNVIDQGTQWYWGTCLRIFDDDSNFGRRNTQSQQSLTKSF*ETTEGGFDI
FWRDIKHRNEVDEDMIQIRI*SVGDF*IIQYITHQSVSFRSQIFLNRNVITDMTRSNNTS
CKESLIQWRSLTNSFVDMDVSIISENWFNVEVGQSS*FQLEGQSRLNVTNCFIFVIIWTV
KSIILWIRPIFKTEHKCDTTDRSID*FLLIQIQNFSQPYQNFLFRFETFCRSNTNISNIT
QRCGATRTIRSRSVRRRLVTRNNFQTL*QNFINII*MIHSHQNTFS*RR*LTVCNI*QI*
NRNSPVHTHFRFNSWKGGERS*R*LEFPFNNWNCDTFVNSNISYGVSTISTTNIDLSSCS
SHNWVLMG*ELK*NIEHNVIRIDQVLQDIQIWFRALWIG*AIGNLHNRGF*DMFNLFSSF
LDRR*SALNQNFSCL*SDLSGSLRF*FNNML*RSRENGRNFRR*LAQWLIMFQDS*DQVI
LR*NFRMRQNS*RNFI*IFRVFITQFQNDIFLTNIWTIE*LFNFVIFFQEMDKYRMFMGF
*PVRVLMSNIRQWFHDGAQQFVGVVFRILHGHINQFT*LSSWENSTTSQRTCN*LFHLFI
*LSRQS*M*SRDV*FPF*VRQFWISQNLYQLLQGSVHNNLVVITLQNVFQSRH**LEFIG
RFGSFDNWRTKIWQHTFKW*SVLDLGWIVKSHNSHDITCNNGRTRLL**LDDTIFLRNQR
HLHFHNFNFCIWLALDNVFTIFHQEFNQFTRGWSTQLGWIVFNFQQSSHRVNG*SCSSNF
FFPIDGMRFTAYGNQKTTIR*LTQYDITFRTIDK*CVTVITGFSYGELVSFTLMDKIYRE
HSLQ*VFR*NLSLL*GFDILVAGFFRC*ESLCSGTANDGKSWIRLFSGHFMSNQIVQPTG
GNSVILEIFSFQKFDQVFHSSSEITPNGQFLQGNNHVFPGSLSIFTKSKNMAELRVRKGV
NITIVTHGEVTPNIRGRTEV*FMQSTTRWLESIVWIF*CDTTSGTMTLWNRSSLFLGGIL
SFEFEIDF*GRMRIHTI*SSNVTYSMHRDTHSDL*LSCR*VNTGDHFRCWMLDL*SWVQF
*KVEFSIIMRI*ILHGTGRDITD*FPQSDGSLFHLVKCFSLGNCNWCFFDNFLMTSLNGT
VSTEQGNICTVLIC*QLNFQVTRSTGQLHDENGGAWNFVGCLVV*SDEIFFTFNLSDTFT
TTTFGCLNHDRKTNTLGLL*TIFRRGTTTLLIDVIVDRDQTGFLVHVNGVNTGTRPWNTW
DFSTLSDNGRGDFIT*RPHGVTWRPNKDDFPLRLGQFFRQ*WILGGVTPASPYGVYVCSF
GDVYDQVYVSVVVIISTTWHFNVLIGHTDIFCVGLQIFWGGHGDELDGSVIAERLVCPFS
DGSNFFHGGNTIICYQDLGYDRVTTVTLNKVP*RGLL*FIYCIEANEMTWKFCMSF*VVC
NFVLHLLWRRLE*AFFAHGRNLIFSNFLRCFGNGKKLS*KTNRLLYYYICIV**RVVSYR
VVSYRIVKRKYTNK**YVEKKKGSFLSLALNLNSNSSSNCSLVYCPKIRMKREGRAEGKV
RIVE*INFYKHMHRSLTEDKKMAQQIYIYRCKWRLQIRELALLFFIFR*TVRKG*KE*NK
ERKIEESRTIVEPITIVTVIVLGYTVPEYDWECCSSYISWR*LSV*PSSPSSRESGNERL
NFDCDLLAQRARGRAM*RF*RAQRFGGQWKLLGVVQQDEAFPFG*RQRISGQPTGNERKR
LKPRDVPGVCCSCSCSCSCSS*RMILVAVVVTLEGVTAVMRPELTVTSMHARVRCVQA*R
AIPHQV*VS*YTRHLSSTLGPNSTQHI*WFCMGILSVQTKCELPGCLLVAAYELAC*SWV
KII*SQKEEKEIDDSLKKRENTEKKKTPTKKREKGTFT*SKRETFVAFN**K**VIAFAL
HCRKKKKKDHFPLLLSLPVHTTRYSVNKSR*KKKK*PR*YRYTCLTDHTQSCRGFLEIRH
LPMMRMLPWAAKIQPSLRNYR*SRV*VSSQTSIT*YQVLVECMSTPLGCILWLV*TRVWS
I*IWKKNNYPR*KAHRV*SLPVGGPMTYVTVPVPSTCWDLVSEGFLV*CRVCRIFRPIVP
ENCN*TPS*ITLLREVPS*VIMRGFSR*ATISSILQ*MH*EANMTPRAPLALGPSRALCS
SLQKV*NPWVIPRQWWPLRAPSGVVSRKDYLKNEQHKNLLSLSLSLSLSLFAFPPCTDGA
CI*HLKNNST*RRKQTNESRNPEKRSKKTKKKDGKSACMCRYVHIYNYLYVICLLYC*AI
VFDGQLK*NKPLTLGYFPKLSEPSRPTDSPGKTCLEAAQSPAASVHLTLNSC*RSTPDRD
NSSKEPAKNCAV*ASTLASYNQTMVKYTKKRKECSFLFPF*PNHLLFFVV*PGKNVLLYK
HSLLRL*LEKTLDKCTDTHQHRTMKILTQDEIEAHRSHTLKGGIEGALAGFAISAIIFKV
LPRRYPKFKPSTLTWSIKTALWITPPTVLTAICAEEASNNFDATMYGSGSSSEDALDEHR
RWKSLSTKDKFVEGLSNNKYKIITGAWAASLYGSWVIVNKDPIMTKAQKIVQARMYAQFI
TVGLLLASVGLSMYENKLHPNKQKVNEMRRWENALRVAEEEERLEKEGRRTGYVSNEERI
NSKIFKS*TSSVYLPQLYFRSSSFIKFLSSIHLYIRIYR*TNTKTY*NFLKTTKTIHCSY
T*MLNFISLLSVPRS*HLTASRAITGKIPTVSL*YY*AFFFPGIYKRGRKLAAINSGIAT
*TRSKQTHYVSKSNNNKHNHGQEEGSTGERTISPHPKAQRCRCGQKTIYNSGRRGRTIWV
RHLRQLTSQ*THSYHNYTESQRGGLKRRRRIHPRNCYRRQYRDCN*RSD*DR**HVQDPC
EDFKLQREGTV*ARVL*LYIVFR*YVI*TQAQYIRWVS*RALQDQIRGTYFRKGDQKKGE
RANGHAQKFTPPQVLPRCCRLSREK*WRRPNYCSNCRHLRNGGHR*NHHNFIQFLRVVRG
VLDGYCIWCCQGFNRLLLPA*W*LQGFGDLEIYDYEFVHCGIRRSFDVFEHLFCRWNTIL
MQVGGLEMGHYRLDLHLNLRVFVCYLLHVFNRKHPKTTLAVQDLPFFAFFSFIDENAFFR
LLQWLSMGYKGRTTIFQKRSCQIQGFYK*SKSYWCS*EKL*VL*F*IELSVFKRPNSKIP
QQYQCKKLFLVHHVSNPNLPN*ISKN*GNQMELRIRKDLRHLRYHFLNDDRCSNLDVSCS
NESIGCAQF*MDWYIG*IIEMGWIAR*YRPRVYRDVHLGLLFDLGCHFELCG*IDKIWRQ
IFLR*LVELC*LGRLQ*NLEHPSA*VFVKTCLP*FNEFIQIEQESSNFDDLFLKFRRS*I
SNVRYLQEIEVLLVLLPNAANAISSFNKY*IHEEQNHNRKCYFLARYLHGTKCHVYVVLD
ILRHPATVLWSY*IFIVNFFLLFFFFFFFFIIYKRLYIFYYRILSFITLVHL*ISSNGLV
SAKQLSQTSSTIFAACSLLWQLGFPETLIIALLLTQSWCPLATWNPVLNPLLLNSSQNLH
SPLNEEALISEHA*CFRFNQSICHFRSSK**INSCESVSSKCHLSRNLFWHNRIPNSG*K
PPPFQSGQ*SQMIFESSNLLSLPLLSFVIACTIKRTVGEYLSIQSRYS*HFRHSFFSSRA
LESSSYRVFSSGVKPIPVLYCMVRLHHSNPALSPLLFISCQKKKKFGTISFPWFWLYKLC
LTLLIILILELLFFLFVRIVINDNWRKRAKK*KSENYLKKKSLIL*VLLLK*VRYCCRHK
N*ISRTLFHFINMSSSIFGPLTGFLERVNSLNAPYQALSYDEQKAMTIWQRVKFYNWTFE
LCALGVLFLVYAFYKFGNSVNLKRGNQIFQSLHSFLANDLKFSRVGFNINDSKIFTVEHQ
NTWFSSFATGRSAIKSINLNLHLVARSNPFSMCLEYLLGFFFASLKSKQLEEFMEIVIRP
NGILVTSESAHPNKNAHEILTKFRFVTSIVNKEFMNQARTENYFLSIAHTSENDKLPNNF
VYMSDVNQLSGFMFHYSKPYEVLSQAGNLLKYISFTDLPVNPPRDDKEWESSIEPKAIIR
CAVPQNENELKLLNQIISLVVEIYDGFTQDLVQQSPNLFITNDILKRTTNLRQQELNKIK
KFMKETELELAKEKKLELEKAKRRQLKASGQQEKVDQKMKEKRERRLKNKQRTRFQ*EPL
CSSFLLIIF*TSSVFVYERFPCIHTFK**VCKLVCGVLNCDVAYIQDCTLSEYILFTNQM
SRPGILTSSIVIPESNNPFFSSFGFSSFLWPKTDSLRNSMFF*TSVSWRLESC*WSSSSF
ASSVWYCFNSSVFMSCSSLSMYFAPLKLCK*FLIKDGLTFATCPLYN*NRGKSFRT*TLT
LWVLFVRALRHTWVQCSIFGRPVSFVI*LAFYIPYGIT*LNCPLSLLFHRKEQMN*KLAI
INKKNTK*RGCIKPKTK*DNSKAVKQRSNGLNHVQSNETQQRKRF*KEFKSSHT*Y*KFL
SCKEKGSGEPR*SK*CFSNYANSATFSSIRYGYP*PFSRIDS*AVFFPTTGGFREKIRSF
YSSAKLTYEANGCAVGEVKAIPRVSLSSFKFSKCKISPNLHFKC**KPTLANGHKQ*G*P
YGTGECHLDDENRRSIIGQCAS**SSKRKI*LIHRIDSGRLQK*GKR*CAID*I*CGP*R
KCHRRTQ**EIELKLTVTIFTAEW*QLYYD*YRPK*CHDGGGDCQKGYEFYNSKTRISEM
AV*PE*SCRLRWSRY*EGRV*KCRMHYKHPAKIIPRRAIYELLSTTNRNNRIEERYIT*C
NIFHI*IHPFK*IAYQ**VCIRKFDGQQEQSQ*QHQY**DA*CSLQSSFYCKIRHSAYYL
ITQQS*RIFSRYNEINGFTVPY**YSPAPITAN*N*LHSTR**SFHLW*VGS*Y*ST*CQ
RSKIQ*YTKRKSNWGC*IE*KCQGIGTNQTQDSFTGQRNNVRSLESTREQQTIPFLQEN*
*GPS*SIK*MHCFYLECFESFIGR*GL**RYGKAG*LLQGK*SYVAREYRSHIIKWTNVG
FFTLIHNRLKIYVVFFVYKL*IGKERSPFIYNN*RRTDNADLFIAPTSNGGCLIPLSLSK
KSAENFLLEISEYEKVVEMRAT*TQ*AYKEPREKQQMSANNGVTGKLSSRVMNMKFMKFG
KTDDEESSNSNTPSNINSDVEPIEQKGKLFGLDDSAWDLNSYKDDLKKISGKEKKKVKRV
VYKKRPNLIISNVGYSELRKPEGVISGRKTFGDNSDDSGSRKRKFDEGEQNEDEKRDAKD
KEFTGSQDDGEDEYDLDKLFKDSIKKKKTNHNGKNKNRNSKK*RRQCTSRSTYSYIIMRT
*YKALCSIFFVFVINHKDCRPFYYAQFQNIYKNM*IHHF*FIR*ISIINIIEIVFVSLRF
FS*LECRHSPFRYFIIATS*LSLKLKHHLFLEKLRW*SQTLPLQY**CYFQYIRLQFHSQ
NSSHARHALLWNLR*VQMFLYRGCQTKLFDVSLHQLRRAKRWCLFSLENCPSRN*KAWNA
NCAYRRTVKCKKAAQ*G*SW*KI*RFFVSLRCSWRS*AVILLCG*CWLPKHSPHM*SPER
**PL*WQNYELV*IF*TLTGLLVSQELWNCHYLPVPPIHPSCRHP*K*SL*ICLSLVWIL
IRKCFLI*CLFWSAQYLSLFLKRLLSILCHRL*SLF*INSNSYQNLFS*QCNFQSLLKSL
PS*NR*YKQQPYHQWKSVNPLLHP*SRSQTSLSSRSGQ*FSL*QVL*MMR*LQRYLLVKY
KPASCSHPHL*MRQSLH**GTPIDHSLYRI*IFSSAYYLYLG*S*CYFHCSQPK*YPWKR
QLQ*ESRRCLPMQTRSIYETVPSQYLW*DPRARPSACLVCHCFLLLHRLPQVMCRYSKIL
HRTQDTRRYN*LSRTS*WLDCISTLLYICISITYPSRFLYTFLNFLDFFFFNFSFFPHSY
SIVITIQDKDNN*L*EIRPDAVEG*IHACVRVVPMTSTLHTTKKVLSIQSHVIHGYVGNK
AATFPLQYRGWDVDVLNTVQFSNHSGYAHFTGFKCSTEELVDIVEKGLIGSLRIKYDAVL
SGYLPNVQALQKVAGIVGQLCEGSENVKWILDPVLGDNGRLYVDRECVAVYQDILQNFKI
FLATPNQFEMELLVGMSIRTLDDAKQAFKLFHKKYPRVSRIVVTSLELSEFLSNDTYVVA
GFDCSASEEIFFYEIPKINAKFSGSGDLISAMLTDSLLGDRRCTQLSLSASLGQVLWLVT
SILQKTYDLNIAERGPQDSTIDIKDLKLIQCRDILKQDLIPSIGKPKTIKI*FLRNGMLL
PHWGAAAAGTCLNRKIHS*FGNCRHTTRPFGEDRSFFGSFNLIGKKIFKKIEEKYRIYRI
YRINYCSR*IKKTIHIQYHN*KIITICIHWFPMKSFFLYLYVAFMFSCITALPLPVDNKR
ASSDSLDLKKKYAPDPPITHNVNIGIVFTDPESSEEAGRLITIDLYGTMVPKTVMTFCQY
VDSVKDRLASRHSYSPERDFDKILPNGAIEGSSVSSSSIEETEMLAPKLPEENHSLIHDR
PGRVSMIKDDKGLKFIIETSETPLEGESVVFGQVTAGLKDLMDKLANVKTDENGKPEQPI
TIGYISSQEHRIQHAKEAHEKYLQRLQDYQNGDLEKGITLKNYLYQGSQRKLEDAKYNQL
HHPLPKIMLGISVLLLFYVLAKYRKRIFNRSSKIVSIRED*NVSIHPLNIHSFCITYIRI
NIHNLPRLYYANHHSRVLRNSSSMDSFSRYFPISTILHSLLDPSYLPGKTS*VSRTPWIT
RAMGFSPSISIRPLVLCTSQSRPSSRRRPPSTVMAPKFFHNKGCKNCLINLLLYSSSFFN
GLKVSIIVPIRSS*MVPFPLPLSKMSDIRTLSYA*ISSKF*IGVSLYLVKNIGAIEFISR
TLSFNCLTISGECSIVSYLFIIIRSAMASWKCAIVRFPSKPTLSPCQWASMEISSKHFSI
CSQSKTVMIPSM*TLLFNPSSCQNIFAMGAGSAIPEVSKRI*SILPGERSTISSMALTPI
FFNEQHRHPLPKSNHSW*LFDPFLMVIAFSISLESPNSFKITAIFLSAPFNAIFSSNVDL
PDPR*PVIMLTGIRFFSCTSVAPAEVFSTCLFTLSTFASLTIFPPSYETFSKISCRLFSS
PVTRQGSSPSSSSLNLMFLNADILPL*KLKIPQ*KGCSWLYKRIKHLILYNIYNIHVIPI
VKKKKK*K*K*KIRPLKMNNLLPAGIKCRGTSQFITQGIY**QVKPLTISVVKRVE*SH*
TTIQLTMRWSVLDTVLLTVISFHLIQAPFTKVEESFNIQAIHDILTYSVFDISQYDHLKF
PGVVPRTFVGAVIIAMLSRPYLYLSSLIQTSRPTSIDVQLVVRGIVGLTNGLSFIYLKNC
LQDMFDEITEKKKEENEDKDIYIYDSAGTWFLLFLIGSFHLMFYSTRTLPNFVMTLPLTN
VALGWVLLGRYNAAIFLSALVAIVFRLEVSALSAGIALFSVIFKKISLFDAIKFGIFGLG
LGSAISITVDSYFWQEWCLPEVDGFLFNVVAGYASKWGVEPVTAYFTHYLRMMFMPPTVL
LLNYFGYKLAPAKLKIVSLASLFHIIVLSFQPHKEWRFIIYAVPSIMLLGATGAAHLWEN
MKVKKITNVLCLAILPLSIMTSFFISMAFLYISRMNYPGGEALTSFNDMIVEKNITNATV
HISIPPCMTGVTLFGELNYGVYGINYDKTENTTLLQEMWPSFDFLITHEPTASQLPFENK
TTNHWELVNTTKMFTGFDPTYIKNFVFQERVNVLSLLKQIIFDKTPTVFLKELTANSIVK
SDVFFTYKRIKQDEKTD***LTSIPIKYIASVLH*STSTRLQIFTFISYLYKFLFSKSKQ
L*KNAIINLLSLN*HYILSPHYIIF*FYI*YNKPSQLNYSLSSVSVEEESSPKAISLICT
IQGSINSSTALALLEGF*IRHLSRNFIPADDTSSLVGNCGVCPAATWYMIAHSLSKLAHG
RLPVIISNTTQPNDQTSSAPSLPLVVDPVMDSGAMYIGVPIMSNRAFSLFFTAFESETWV
TSSCSPSAFSILFILANLVPLLAIFLAAPKSTYLITPLKSSRMFSGLTSR*TMPDSCKYA
SPSSNCKV*T*VTISSSIRPCSKRAAREPPSQYSIKMLTLSR*TSTP*YETIFGWFNISK
TLISSLIKGNIFCIDLLS*ILISLTAKISPLSKSTAEYTLPKVPPPIKFLFCHLIETFDM
EDAKETRYLLPLSLSSITLPV**GFRFILSSNSIILCTRNSEFTCSIISSSNTSSKSRFD
LAC*LIFSTSMERAPIISK*EISNDMHSEIFCFKEENWHSSRASMFQPLTICIANSIDVT
HHLNTL*SVGSQSSAKNFSHPILNRIIKSIIMDLFSLLATLILKKFRPKSLPKRKILFNK
SLTGLTFLNVVTIFV*FFRTLYVHLKYALFILCKLFLTVSEEDFFSKKETELPDICWNLS
HWYSKA*LDPWHIKSIELGITFKFNPSGLIVLLSDRLYISPSQSNGSCGVNTNT*PREFN
LVSSS*NSSSVLLLFSKSGSRLTLLPL*DLGWVVKSFLI**NGVPSFEISEPSDELEFQL
SSKAL*IVRLLLISSLGTKSQPMSEFLMILKISSSLQPNSSGLPIK*VPFCSR*PPVYIR
KWPVSFSCFSR*L*SSIL*RTKF*NAFVKILVNLLSFLFMDPSISNICTSHFSAAASFSN
FGGVFCCLKR*ACNL*TNLSVNFVNSAAISSPASSI**PTFLNISQYFNNRSGSLEVLNE
FLPLYNILSSKMEKKYSNPSTTV*SNSGSIFTLKNQSLQ*EATVNFIWTANLIYVLKSSI
I*SIIIKVGFCIFFA*DRRISIISFTKRIGNINKNSRS*SK*DRFNSFQVFWYFKKKNLA
FKIHGANGKNIFF*NISSISFSFIICSAKRLQLVAKTAGSSKFTVVLSTSVVLSSSLLPT
IHFFRYAILVSKLNLKLSQLFKVSIRFLNASVLVMGFSACILLMLGHRFKTL*YLSTSDL
IVSAASSALILSSSLKAMIS*NTESVESLKILRDLF*SSTVLPFIHAFNSIQMSSEN*VL
KPGPFP*FAIFVFSFLTISPFSTLDNIVCHSNRLFTIGFCNNFDSKSSLPSMECHSSSSI
SHG*SLFTSLNQSNLPFR*FRLIETTFSLFFVLDVIKL*PKLKSLSLSSPSTFKRSSISS
SKSSSPLLLKFSSSSSKLDDATIPLV**SSLARFLIFLKYNCSFNTYCFLYVRRLVVLPP
WWPTDRCELFVVTISCKVEELVDPFGCDLVGMCLFEVWFVIFCGVDIIDVFVVFSEASSG
DITNVGVVNNGS*LLFTGAGFLIISLSVLLASTFLCTGTG*VDNFGRDC*GFFGRGRPIF
EGRLLDLAEELEDPEMAF**KN*P*GIPGRRLNSCTVFNGDSPGL*TAFGDLKYWVECSP
GLMGDDATRACVVLEFRPKLSDLSLDEDDEDDCLILELLGFSVESP*GL*LK*SECDIIC
ACQIVYAKASLLFSNGRLFVLETAQ**LEGQTELTQKLTNMLEPFFFL*ILCKPVIRFEN
TRS*LFFNSTTL*GNNTLGQQQLQSSNLF*SADLASFYLCLPTFITLFRLINSFHTKKRP
KSGASFPGDGAVINNAKLLKYPLFQGMKRGIFSEL*VIWNSS*LFIKFHSLQLYPHCVLL
FLVRELAQ*RWNWTNV*KGYTRPSYYLK*L*GHSALS*RKC**RSQT*FTFRPLSQSWGI
CMDSFTICWRSSK*AALFLIRIICSWATM*TGGCTVWKQLCY*LCLSFDILVEFIF*GET
TSHVKSRRAMVSTRSA*TSTVAIQEFGNI*QIYLTI*CYAVLSTTKFFVFMVGSRPMFKP
*IRSRLLIDFEKFHTMAPWQTWFGLIRKKTITPR*IIQITLDNISRCHLVEQVILSEEAW
WRNSYV*TI*TEYTEPISYVTKVTRYILMDWLLLYGRRQTIVIGAAIKHLFWSCIVKINS
TSTFSKRHLKINC*KRTV*TTMP*KIAYLIR*PTGN*LQIISKTTLPPQMAPRTLKCTYF
QMYTKPDLLLTDMLITSCSLLNNRKAL*RQRHLIISTYSISLGCKCMYCVFRSKKKKQRI
FYR*YSSKFV*SCTS*SSREIWSFKTLPPFCNTILFGWVPICKDNTFLKSPTLSSARHFT
LTFLPNRSFTTTSIIFRVFICNLSFATAPLSQSFPLPPHLSQPKPRIYKNKQVSRRTFTR
*PFEISQGG*RNAVRYN*HKATTATASCPVHRLL*FIHLQCSETN*TTN*YLTGSQRRAR
DDGT**YVPIYGSAIATFAAF*CYRCWPRTWESQQWCTRYGYNI*AFRECQWKVR*SSNI
GYMSWVPSNVLGSRC*CQ*AKYYQAWASV*NAFKRCSQSLWPFFWLSRYVQIYEVPFIAC
QCRRH*HPFALMHNRR*ERYSFDECSNEK*AMVWRTVPPGVMLFRIGGAVSQ*LSQVEFH
K*REDRKVGKEET*WRVFRYPISIG*DY**RPHIQGKREISEGRGHNLR*AVRGL*RPEI
DI*NLQHHTRRKICHVIFCD**KYG*MVYHCFTKLRIPGIHSLWSYEKDYSSLLAR**N*
LHLVEKVSRWSRFGFAWLP*GNT*R*IPILDHFG*IYGE*NNR*PQRNTFYWRSCWHFRL
*NRSVHCMRPLQ***EFPCSRRQTSFYQQ*YSH*SQAREALLYFSG*YISSGIRTIIKGQ
FC*KEEY*AIPVLAQVSSRGDRLHYNYAR*T*LR*GV*EMSGLYA*G*FL*NVSHNANQS
CTICGDRTLEDFPDLGTKKPGSIFKFF*V*RHYSPPR*NASSFVLLKYFSRKVFEVGCRH
MRATSHQGNCEKRTANELGKSHTNPEDTKRIW*ELNDFGLNQK*PLRVGS*RSGGGVHVR
ARICHRLPTR*RRKGTWIDLCQ*EDEIFRH*CP*TLASSGIYDGSPQEDYCAIIAGQDRK
QAKQTCQWWSTWCLQRCHGILVCEFQRRLVC*H*MYVFLQRRNQLATRCRGGHNSLKHTR
WRTRGNVQQVGEQLTNFHVDICILLDMYANIFFRIIYYSCTMQNFFFFSL*ENDVLCRGK
PWKRILEKS*SMVI*GRLSFQFTYQ*VIMYA*RSRILSNHKIIDIITF*YIKEARENRF*
LE*FFAR*QQPYLKCLHSMNLQE*LRQLPIMLFTHKTLPLRRAKSQGPHRCPERALTEMV
TQNPKRWRE*IL*GVMPPAVVVVKTAPLRN*KRRKKGASRLRCPVVR*SKCCTKDC*KET
TFNGVNGTFTLLMKD*CPLAPVKAITVLLREKYSI**IRRSTELRKFITLMSH*LTTLKS
VQITMRKF*LKDLPVEIL*NYRCLICFCLAALLTVT*PRYSPIFKRIYVKIWHGSYL*KM
HPADLRIGFH*PSQ*FVTLIESPLL*RAPQRRL*SRQ*WKGLKRDCLVVLSMRAPPVVFH
GL*TTML*KMSL*LRRSTSFMMMRI*LSRCLIFWVLFLSDDNDN**QYYDLTLTIFFF*L
FLSPPFPLVIAINHPMFLNFLEK*LYIKQVILVT*CAYITYNIYNIYNNPLEKNNNNHSG
YFPFGPMASAKRKACF*VFFSFKEIIWS*AK*EIETKC*LQSLRRISLQDHLIRMALSSF
VCRLSTQT*FNIHSSGRYTTDIKTLTLRVENVKG*SGCKKASFSRIPGTASHLAR*HTAI
MTKYTEPCGCYTFPK**STSPIFYILRITPHRPSTQKFLFLLTRLSFSP*VTLCR*FIHF
GIVCCLFPRFFPLCLAAPFPGSLEIKMKRLIARLLTPC*YSLDTPY*LAVYPESMSSKNC
LHTVRYFL*SRQHYVDSFILDIFFTWTNQRRRSARRECKAIIGV*IRDTLFYYREKYFID
LVSHLA*YNQTKVFLILYQTKKKKKQNNK*S*YHEVKYSNHRSIAKSSGFANIR*KLQFT
GYIRCRKSHRKVTNRRNNQEIKCRVR*AGLLRLRRCSIYRSCLQESWPFYCVLHSKEQEQ
RGRCSSCRNNQLAQNRISVNSGDSSFIVSHLFLCIII**LNYF*NVSFFFFSYNPFYGFL
RTYLIFLVDNLSTGEGSSCLLSAFCTQFIIFIIFVHLGSI*DFDERVHSESHSGVHVGFR
ALYVIMEVVSKQC*LAN*MELQLFCLEMTWEKNKRDKSSTLLCNFRWLI*SLQLQWWFM*
V*NLWSGLDLTVSLTCIHEFL*KDLAKNFICFVLKNSLEDYGNSVIGRFDEDVLLVTILD
CEQSVVSIGSNLTASNFCFDRCRLLLA*FNKLRNGQFEGKTQYNGLQNRQL*NRFLNQFG
QRNLKSVVIAGLHFTWDSHPTQRGVVVGQKLQ*RQRTVQLALRDTYPSFGLNTQQQNGLI
FCCV*NVVGGIVEIGNNSVHGQRRTLAKCLYRFIQCLLDEKVLWL*V*HCGLPF*GKKIA
SLVSTLVPLNAS*PLCL*YFLSIQASENSDRFIRVSMPNTPNIPKH*LRILRIHIYIYIY
IYVWSLLFTKGCMEWEY*RKVVERPKKT*SVLRITIYLASWLHISTSKKSCLPHHSGHQH
L**HGTSHQASPDNAHL*HIQSNALEHRGPHPVYMQIPRSR*SNGPCTPFSAQNSASWAL
KPLHVIRHPSAGDTDPVVELYLSSCVLEARSLF*SDSMSLALS*WRKTISAPVSRAYTMC
WT*TSTTWLLLACFNSGVPVSSPSFPWLYAFFLPKSFCRSGKTEMLLKALLLFIMLYIYI
YTARVWLDLIYMIYHLEIYIH*IPHLFLV*V*LKRFLVGANSPSLWPTISSDISIGTYSL
PLCI*NFSPTN*GRMVAALAFVLIGVPLVMASLMGNGTMLGPFHTDRDKSLAAGCILFLV
DTTSADAVLLLQ*TSPF*VMVRFLLGASNCHFLLSHNRE**SKR*CRVMLKI*KIIADLY
YIESITGDEMCSKLDTFTIGDR**QCLHRDLTLAN*LLLQLAHQKESSELLPRPLCL*RG
RLLNLIMKNMALTKILMRVPTLVQRKTKTVCK*IMGLVKRIRVKWKRKRVSQVLTAQCYR
DSSKQYHCKKG*VHLILLRVRKTKVLKTRRPQLTN*NRFLNLNSSKTQ*I*IQIHYSSNL
RVG*ILRRYIMIIP*SNRSRITQMN*KQNYCRIFARISLQTLFPSNRSS*TPYYRY*TSR
*TYLRETSPEESVIFL*MLLPVQVKLWLTPFLLFKPSSRDKLTDCVV*SSSPQNY**TKF
ILR*QS*LKGRRLL*ALPN*KIL*RTNTKNYQIWNQIS*SLHLVD**II*I*NR*I*KT*
SF*LSMRLIVF*TSPSRAGVQN*CPI*KRIN*IHFQGT*SK*SSVRH*LPTQKS*TA*TF
TNQSCS*SKPINCTSYLTN*MNLTSTFPRRKVFTSH*YCCIQYANLWHIPPLLQRF*FSL
NQMNRLSD*ASYYNLSVNLAHNPAY*KTFKIWR*VLILSIQTTPKQKIKKLLRTSRITRK
AQALPS*LLPISCPVVLILTISLK**TMTHQCLLNNMSIVLVEQQELTNLVPLITY**VE
VKERFSMT*TKI*IETVNLSSH*NSILPYWNLILNYILRL*KV*KTITITPHKLNFSLST
FASIHL*HSNIFFFSLILITPEYSNINMYVLMGM*L*NYIRSMSIVVSHVGMLV*MHLSM
ANLNINSSSSEPPFIVILISTT*SVKFTLLITISS*FRMYLDLNSLNLSIWSLIMFLMVV
GFSVKPAEFKNPVFRIFVFFVAIGSELIDLGRTDGFSLAALDSTC*VWAVVSVLSLLLNN
AELDKDVVENPISNTVEVHRAIVSPCHRIKLEITKVAR*SDILDNRSNSRG*MNRYAV*V
MVIIGFFVFKLLYLLA*NVL*SDNVDNTKLIISMLYHKVIFSFCESLALAMWE*GICSLI
SS*SWLFVKELPDSTKRTMNSSIIWNKRSSPTKHNETASAKLSRTSILFNPNGNVIVPVN
HTWN*DKFSTNMITSEPMIS*VIKCDSVIKLLHEYRCPTWKVIRHAKICRAAIDN*I*AF
GHGKFDSKSLKSGMGRDLAMFKGIFTSGS*KKFMDTEECL*RCPLRNEVLDAAEEGGVC*
CGCSVDVVKLKGESKVIEDLLLLPASGEMPLTGDLVLGGGGTSFGAGIYLSDCLRPSLPF
PFIKAASLILALLEAFSPKVNEGL*MILELELLPSLAE*NRELGLGDAKNVLFWDGIPST
FPTAFILDKENDEASESFNLGVWKATSGDKLSSSCIAFICGVSIALSLFYNLAHKSLNIH
FFSLSNKNTFKVHHFQ**IFLILRNRTLVENFLRLRYPR*NSRTIKIIISHFSYIIT*EG
AFSYLMWTRV*QTWLPRISSKEAASH*RS*SKKSDVTEEKSLCSSIRYHGRYDGLQLL*L
*CFSHMALHTLICRGELLEKCTETLLRKKNTARGSSAKLLGLWL*GFCL*SSLLPRNT*R
QD*SQK*NICHRSRIVRCHGVN*LDALTC*EDQFLSRGRSMNCLKIRPPRSSQE*VLKVW
RIRPPLFSSQWMKKHPHFSINFTFSRDLVAL*RMTPGSWTAFSTVWQKISY*TGQY*LRS
FHIRLPRPYFTRGILDHPSRIS*SPNRYGHLRKNACK**SNKRTIKHLYMHAISTRIQTV
SRCSRLPRRT*SKVRC*YLH*NTSSSF*DCQDPLSLSC*RVYKRRLLVHQ*TQAPITTHC
SSRRQLTVRFETRTWPS**TLCVDPKPKR*T*FQP*CQTFYPGVRI*YRKSYTTSNCSGT
KVSL*ASSLHPWQETQVTLPN*NMHLMQLEDST*TA*TKGM*TQ*VTMQGLATNTAQEAK
IERPFQQEFEPPRILTPDGGSLYQRR*ASRRT**LFDPTFYPKNR*WCSQHLSLPMHLHR
KYPTYQLLRSM*HLASWLP*V*TNCRANITATCPRVSLASSAPHTVSIS*AAETRTVPVH
PIFPFLQLPTLST*TQVLILSRKGRRRRRKKTYISFCCFQ*FQQR*LGRCPEWTSLVKYS
FSAK*TLVDTVILRQLFLL*SIVYSALLITLLLILA*FL*NFSTMPKSPKWLV*PFLED*
YIKSIHRAGNGDARLKIPRQ*APAQ*PFTQHPLPHPSTSQPLSIGGKGTRS*ICPPIRPY
Q*LYRKMTSER*PLRLLHLSLNATLCG*MENHTASTMKELKIVCATYAN*ERKWNRRTPH
CPHYLNGNSTLSPKITFLQQLV*LPPLLALLHWSLQLLSYTNYHSQLQKYLE*QERGLVQ
LVDRCLADTWPGKWEKLKMVMIPWQYKSQTALTGLR*KLVS*LSAILKRM*VPLRVCN*P
WQPPNYLKKELNMSYQRDLKSCVKPLLKKISPPLQRKQ*WIPTLSMPHVWTLSLQYST*M
TLPSVSSVGATPLISFTEKQSLHTRLMQVQMLCCTT*LKMSRNSLHLSINCLALFLDGTR
NLLLSSLRLSTINLNHLTLLHVNWILSCKRMLPE*F*LKSVQAHKKQTNL*LTQRLVYQR
NKINSICNIFLFFSFPFFTIANLRFPTVLVGTTKLQFINILILTAVTT*MRNFLMPTLLL
FHIMTSLHASEFPYS*LSNSTT*HKYVHPFHT*RSQQPPNLHLGYLSHIFSNFRLAFNCK
VSFWILHVSSQNAAVT*FSETILKHSNDLKQATIANKQFPASN*NVYKRRIMIYHQ*LS*
TFPVFTFIFEKRRALTIKAKKTKKFQMTLSFAHFTYLFTILLGLTNIALASDPETILVTI
TKTNDANGVVTTTVSPALVSTSTIVQAGTTTLYTTWCPLTVSTSSAAEISPSISYATTLS
RFSTLTLSTEVCSHEACPSSSTLPTTTLSVTSKFTSYICPTCHTTAISSLSEVGTTTVVS
SSAIEPSSASIISPVTSTLSSTTSSNPTTTSLSSTSTSPSSTSTSPSSTSTSSSSTSTSS
SSTSTSSSSTSTSPSSTSTSSSLTSTSSSSTSTSQSSTSTSSSSTSTSPSSTSTSSSSTS
TSPSSKSTSASSTSTSSYSTSTSPSLTSSSPTLASTSPSSTSISSTFTDSTSSLGSSIAS
SSTSVSLYSPSTPVYSVPSTSSNVATPSMTSSTVETTVSSQSSSEYITKSSISTTIPSFS
MSTYFTTVSGVTTMYTTWCPYSSESETSTLTSMHETVTTDATVCTHESCMPSQTTSLITS
SIKMSTKNVATSVSTSTVESSYACSTCAETSHSYSSVQTASSSSVTQQTTSTKSWVSSMT
TSDEDFNKHATGKYHVTSSGTSTISTSVSEATSTSSIDSESQEQSSHLLSTSVLSSSSLS
ATLSSDSTILLFSSVSSLSVEQSPVTTLQISSTSEILQPTSSTAIATISASTSSLSATSI
STPSTSVESTIESSSLTPTVSSIFLSSSSAPSSLQTSVTTTEVSTTSISIQYQTSSMVTI
SQYMGSGSQTRLPLGKLVFAIMAVACNVIFS*YQNNLIHLYKHIQSIE*KYNNVMKTLSI
DMYLLTLINLLKFYFKPF**LHAGRYIQ**ITK*GKYKTNG*QQ*LGDSKGTRAGVETHD
AFEKGEEEY*HSMATFMEAFLFRKL*DEYAFFSK*EETSDKLHKDKRTSPEL*W*YIPIS
AYTVEILQCAW*FDVCHN*YCRIYGHCYV*YAGYYQQ*KSIRRADDGGTGEPGETERRAR
DYGPQLATRY*IEG*RR*Y*MGAT*CSTCPGRSLSRGAERKVRHPYKTVYFRRFDFE*EG
KCH*L*LAACEGIYIPHAICLYAVSRCYSTHDHDSK*QQRGMAA*SRAFD*GKRGTRYSS
KDRRVLRPVE*KFR*DSDIT*ESAEFSTAELV*IPNDIEIHLHRTSRQQFEDLG*V*AIL
WKGAI*RGKKTVGSLAVRPFLPFPP*YLRQQNRRRFLRYIN**LHAG*QDIPEILFNCNE
SLQRTYSTFFP*CKFSICQQASTEHISGNIHTTTQGIYQLARNRLQIRL**QYIQTNQHP
QTKLFPTTQQEETRRANRQNPTAER*RPLSNTWYHFAGREENLLSNSKQK*GRGCAAETH
F*YPGGLFLIKHVNMYLPNHTHHLIRNCIFLGKIFIDEL*KQNYFTSNEATVASYDLFGS
THHITSLVNMKFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNIV
DRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMK
CRNCGHIYYIKNGIPNLLLPPHLV*IKRDLCVWARKTKRQLYTQLYM***PHIRMASNM*
HKQPKRKTKTEI*PTTVSI*AFPSRVIWRYRF*EL*RTRYSPVLRTHRHIRQQSRRFEGS
GALKVVSFGKQQENMAGHHHEHEQERDHEQEHEHDSLQRPTTGSERTRSISFSKLLTRSW
KRNASSSNNMSVSSVNLYSDPENSRESDHNNSGSEGQSSRFSKLKSMFQSGNSSKNASAH
NSSQSSLEGDSASSSSKLRYVKPMTSVANASPASPPLSPTIPETDVLQTPKMVHIDQHEH
EREHSNCGSPIMLSSSSFSPTVARTGTGRRRSPSTPIMPSQNSNNSSSTSAIRPNNYRHH
SGSQGFSSNNPFRERAGTVRSSNPYFAYQGLPTHAMSSHDLDEGFQPYANGSGIHFLSTP
TSKTNSLTNTKNLSNLSLNEIKENEEVQEFNNEDFFFHDIPKDLSLKDTLNGSPSRGSSK
SPTITQTFPSIIVGFDNEYEEDNNNDKHDEKEEQQTTTDNKTRNLSPTKQNGKATHPRIK
IPLRRAASEPNGLQLASATSPTSSSARKTSGSSNINDKIPGQSVPPPNSFFPQEPSPKIS
DFPEPRRSRRLRTKSFSNKFQDIMVGPQSFEKIRLLGQGDVGKVFLVREKKTNRVYALKV
LSKDEMIKRNKIKRVLTEQEILATSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQ
TRKTKCICEDDARFYASEVTAALEYLHLLGFIYRDLKPENILLHQSGHIMLSDFDLSIQA
KDSKVPVVKGSAQSTLVDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGIL
IYEMLFGFTPFKGDNTNETFTNILKNEVSFPNNNEISRTCKDLIKKLLTKNESKRLGCKM
GAADVKKHPFFKKVQWSLLRNQEPPLIPVLSEDGYDFAKLSSNKKRQTSQDSHKHLDEQE
KNMFEERVEYDDEVSEDDPFHDFNSMSLMEQDNNSMIYGNTNSYGKIAYTPNSNRSRSNS
HRTFFKR*RGL*RISVGIFFFFIDFFFTLIFSLIYSSYI*RTLFLFKILIYLFFFLYFLS
SVS*SVVCNLNKSYIGVSISSILCKHQMKHCLSFQ*TLCSFFDLLAYYFSRDS*RNDRRM
AQYTS*KQIDI*SIVNI*NKVLELRFFCAIWD*Y*GGKRKNSCLVSKMLKNPGNRQTHRL
DNSASKPGSPSCRHRAYCRCLF*WHASSHPLV*GWWSAR*VSKD*W*TTQNVMHWHRRSI
LKRFPPSTWTTTSVRKSQSNLNGWYLRILN*AIKLVEYSSKFQIISRNLLMFITA*QISI
KTIENMCNLLT*TN*KEKH*SEMIWIQTVTL*GR*KIRPYSPVD**QIRCSMIHSAQHLL
V*TILQIICLPQKVLRGTPTATDMERPNTMHPISYRPQIGPSYFPMATLTITFQTYKTGN
SSKYG*ELLHCPTSIS*Q*KMRPMG*VRVFTLLI*NSTTQ*DLSMEQNLLY*PQTVLSVL
ETRH*GLFI*LLPGLQLFSPYYS**KSSSNQDLCMIIAT*ILRTAIPHSMRVVSLVFH*E
KFYD*LSFTIKSLRLIRSLGKRCNFMYIQNKDEVIYHTILSPCILYQTLYSVHIRYLYIH
*MFFSLYFSKV*CYLKSIIVIASL*SVLHCHYSTTCVWWRRWRAGGVETVRRFTSTETCP
EFLAC*RSSRP**SSSRCRARGACMIIVYILKRFTRRRVLRCVPV*RRCTHRIF*RSLPS
VRKGWREMTRVLLLHIMLHLSI*YFTFVR*IFLLPQPSWEPLERMLIFIEFHKPFMDQCS
IYSITIFFCFNG*MCQRCR*RFG*RLKLVPKSPGSFLGMRYLTHHMREILVILVVGIRA*
RLIVSWRFIFLHLS**Y*SLKVKNS*ESLRAHLIRSDQKQDYKMQ*PILFRLKVDDLLAV
QASGTTLSITF*SILSLFPVFFFLRFLMKV*VILKKDL*SAVTVTYDKPFDTFLLI*ATV
FSFR*MPYLSFSSFMIGSLISGEYGASKPGPLIVPSKTNFVAMATG*PTVAAIEL*PPTL
P*STKVDVLVSVVPSAHSIPNLCCSTTISLSLSSYCISSSKRAHRVSKALPLGVIFASEN
KPNQANPERILSLSSSSFQVAFESMEAIKSSLEVDLAPKYCFSASFQAIGLLKISLASSF
NIPMSTKALTNSGKP*YLKVPLMTVSASGI**RSLKRVESLFG*QTNA*PG*MK*GLAVA
IKSSEETVSIFPSFQYLAEFLKASSTPLEDHENLYPNGLSESSGAGKPPQYDKNDFSLPP
AL*TSSIVLTAYKWSIPGSNPISFITVIPAFTISGSNSLKAGEM*EEVTTSVFVLMALFT
TFGWKVYGIKEMTTSLSARTLSKALSSVTSNEIALDPEGLANACALANVLHATVTLMSSL
AANVSITGCATKPDPSNKTFFPILKYIIR*YNSIVLISFPYCLRILPM*FYQDPTVYIPL
SQILCYFLSSIADNSIGNSQYPLLTSLFFTTKRIFPTEFRFQSMSNSFHY*THCFVVSSN
RNHTLHFCCGEYQKKQEIIHNFLSLTCLQLRLKFDFCSTALYRYYIWKSSNDGNPLRGT*
IRYIRLLHM*LPTWENLSSNSLFALSNF*P**KKMKNNCQLFPATFQNRYKSKSKISQKT
FLS*LLIAISLVFSLILLSI*FTISWDFISMTMPFLGSLW*TNPVDYSHVCCLC*QQHRV
RKSKRFISFVHLFFILKACNIYWLQHGLFSCP*QSPGEFFLKIFFYFNYVHKCRQLTTNE
LSINMLFFFFNYCSSLLSPSTSVS*HRRKCPYIIIFNF*LVSFSFLPRFRASTLRYIFII
ISFKWHSFPSAPVY*LLIIQFLVSIF*ILISGFFLVFLKIGFMIFFFLFQIFLLFFQFFF
LKGLWLTSPFFLGVAFYENVFH**ICQEDYCSWASLLFFFLSILQYHQLTFSSSLKHRFG
SFEFQSRRRQNCLQLLSS*LYRILFLRHFSIFLLLSHLYL*CRLDKSRPC*RC*ILVFSY
FCC*H*RCPSDSPFQIFFQSVSWVVFQV*CIQPWYYFC*FCRSFHSSTLRPMSSLVDSQR
ALEKMKVLKRYCRILWRRKPVALLV*FQFQLPLRPQVPVFHH*LLYRWAKKSY*QHLWPQ
QSLPLS*LVQLSFRLCEIFHLV**RFLTLL*RPHLVCGCP*Y*MVPFRCESWTL**RV*P
EVDYDRQLVFPELTIQLAQLCL*PFPFWPLVSIFLVIFLFLFLFQLRTHALFYLLQLH*Q
SSPR*IVTKKHLLRHKA*MNWK*I*LYHW*CQT*THCWMVAG*MFDKTYRPEFLSKTFHP
WP*SECFCASAQCTGNL*YLILVSSS*LWHHF*KKTY*CFHVQ*LSPLEERHLFRLLTWT
DN*YASTRLYLHKNMPIWKGRSSFFRSSFAKRQNICLER*HPFSFI*YFYSRV*LQMQLL
VTR**NYNTLEKKNAMVL*YSS*SFSL*KSTKNKDVSVK*VFNRFSVK*LTN*IFERK*G
LNENNKTKKKM*LNGQK*IKM*GKNTT*RIKQSKKTKACGR*YK*IKAISYCLFFL*NSF
GTNGN*KTEEVFRILLILKQNILCQVLPLVQSSFCTN*V*IALF*NSNGIKNK*LSLTSA
GCDRTFNRNNSNSGQEKKTVRKGNIA*SEIM*SL*NY**RSLYFLLSLEWTVMLLAICHS
FINRHLMFFAALDEKISKKK*MVKQTTAHVTDNYTGITHQSPVEECLLHRRTNLYYYMSN
HKLMLLLNFFF*NCVYI*YINDHWSPSIPYMTPWYLAKSVPFGNLCIDSLLNWQKDRSIN
RLWPPVVVNIENLGSPNSSASVVSEYCCCCCCCEDCCN*GFLNSWIILYTRFKS*KLGMY
*WTHHSKSSLLLGMESFIRMLIRKPRSYAAWYVIQVTESSIIKPESIRSCENSNTSMPKF
SCFSKLIPDFLSNSNDSVDMISFFGSNSKLNCHVEGPLSGLLPLASLKERPSCIGFKKST
LALIV**W*STFDLKVPIGLAKVPTNSVLIDT*LYCETSCLITANSL*RLDFQTSRTKR*
FGGGKKIGGILWLVKCLGSWEAKGRLSPTPCCCCCCCCCCCCCCCRTFSPGGKLATETGV
PILNGCCCCCCCCCC*VNSGSFFCFKR*ALFIS*LTEPLIVFTGIP*GNILALLTFGEYT
*GPMFCCWCCSEACL*EKNCSPPTANTLGCTFIDCIILFDPL*MYKIELPVSNRSKYFQY
EKQGSPDNETR**TSN*SFLSVIILLL*LKRLNKENIIMMKKERAAGKDRIPFGMTGIMR
FTLYYREGYIITELKFSIGILYFIN*IITHLCCFPKNVCCHIIRTKKKITKKKKKKITCN
LKLILYTGCPFLPLCRLLNFFLLWFFFPFLFRWKDEPRDFTSIKIIQYLLRNTRLIRLTT
LQ*STLFPCQNFNKLRGILPS*DLVSSFQVLYLTTF*NTWNILFWVCDVFDSDNTSE*NV
FFGVFTRRRHNTWTINQKNSFHKSNILPDLSFTRDWCNLTHLFLSQCVNDGRFTSVWIAD
KPYRYLLSISMQL*ELT*QLN*RTFTERVGNRCVKRQSWTFL*QMFDPSCLLVKLELKKK
NLLLVKNTFCFIIGNLLPQENVIIIVIAEIDCFEEWIKLKKKKK*KIVRIFTTNILYGAR
DKVSNNKSSTHKILAVLKSEGIPLKQRLSF*FTHEASPERGNMDKRTVLLFQNSNRHFCR
*VYPKTDREAP*QKGLVIKIILYRKKKSLVLSSWLERIKKKKKKVNILQPR*VPNHTY*E
HKLNACVVFPSSYTLPRTYNGYPMDPLHLEHVLPRQTNR*LYIIRSKYVWIDPY*K*LLL
LRRSTHFLCLPGSPLVLMWHLRLAFPHTW*CLHL*P*PSPLDWMQQDVVSFFGLWAQTHQ
HNFRYPKFWLLGIHLRPFLPTMTWEAYFFSEELDMYLFGFHPMHF*NAAVRPEISLLCYR
TNDDLVGPSHPVLWSPGKKRP*LNYLSYS*SPSH*CTYSGI*LSWSLCRNFHPSHEDYHL
WCHLHEYV*ISLSYQYPLYYSSPDI*WFCCKSTDLQS*HLRESTNK**ISFIYSTLLYMP
KKKKSEKFFFKRKIFAMSIGQKNVLNDRLCLYICY*FYIIVNW*EHYPSLWTQRIAA*YQ
REHWHGLFPHDVV*IPCEGENLQTLLLFRRAS*SS*CFVSSYFAPRF**IPRSVCWPARF
PSPTWPV*YRSRGQSVQSNLPI*NLGGTSRSGYHHGRKYLSCHQ*CSRSTSPHTIWRLFS
**TRPNLLHTCFSCFLHL*LFACTFDRPLSLEIVYLPHQNELIFVSFLQVSCKVEYWRSI
PPQSCV*TSWRPLILPVALVFLFLNPVKWWTKLVLLLLDRAFLHSLYLVVLHPLFLLVFA
LLLCLTRFHFRCLLPSY*RYHPY*KFFSWSELRRYVDRFPHLRKSLQSHYLLFHSCVKIY
FTLLQ*TVCFVLT*QWVVCQVEIFQNLNSESFTAQCEKSWL*RSNSK**NKRKKKFTRHC
LWKCDQTDPISPFKYSSRDNVVCQLKRYLVAG*SNMVDEGVVNPAALKELSLSVCSYN*F
ALKRYMCIIAVYYKEFRSFLVTF*SRNREMSTTTQPIW*CILHIVNVFGSYYNITILRIL
PFL*Y*L*SESTFINMATSGKSVIIKRLQALGFEISIYEL*DFVLS*GRKWMCEITYGRI
NNSNVC*CVKMAKCYWYASLSIHHY**RQN*NINCGFRTTLELQSKVIRSQ*LMKNNNFL
EPNERVETFRKILCTSLLNLLLGS*EMC*NRKNAPS**KTWPNQTLSSTSICISHNKVNA
A*LRIEVATPRIAQNGKFYGNRIHMTLRTKGTL*RTKLL*CEE*DDTVLPNTKDRVVEGG
IISREISFQLEHIHYQVTTICIFFFFSR*LFCSDVQKMGVALTQRFSGKLYIHISSWFGK
*RAAYLYEGKKAKQNIRKATIKSQWNLFSKFAFFQNIYPV*CINENYEHLFPYHTYIGCS
TFFFI*AYKMYTVVKYHFKILFEQS*NTTQVFFFKKIASMYFMYLKTLCLAIKDLVAPTK
*KKILKDARFELARTTVQQILSLPP*TTRPTLQRFILFVVSQNEIRQYDILRS*TFIKHI
*NNLITKRTT*DKTRPSLAELPKSINA*TISLDPRFRASTT*HDSYFI*YIR*VTFRELI
**TVLTTGYFPKTVYIRIVKTLRYYSSP*YNTFYRISGSIPHHYLKSG*VLR*LLGFHCD
*GYNIRYVDILEVLLEDLGIHKRESAILHNSINIIIIILYVNIH*SYYIINPCVSASTNL
DDYFSSFASSSNTVYDNILVT*ILVSR**LIFIPTLLYSAIVAKQTRLSILFKALLT*MN
H*EIYILSNTSRSEVPCLHPLVRFRLYEISGILWTKFVINLISSYFLNDIRTPG*PVLFK
SIEQPVYLHFIRYILGYALFKSSSAAA*KKQLKCCVGTSNK*SVISPFNI*SSKETFFGI
NCL*KL*T*VYRMYQKLSCRI*ESTKGARYFYIIYIFISPSILYVVIPYPITSSILAIQH
PITLITVSHQLCRHFTLYMIQVV*VHTNR*LIFSDNQILGS*THIIAISVNSGFNHFVCL
SYRSLVNI*FFQ*KRLKITMKITRGIFQQEQ*YTIHE*RSSYLTRTIQRFCTVFTVRVAS
HLSRISEGRNPIAKSILSPRSFK*AIVEYTQGQPLSLWLQCAPSSGGKHYRSNKTLKKLS
ATNEDCSIQIPLFSAK*TLLLCHINKKCHFLVLLQS*EWSIRYYYLNIRLITCSVAYLVS
V*GNCNIT*PVSHVFHEGRFCCCNYNPS*VKKKYLIPIIY*IQERRL*ITHRLSN*QIAN
TIS*SKVLSSYHSSTLVKQMQ*SQS**QLKQCKYFQYQMQLANQNR*R*KCKISCC***Q
YKPYLPKPYRGNNPLNTPSQYHQNNPMQTQQNPTRRI*LAKAIV*RYRYQTSANPLAQ*L
QLR*RSIV*ILPLKFLYCDEPSKEQSSH*QCQHRYNR*LLQ*VWEHS*LRHQNHYSSMEV
RSRRFLEWSNKTSGKRLEYPKTYQTTTLAGIRTF*G*SLDI*NTV*NRSLSN**LWLILL
LFLGMVSNALLNHQSIRESQVW*LPLHC*LRIQPSLKGLHLSHPWLQELII*RQDDVSCA
TRPYCQSFVKWYRLRIPIDSWSKGSYTGLCRSTFLRSQI**LLKGHQI*SLRPNRPNGSW
*MQICTQRSMGPRTYRY*CT*YTRSIRSPIGAGKKCRSGTVAPGLQHRTH*YLQTTETIL
CRSFFWPKQTKAHQRDLMWCKLCT*SSCHTS*QMEPRIKWTNQYLGKEHQPLCSWNRRIS
HKSHSMSLEQHQRRY**RR*TQL*RPLDQNEPISSS*TSSVDHLASMMVEGLGRLLRRFS
SILIRI*YHFPNFGKNRC*MCQEYSPDDPCWYICPSVKNLRFTLANFLL**FFSLYSLEM
QKLRSCFVISCRL*YDTSILSDLVFTCYSSSFK*IR**GMSTW***HEIVS*N*GC*RFR
QQNGLVLFLQRRFSKYYLRD*YR*FFLIRLRIYLYRLD*RQ*TIK*IYRKVRK*SKLLWF
VNGEVFSLIFCLENNFILKRKFSSTATFFVMLLFSLGESSLKISVEFHMTQPGLDVNVKL
HISQSLES*CMKFLHCVVLYVT*ESNCTS*ERKILFREELFEYILKDKKMSWQK*VSNEK
EIFSKKKMKKMTKYSISLIF*FSFSSKKLVHIHSLNRSSLVYTIMRIRLFSFDIKISTDY
FVHL*NKFCHDL*FSHNRDYLRTKNTLSPNLLLDQDFR*SPNYTS*FLLVMVCAVEIAQ*
NGFMCSDLIMNRNRNPHISFILTENRLSAAAMVPTFTLCGVRLVL*YKGTSGNKYTIIL*
NYDTGGQKF*R*SYKR*YRPRNL*GLFFFQQHLRCM*GKQRC**CRKLLHTLLRCNSCFL
Q*PVVYMGKIKIPGRTRSIEYI*YEES*TYDDG*AC*HNLRHSRFYE*IFPF**RTGI*K
KELRTTLVTG*CMQ**LR*KRY*IP*IYSQLSLHIFVTKNGHIMET*TQVSTLLASSRIC
FPRNPLYKMVRNFSRMIGGFDFARFHLQCLKQNLL*YTYIAGRH*DSYYQWPGKIFLR*V
K*TQRLPFGQ*CRKTNQRNK*N*LQSPQ*W****LWELRNVTYYNPLHQSCA*QSQCQQM
PRSD*PNRQQTPFQTNSSLFDYQSSQIY*KLWAMGLRCCQILKQYK**KSWRKTIETYRA
QTERYRATELNKC*KVSKRH*YTRNPQKHASALTRSPDATTYEYRYSSLTKMSRYLR**K
WHRNSSATLQPWKKPFEI*KKLPR*KFDNNSRGTLLHHRQKGPRTQGFSK*LILVPTF*E
PKMNHRCCLAG*QQNLPEIYHT*D*KKQQLSTHR**AVALHWQYQRPSTLRYRPMSNLMR
TRYLIGTTN*SACQT*LLTFLN*TFLFPSCDDLEQ*TKKNFFHIQIGTLPLLCSYHATYI
*LMKALQLFYLNYSTSCWVINDSTDGSSCNSIS*SCAVVHCATCAIILTPNFFRACTLPS
FGSPLRMTPKRWLLKPLSQR*FQVSNV*FRVPSPLRATTTTYTGWPLVSIRCLIRSVVIS
NLRVIGTQTPPAPSTTNGFSALHSSGTTKSNNLMSTLGSYSMAWSGDRGFCSA*VGVNIG
GCQVDAAILKFFNVSESP*SDSIPVCTGFQYAAFHLCTNNVDTKVLPTSVSVPVTNTIGC
CSCC*DLLFMTCALVIF*VLFTGLLVEKSISLYILQ*TNYQRDFILFCPIILNYK*PLFV
YFIFFWSGGCQQRNSFSIARITTNVPRNFIYTRCRGTARL**KTYLASLYVIEFTIERLS
GKECSRMQAGVGYRLTSGRRGDRRHVVVVVCYSRVQ*SRTK*GPYQADVKVFSRPSWWIH
P*RSCESSPKTFKSD**TLFAVLFPRRFWLSSSGSSFEDGFTIKHVRGSY*K*NKVFDNQ
ERVSW*YIWRYECL*S*EFYASYLQRSTQ*EHLRPSSLYCRWPSNQPERFRGPLECRRSY
RSQEAI*IA***DLCCDFGAYLTGCRRFATIPSTVLNRSSETM*PIRRFIHHGRDCYRIW
*NR*DFRIQALSKIPGPTWHQSFRSDQSCS*HIVRWEGLNQWIYDYECSGSQRQSCFQNL
FSK*PYWWLLHAWPHLHGQCPGMQCGRKVYGYTTAWRVEKTSVCN*KPNL*RTIPVHQEP
R*WAHWNCC*ACVSYWSCRYRRAIQEDRSRVVPEKVYIQGSTYPTFQLPVLHYATICDHD
RGIDEG*SSLD*SIT*VEIPHKPMIYDLIKSFAKEFLFLA*NAFFYAIIYIDITQNKKFM
VIYSSGPLYLTFLIIKLCRSLLHKRKLTSSGQERITGSTS*EIWTEMVRGRLPAFCAITV
LSSMFSH*R*LHSSAADTSHDPIFYLL*EERKRWDIIGSAYSSSNYC*TGSYNSYL*TLW
*IFPAESRLLLRQTCKFPSAFDYLPLLEILHYIFLY*PIRSNYSQDLECSKRCLYNLILC
KILQDVLGPGFSRGSNRCSPR*ENALPSH*SSMGSIFPRILLLSKQAISAVVFISTYKIT
YVAISAKLVMLPSK*LYDLSSEGKHCASLFKAAALVYHGFVT*ERIGSAM*HLEKMKFVN
MKLSPLC*GKSAIFKNVLCKKWYCAYEELRNWHH*SSHHCCLSLFFLGSTDSIHSPTISK
HAEKMIALATCTAFLDCVK*RNMKSRN*QVNSMNRIDGNLLYLT*PGVARM*KLCPDRYP
IWICIKNAQKKSVLIRIFPFFIA*KPSCSHI*TSQP*IVNNLIIFGLFIPDLMEQSTVDR
YYNFLLRTIRSLELHPLNSRLANLFGRTG*IQLFKGIQKVW**AYRNIWWLIQFD**EFC
GC*IIPFQLKSFTNRIYMRVLNSS**QQQENLDP*IIPLRNCGFWM*KTC*MTNI*RDSR
DFRISGWQLPFVHFKYQSFWTLILYLLSRWIHSMKLTDLKEQVHCFSKTGVFQPPS*VHS
KLKF*SR*SIIVWMYPRIRSKVLKS*NIT*TMRWQLMQ*RP*FSRNKNITWTAA**YSIN
KNTFSVYQSQ*CCNFRLSKSFSMVIRNGFGLVCLFPKKSLLFIQ*RLRM*ED*RSRRL*K
AVQSVLPSYLTRTCTVIFCG*MADYPFAKKIVGIMILQSVKRLRPNTKALMNYGITINHL
*NSKLS*YPMSASPPGRNRANALCTAIAHIIGRDSTEN**SLQILKRNITRKL*NYGTRL
YRVCFSMSTVNFL*VFKLLDFSIKHVKPFLTSFSNGIFPTELGCF*DILI*VPLGTMLFP
HLYLVNIM*NSLIKRALALSSFCLKKTLK*SRNANNTFLQ*KTNIGVEFYR*SYILGLEH
*HMHFSLDPCTNHQ*RLNQKLTKYHICFKQISISHEVSFPHVKLLQHIFA*NYKNV*CIG
SKRVIVRCTCIKSAQYPVPLLAQGNFPYKRALQ*LRK*GYFGDGHRCLSSLFPFSFPQEC
VK*RFRDKAGASKKLLLRVTWLRREE**RYAME*F*KRGTCFLETRNLNPRATAYKTRSW
LCKQERLFPIEERFLFFYARPSKNLHPI*HRHSTNTIIAPGFIGP*GNNTQKNKDYW*RS
RYIPSLPVTMVKMRLQFLYR*RKFFSLRQTHQRLHREFLA*FNEQGTSNPSSSCSYTKYS
LKASFSPLS*SWLTLI*NN*RS*ERLQLIVSPQRLFLEPEMAK*A*VGKTMLLVHIISFL
LFFQLSAAKAPPSKTSLINTHERRSIYSCYVGLRKETWGFNGSAICRYEPAIQSMLYCLY
EDTHEKGYSNKTLEKGFEEMRQFCYTPKFLNMTDAEFYTSLDNGTYYIQDQPKAGINITY
PIRLNTTLRKAYYDAYYGYYYNHDIPYYFGGIICAYFVGVMLLAGLIRFLNYTPIKKIMF
QQKLVNYVRGYTTLPTLYEKHAEPFSYLKVITGYLPTRFETLVILGYLILHTIFMAYKYQ
YDPYHIIFAAHRAEVAHFVAYRSGILSFAHLPLIVLFAGRNNFLQLISGLKHTSFIVFHK
WLGRMMFLDAIIHAAGFTNYYLYYKKWNTVRLRVYWKFGIATTCLAGMLIFFSIAAFRRH
YYETFMALHIVFAALFLYTCWEHVTNFSGIEWIYAAIAIWGVDRIVRITRIALLGFPKAD
LQLVGSDLVRVTVKKPKKFWKAKPGQYVFVSFLRPLCFWQSHPFTVMDSCVNDRELVIVL
KAKKGVTKLVRNFVERKGGKASMRLAIEGPYGSKSTAHRFDNVLLLAGGSGLPGPISHAL
ELGKTTAASGKNFVQLVIAVRGLDMLNACKKELMALKGLNVQVHIYNSKQELASAEKISS
NEVKNGETTAEKAPSSLSNSEKAPSESENTELPLSLNDTSISDLEFATFHVGRPNVEEIL
NESVNHSGSLAVVCCGPPIFVDTARNQTAKAVIRNPSRMIEYLEEYQAW*TIFHI*VNTQ
CIISSNCCNFINVDGLRLF*GTLVD*F*LLRLKLFQITLFQKNNRIKKQKNHT*DDRSFI
FSNSELYNTPIADRI*TNRSSAFMYLI*LPVFSYKDKIGV*CKDQEKKESRIPSNF*WTI
SSKNNSINTYIMFGGYTLVF*NAVPKVIY*INNYMMCS*ELNSKRLLKPFKR*LLVFQIH
MWR*GRHKIIWNDSVLTPIRFRNFKCLHYST*EK*KCVPLKYTEHRRTKKIH*AKSETAC
TTRHLVHHEECSIEPSITFSCSMLALSSLSVESSMLSVSVLASS*TSRSKRGSLSSRLVS
KRSTVSRNAFTQAFKTDLVLDPFSLA*DRTVI*EAYVVARNSMNKTASGKISILAILQEP
E*SKFIPRGILEQDIEPNFEARVTKAVNHRTV*TISITNINRTGKNLTIPK*TEDMIETA
KLNLRIRSTL*FVIMAKLANNKLVTDKPSWKYLSTWKVTDVVVNFNIYVLSYYYRS*LGN
KISSCKHRLYSPIYG*LYFTSVEPRKK*QLEKSLIHSLF*FFYISHT*LETRNFNFGQIH
KSF*EVGF*SPRDYKPTSLKDSIHFSPANARADIIQQAVQQIGSEFQ*QFAE*D*NNILR
LKKRLCELPNVFNFEAAKL*KTLVKIQALASMQTDYIIQYKVPYKRGTHFSTTGLNIIEE
*IRRKL*ILVIFIYGR*KISPDISL*KW*R*YTIISKCKIC**NAIKKRLTFCRPSSSKK
YTSMAPDI*LDLDQYMSKEI*HLFFLSQISGGIETATKIIPNPTAIESPNLVP*RAANTI
GATSLPIPEIAPIEGINWTLSLGSMYMEKRAGMLEAKKLYPNNVIDIPAEKNIPEFVGGI
DLCFKASDAPIIKACPSNETNNAKMDRKT*PLYSESFFFTSTVSLPVVSDSSNPPSLALP
QEHPTFINFGAK*LPVTPSIDATINAMP*NLVSQLTWSVRNSGIK*TTSLIINDDRNMLH
SKIKQEMSFFLSTLKNCFRALKRLFSEFVTLTSGFSRTTTNKRHTARIMKLEANVGAL*E
AMRYPLILKSQYPKNMTINCANAMKIPAAAR*IDRSLKTIPLSCAIDMM*LNTIAPEADA
APHIIRPPRRVFSDTAPPHEYKKLPTKDKK*SPTITHLMDPRKAAISPIMNETKT*TAAE
MA*ILNKNLSGLVSPFSKLLAY*FIEIILDLH*HLLL*CSQPHLRDIHRSRN*IGQLSKL
QPSISKTCVS*HLRFFSF*FIVPPSSEMDGFVMQLRYN*EERKST*QLESNVN*SFI**L
FIDGDSFPD*EILFRLEWDRLVWALYFCIKIVKSTYFSNRREQ*AFGNSNYLDCPPFPDS
CPIFF*DSDVEAKD*KNK*SGPL*A*RQRHVRKVSVFAIRRCKYVSAFFTAFSWRITVMY
FFFYIIRALHSSIHI*NSSVLMGFLENYSPRRIS*ALYLDVT**SESIMNNF*S*QNIRN
*TSFKNVFI*KLVFGKWLRWHTCNVLGKN*FIIRPVQNKSCHKKTSLHFISSGKYPNSKT
SETSVPPKVCLPVC*NSSCQVT*V*RII*CFLHRGLLGSLLCKHLDLKKKSIVFTGIAEK
LCLFSLMLSSKIQLKSTIKFP**YPL*ELNLKLQKRSQQAVWTDLRTLERDLLVWPVLCV
GNES*SAMGTSHVEDV*G*IHQKNAFIILIKGKTREKSKTGRRFFYSRIILSITGITLY*
RTKD*MKTFLLIYMRKKRQNSIQILIYQDLAQMML*FLIMTGGTLLFRSILISMSLTLRQ
QISMTF*NY*AIIHLQRNKKVFPIHLLLQA*AVWLKKLRAKITLLRGLG*SMSCLRTSFT
PYQEYQNGIYMSWNPNTQIWNVQKEIVMKSFYFQLYCAWGR*PYEKGNY*IIRT*TIVHF
CRRIVFQN*PLMLLSTIMLRKRLFPTCYLIPQSMDFAASF*WQIS*R**YP*STNYI*V*
MLYNLLWL*T*TTIQNARNYLSRTATELV*SCFFGTFGVLLACWQQFMEKILLSLWNKLQ
HLCRVKYPPAIKLINF**ISCKSESS*PLYKVRFFNGYILPAPQTRYHS*T*KENLRRFH
SRLPG*KAFRYSKNIFFTGAES*C*SYHV*ELKLLFYYIVRI*SLENPYKQ*PWQNQ*FT
KYGVNTLNSFPITKRKGMNVWIGIFVIL*EQRH*HYVFHVLYS*GISRWCSSLKVLNYLN
TF*HWKYCKI*FRYFLLNKTLLI*SNIRSVQYS*VVIALSNFGVAYFTKPFPS*FFDTLF
RNDLLRYKFTRGKIHMTW**VYPSKQHRS*KRWLKNLLKMLYA*INILSPGYQYKPLIMR
PDICFDLFMSNNG*QKNALRQLYVSRNICVFGN*TKYERFFSENIVTRT*YL*FSANILM
ISSAIATT*VSSAKWPVS**TTFKLSTSFR*ASAPATLKIVSFAPHATSTGIFESLKNF*
KAGYNFILF**SKNNLN*ISVWPVR*ISAISSV*AAGSTDSIAGTPSWYWHMTLAGSSRY
GIRDLTNTGSL*YDFQYSFNGPQKRSSRPSS*ALPF*VTMPVILEGNFKANRKPTGDP*S
NIYMANFSILKVSNKYPILSQRESKLNL*FSGVSVNPNPGRSGAMM*NCPASKGMRFLNM
LEDVGNPCSNKIVGLPAAPASRYQTFTPS*T*IL*NLAMIFDIFVLRPILTVKEKWSSSV
NLIVLIYVLFGSYHFWLLSLLKFLSRLCAAQSLGKLQTNGMQRRLWKR*ILNYHTFK*LC
**QR*MEI*KMHNIEKMHMRTFC*QTYDYLVY*KNLFTRPRCAQQLNQACE*HYVLAMRL
EYC*WQAGLSVTCALVRVCKHLLVQFQNYCLDL*NWINR*HLHASHLIHLKTDPEAAKSK
*DLFCCQTLPLILKKSVLHLPSCVEMQTW*LKKCIILVLQ*C*QLYRSYCFLSAHRLLIL
FLQILKIPHFS*YLYRIQTMRQRK*REEL*QKPAHKRRCL*NIFP*MPFLFPDKDVVLNV
HPISAHLYRLIREFFDSQRNHSIQLSRVPFCRYRHHSPNLSL*LIYKYHHWLYKNYSHIR
NLASYMNSF*RSSKIQKVEYSQ*NIFHRFYVKTRFDDQIDNQFWNPEEST*NLPFFYP*Y
QTHIASRRCF*NQLYTF*MNHYPCFLLLQIAKTSKQNLWER*LYPLRGLCRHRIYNLSMF
YQNRWSKK*NQFLRFRGPKPRLHHDHRTPIDGGLF*PQSTSLLHQWLKKWNTPHMVEAYR
QHFRHQTSFLTRNRRNMYP*YPYVQCNHANVENIYLMIQNHRETFSLPNPSLEASKSSNL
NRH*R*FSSSIVRLPCSLQPFPYSKRCW***YLQDLELFQSRHNRMCFY*RHALK*QKKY
HSSWISKGFQNRVLILSLLLNVKISILSQILK**MPLAY*HLDHTGILPRQTQYHQ*LHM
PSTHCLHEVRQQ*YSHQWTSSR*CFQR*FYYHLGKNLSKKPSFLFLKTSFLLGT*PSPHL
TDIQRVCLQTHNELHYQAFL*KFHLHLW*GMLLHDILDLRLIHNSCHHSK*KYPVL*H*N
LVAYLIAWLQVI*LS*KSVLYRVLRICYL*SQTNMLKN*NMG*TQLQQFFRR*CQTFLLF
VHHRGIYRRLLSNSA*PKIRRQLYRSIGKI*FRSQICFQWSLFPCHSNPPLEFRHTEYQR
VQFSWVFYIHHL*LIVMALLTQIYPSICHICWKRQSDYNLVYTGRLRP*QIQTNIRSRIH
HNYYKAFHLNSNL*MLFLPNTGRLVSSFYTCIWRH*HISHPPNPNLQNLPPHTF*SRMLL
KNQLYTRHLLKKLYCWFRNR*WQTFL*K*ILSQIHLVLDLSICRDGQNLWHWSAHIHSMF
YLGPKNNKIQIENRHLPLDHMGYTQ*YFPGHQ*HITQKNYEQISTLNRHL*R*KFFGLPN
RIHYRRQRNLSLT*FRQ*DLRFRYYKKGSGANIFQA**YHKGMNLHFPRQPLSNLTM*GR
YQQIF*FHIWLSFYYIFLCYESSQRKDETSQLLFLLRNEEKQYQYNQSEDLLSIQQVKIS
TLENLILKFLRELVGRFFHL*IS*I*E*LFFQ*NLHKFHTYGRAVLEQVDVPFEK*THHW
ISRCPWVTFHCIYHLVSKRLYVILISCIDK*FYH*THQIF*KFYLHQYLRLIVYMRHLSD
DRYRNHGSRTNIVSKRRYPQYQNPC*I*QSCSLNLLYGHLLSFSRKVRYCKRIPHRW*SK
FHFVFGYNHCRL*SKGNLQ*GTFYLSDG*L*SKKYPNDSFQRRV*SEPSMIFHDHR*RKI
WVINVSKQKPCPVHAKDQQLIREYALQFL*PLPNFLQNRNLSTRLDYLI*LNCWNRQSSL
D*MNILKESPLLWGRIPLH*VTE*RDMSKSCI*LGVIS*LRISYLFLVQSFFSKLGTLCY
DSMTKKKVADNLLVANWRHLNIFWVANILKIFS*YSKNI*PR*LQLF*VWLF*VDHVHFL
FSHQDNVFTI*WGIKQIKLETEQKYFDLLMSPVVR*YYKDMLLKLIFKE*ESLRDHSLEW
YSAKQILNGENFSSLCPIDAS*DDVRILF*CRHYLAKFIH*STNIPLTGMHLPKWSPLAV
VFSNATTFKLSKNDLFYKICM*WERLDRPACQVLFLSN*VGQSP*KC*CPCATHSVIQIC
G*IKS*ITEKCIRIYWVEECLIQLQYACPAAFYRFNNWLDFSLPFFFDESLRTNIRRNWC
DR*HMNTVDIFCVCSKISSIIDNIIE*NTTHFISYDFFRLNCVVILIIEIVVHCILHYTN
HQVTPQFH*LVTDSGPP*LHSIGKIVIFTTTFFVLTVTVFIKSSCP*MTVEPIKHSRLCK
VFIFFRWICDISYQ*IDPIFIVGSPSTIQFRVNIADDSSCMNNVTIMEMMVIVISVTKIV
LRAGGTPIS*TDQTVELCVVN*WIRLFIL*QNIKGRFDVFQSTLSTGFILDDFGDR**NV
RILIDNFTQIICV*PAYTFGNTNL*FGIGNFS**LQLFFRIL*KV*AKLRRPW*PRYLSV
*RCGKL*ARC*ITVHYTLSCRSELNAGIVVLHYITK*RFMMGQGKNHCAT*CRLTLGGIR
KFIGSCRTVRDTLQLEISNVHTCGLIIKDLVISFRRCDGQLNDKTINTSACFNFIF*AHL
Q*KVR*G*IVWSYHVT*PSDSIQKGDTIFENTLS*IA**FRNNGIESDAGTNLGI*RSMI
YTSCKSHTLNQRYFQVVRRIIGF**HYPC*RQGHFINLHSHT*IKIRS*ENNMSNSQRID
QIFCITGTVITTVAILIYCCMLNSKTI*TRGVLPQ*IRIHKGR*FLTTNNQICIKLVCLN
GTIV*HPISQ*HRIW*SVKNSWWFICRNSIEKIDNGRC*RVLRCGSGATGRG*QRRGGSF
CLSRR*GRRDGSLH*RRYINGI*CRRNRRGRRIYC*K***QKNVSC*TRWINWTNSR***
W*W*RTVFCNV*RVNWTSCRI**YRWRKSDLCPIRWVSRACCCRCERLD*ILG*VGWIEQ
SRGSRS*SNEGIFAGSCSCICPY*NSIYRFIRGQ*RRNNFCFLGRIGRHLSYQWIDCTF*
NRSQ*SSI*LCPRNR*R*RK*SRSRSRSSLR**CGDFTHC*CTWHD*GDAGNRTQIVY*T
FAFRIIICVNI*NSDRIIIGLCAYFLRYLACVV**RQ*QLNCCSCIRITVL*INWRCAHS
IFWRN*ERAMRSCRYSCYNHRLCNIRLTYCQSSVR*SFN*ISFQYFVCIIRYETYI*TFD
ET**KKKCQI*LHTSCFFVFFSVCRPLLWLSTC*NKHKKHT*YSFLKQIAPSIYM*SFTL
ACSLRMVYMLCYSFHTQLLFLTFWVQLYD*LVFPW*PNWEISCLFCWLS*QNIAEKSLAQ
LNSVTRFR*KGEKKRKESQIFQKYASKYQIGHKIASTPLSSKFSWQAGLFYSFAEGKASS
MLITLSRKHMRSLQRIKLMATHLVVLFLRYY*YGRFKEW*DFTFSNLKSKVYHLKCTSLW
AFTTLYIFLAVPYIFLNNENSKFYV*RLFRFLVLKVF*EYLGKRRTIVKEIATAHCFLAL
SLSVLQELRCLSVMIL*YQ*R*KLRQ*NHSF*QPSIK*KSF*LELGYQFQQIQHLYQNEV
LRGGNMTSSINNFQNLALW*L*NHHYILYSITVFSYTQLN*PDSIHLISDVKVPNGDSLM
GRFFYS*KFEELCWI*EKKQQAHFSLQPTSFSTHFS*QQHWLPYWLKPVRP*LYSKALNQ
KNRAIYYAG*LLRHRQEVSLFLFDF**THRDMLQCFPKFP*IFS*FHCICASLKVNHCGT
SLVCNLLCSLLSKSIPSPDY*FPVGHVEYY*QLAYILVQAVNFLVFLSLQRTIDLLN*SS
SFDSACFSLKIHFVFELDLDTNMAKHY*GALFLLL*AQFSLS*SLKWDHLVEMKEYYAHF
*ETHFSDLC*REML*SK*FQFEFYLLQTSVSF*VFRFQYFQLPRSIHTYLLGVIVDQSDS
PPVCPPYEWESLALF*KRLFRSFQACLQFQYRNPLSL*GTSPY*LDCFESQMELSLCYTF
FHSLNKHAQKLRLCLLS*HLLSNLLSCH*NCRLTIVRNLFLTNDHNLNSPKILE*KALDE
NSMVYQTLM*GAKESERSDRAYRLRLITGSEF*K*KISYVYHLDLVSCYSVIQSLFYQWS
QKIHKGLPPCSRLHDYMTNSLPYLPFSKFFLSFFGFQRVTVFLNLSYLPKLNKTYRIL*V
WLICFLQ*NNRELYPQRCIPLACSRV*EAVQILEPSL*RTIQSLWGF*S*AMRIYSQLGY
L*YHHNYEFETQQGRKQTGGHQQSLHDYLGQRYHR*ESAYHSQTHLPKEYSDFGKQPHKK
VDSPESMYRN*IEVYC*ANFHTFRMTAIVLEGQSHLPEHSLCSSSDLHYCMRKRLLPFLG
MFHISVPRRRFLQRVWMKMKIFFDNLQIYFVVLLILA*RKNLIIL*SSRPARLFSSIRLI
YQSDYGASFTISV*LAVNAKLIVVNQQVLCSLIKGSI*EVM*SYFVQLELLPFYKCELLF
ISSKEII*MALLIY*TFSKQK*NF*GTVR*SCARSKESGKDR*HLVQ*DEKIYR*LIEDK
VVLKNSGASSLSLTHSRLFFRIFAQ*VRLSLCRFSILDLSRQ*QFPNGDFFFHDILEFAH
FGTSEKIADDSVVRESH*FYEAASRV*IIAHVFRCGTHFSQLCCKNRLLKMPPNVVAFS*
KLMAKV*PPNSVVCRHSLDQGITDGLYAVSRSL*FHF*SVQ*RFESFLSQIVYRTNIAST
NRVRTAQTLTSAVWFF*LGVINLSIRQARSLRIQLNMGNKTNF*G*GNCSLGAKN*GPDI
VLHKLYSCLYDGRRYLCKHLSKITLYETFLGRNMIAFSL*MMAPTSCLNNFNLARRSSLW
SWFVLFKT*SNSLA*KS**TPFRCKRPTLLLFDFS**FDNSISL*FDLSFQFYTC**HTE
SSLDGRKHKRKSGS*VSGCCLR*YYSAALYSQFTNKLGS*P*FYSRHFWLLQNIVII*RS
YKVLGQDWIHLVLFLKITKMKQNKKCQRAALKGKN*N**TFLIKMKGRKQYTL*QSV*KE
YSESSKKALFQTHEEKKFP*MNDCMIVLACNICRIHSILKRYCRGIPEQQINHVTTL*RR
RVWLPCCNILVTAGTLKLGRCPREEHVLLSNLSRYIYIYIYMTHLVKHLCFVSYEGLGTI
LLELRSLIVEKRS*T*FHLFIVLVAGNMKTFALATYLFT*CLIFEHCYPSYTTHFLKEES
LEETFLCPSL*SAVSFSLPYEVKGVPL*RKRPKCSY*YTPLHAKKFQGKYPGILIFYTCT
NILLLEVVMVDLKSI*T*WISILLKTAIRN*GVLFPTLLMRQL*SNLMLNKLLNKGFIFV
RQV*PWNAFQ*KVWILLFWRAKPLAIFCVYHGQLSRVSVSGRIAIR*RSF*RMSVCWLNQ
ERWSLS*EDQALAVHHF*RALLVRPVSLQVV*QQDIYRTMVSLRKK*CNITSQM*SIMVS
KMFISHI*Q*NKL*ILLFPVRCPQKESIM*RKKSILLPIENSMLKFLV*RILSIPKLVTI
SSAVYLEVSVNAFPLLKH*QRKVQFTAGIMLQEVLTLLPR*NLHELFVL*QIC*VQRPLL
RFTKPVKTFMKLLIKSLFYTLEDKYFAAKLLKQKIILKTWVTCVHRDNRLLNI*PQLLIL
MVCTK*SLALSIKYLIPLMNSKNTGLIPQNMPA*KVKFRSTNMK*ILNGPKKHTMSLWHK
KSRKVQEKNLIIRSLIGSKLDFALLEVF*GFTVISHTPLSTHALL*HRLLSLGHCSTKHL
LQL*GPFLEVAFCFFPSYIIL*WV*LILVSSTGQYCKNTRSIHYIIPQLKR*QVRFLLFH
SE*LV*HFS*SSCTS*PVCIEAPVLFLLCICY*QCVQKLLQVCFRWFHLYAIHCPRPTPL
PVL*CYLLPCIRRT*YNYLQCIHGLSGFRTFYPLDMHLNRC*MQNFMEDIWIVVALWFLL
DLGLKTSCQKIKCVLLLVQGLANLGS*VMII*GPNINMSTKILGETSASCGVS*LATSS*
GRFSLSTKVLSKVVVMLWSSRRAQRMLYKDHGAAKMTKRTLMPL*QHRI*KR*LQVTTIA
QVQTLKVWNLPGCLFGKMFLSQFLILADNVNFWTA*AVTVFLVL*QH**VSPALVRPHY*
TLWLKGTWERLLVIC*LMVSQWTLVSKGVPVMFNSKIFMLLNLLSKNRYNLVLVCVGHSL
FLTLKRWNMLKKLYLFLKCRSSQKLLSAKLVTA*MLNRERNYQLALS*LASRICYCFWTN
RPLAWIPNPRGPSSKC*KD*L*QVNQFYVLFINHQLLFLNSLTDYCFWEKAVKQFILVK*
VKIQVLSLSISKRTEPGNVNKMKIRQSIF*KP*ELGPPLLFNRTGLIYGKNLTSMQTLTK
K*MT*LRTYLLQLCIKQLQGPLSMQHRIPTNSIMC*KDPV*HFGET*TTSWPK*CY**SV
ACSLVLPFSMWV*MLLDYKIAYLPVSWLSLYQLLQQTKYRSVLPLLRSYMKFVSPNLICF
IGLYF*LPII*MNCLTIYCFQQFFSFHHISLWVSLPKPLGQVFFI*TMPYFFNFTILVLL
**FCTCLQIYNLPMLL*VLYFRFCSLSAVLSNLPL*CLVSGHSCGNYPLTRIFCKI*LDY
*CMTNP*DVQRKSCLFSTPR*AKHVVNLPNRFLNLGLGILQIQMQQQIAPIVSTK*VMNT
WRA*MLALVTYGETSVSFRLISFSTLPV*LWFITLFKLSIFPL*KLAS*KE*QVNLRENE
EKNCRYTMGAGEAVF*PI*HTIL*ILGYMMM*ILQKCNVILFKEIG*LLFMQTLVIKAIN
T*SQISILVHS*CFFMNTTH*FTVKLPTFRGTYLQSVCFIFTTNAI*LLSAG*TA**CS*
GPCMTFEFEHY*SS*NFVNEKIM*QTSANNLKNFIRDNDKALNIET**MYC*EKNRHNLI
FIHINVFTRTLLVDSFDIRFPAQF**GWDVKYFFQINHFLFLPF*YGFFLVSSVFFFKSK
KYSDPKLTKSLQSPPVTLNLVLPLVIIFILGQVQKLLGLNVQTLSLI*IIYHYKGFIYKQ
VKKRNKRKKLQPHLNIEFVLSL*SVYLAALQKNTTSPLITVDSINVSTLLNGKSRPWHKF
AT*IITGVQMNGWFCRRNLKFDVRFGMIGLKNRNQFVDTHRICSLQILVSVNNESAIKDR
SIFMQNGGLS*IKSSNVPFNDLTSWKQCPLCNFKRFVRADLNFCTTNGLLTLDFVQVKIR
VVGHINWSSITTN*LCLVFHV*SHFCNIQSVLHCDFQVTWKLVRVGLCVIIQQFKFNNVN
ALGRILNRGRLVLLKI*GTDTAVICVTTIVNS*LVRTIIQAENTLGDTVGITTNCSAHHV
TIC*IVLYV*ITLND*LAVYLQVYQSCTKWRNGSLELFLITNCNDTILIITVTI*HFAVC
YLF*FFFSLLIIQTDQLSYQTSTYLCIYMLKV*SVHKNVSHVYYILRHPHNILTDLNNTG
*EVYFIIPLNELSCQRLLFTSLWFVGYSVAT**TRKEKISTPLF*MLSEVIIVGVLQM*M
KYDVLWGAFLFQES*TIPMGLRDYVSLEFFSISPFLFLKSAPCCNQPGYYLTNFSHLHSL
PRKKLLPPWGYYKIYLTSLVCSQKV*LF*LQGFVSE*IVNAQNRKVEVGYAFLCIEWRGI
KNNAHIGT*AQMRGMT*LCKDR*QPRMWNSIPNDDVNVRG*Y*II*Y*YPRLKTGKIARN
LFKRRRQAVSIEISVYER*NLLGTEFYRSSGRIALLP*HPP*SQDNMVNEIYKAISLGVI
FFFRCASVV*ILSHLINQKKKKKKEKKRKINKMQSSTESDRDIQDGPDADIHVAPPVEKE
WSDGFDDNEVINGDNVEPPKRGLIGYLVIYLLCYPISFGGFLPGWDSGITAGFINMDNFK
MNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCAIGGLIFARLADTLGRRLAIVIVVLVYMV
GAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFG
IFLGYCSVYGTRKYDNTAQWRVPLGLCFLWTLIIIIGMLLVPESPRYLIECERHEEARAS
IAKINKVSPEDPWVLKQADEINAGVLAQRELGEASWKELFSVKTKVLQRLITGILVQTFL
QLTGENYFFFYGTTIFKSVGLTDGFETSIVLGTVNFFSTIIAVMVVDKIGRRKCLLFGAA
GMMACMVIFASIGVKCLYPHGQDGPSSKGAGNAMIVFTCFYIFCFATTWAPVAYIVVAES
FPSKVKSRAMSISTACNWLWQFLIGFFTPFITGSIHFYYGYVFVGCLVAMFLYVFFFLPE
TIGLSLEEIQLLYEEGIKPWKSASWVPPSRRGIPSEESKTEKKDWKKFLKFSKGSD*S*S
AYACLDRQHCILYFT**CVILICHEFMKILGAMKINICRNWYVS*VKSIH*DKIVSNS*S
FIQFFFFFFT*SGVE*HDMVMVMRNSKWIHLTID*KS*KMRLKEHNTLLFV*IKQYTKIR
HYIYSTQDI*SLLSRARRSDHL*NHTWSKISLIAAIGPLS*TVSREWVNCATNSLLSRIS
GLKSTSMLSSS*GSLPPLTAAAFKVGAIGSSISNGFPFMSTPVR*RNQPATHTANNLYLP
SGLRNCS*IDGKTYLGILPEPIKQIRATVS*IAGLENLSNTDAVYSSKSTPGTLGNNGIT
SSRIKTRIYLLIVGSLTTSCI*V*PAKYPKYPIAECPPLSRRNFINS*ESTSLTT*TPTS
SHGGRPSEKLSSRTHWMKGSATTGH*SLIPQVSATYLRSLSVQRGVTRSTMLLGEVTLSS
IQAANFSSFFNLANATSMVFTVTPFWGMLSHDIIVNGVRPLL*RNNRASYRYPYRVSGFS
GWFKSLIISGASVIKEFVASLW**PFSVTVKETMCVSGLAIFSITALGSSGAYM*AVIEP
TI*ALVSLIPRSTRVYRQSWAFMASRISASAFIKPTPHMDQSFKWCSCIRRCMKTAKWER
WNAPTPR*TIPCLTPSLG*VGIGRVDSKLFRVLAFKLVAVVSSDFVIFFFLFKLLLFLFS
FL*LFLFIFIGVIRKDLDEVEILTIG**MFAIYMQKMNEF*TMSLQPL*PPSS*NMIVSN
LFGNAKSDS*LFLDFAMPSPTTTAEYTRYPSIYPPLMRKLNWFTSARKVYKMTYHGGEC*
IKKVAS*K*KKSVRGMNCLLSSSYGHFSPCQGKVTIRWGIAG*GDSGTKAKIKIGT*EGT
KLPHVSSFAISLIYCAPCRKISFRHLKNKVPGVNFW*WQAKYTEVGKQHVASAYIGLSRN
EIIKKILCGKPLFY*AF*CFLFPST*TTQYFTPVPYLPLPWHHAYTLTVNSHRPHYTRFK
KEGGQSC*YLYLYITKLRYKTFTLRVKSVPIFMDPPKCQIVIKRLITLMHRCNTVLLLSK
KLHIV*ESKANIFE*LRVLIDYYLNAKFNICCFQRPSLFHNTETNIYIYIYIYTLQFIF*
SIF*IKVPFCRRKDSSTLL*KLKTMEY*SSQVTVVEIGQTLHLAQGRHHLGHVLSQDNLH
QRD*PLFLLVKNL*HFGSKHQPNYLF*PIRDI*NSLHHQWQKRFLPQQLLP*SFFQLE*T
LSCHKGLKYC*PAHLEKYQRLCKSNQHLYI*MSPHLEKYVSARCLKKPLLCSSTT*YHFL
RDSLSHFFLGYRCITQSPAVAYRNYE*WKYAFCQT*SPPNT*ITIHQLVHN*QSHRQEKV
CDLHLRFEKPLFQNTLYSYPRRYKLNQLDQPTLSQLQEPRYQTLWPCLTPKLPPYHQSWQ
PYL**LQYHYQEHFLTAGSTWYNPLKPSNGQLRVENTHN*ML*RALLRMSHPVPCTSDLP
QTHQTHQHQQQLCSLC*LSYILQFLSSFLCSFL*IMKNNDEEMCVYQ*FITAFVSSLQQL
IY*YL**ASFVQPDKKD*SCRVDIQLIFIAF*RLLIQYYQLQSLSHVSLITKSKLYNAHL
PSTTSTATMRHH*SLLQDPHYENTWLTIQSAGDGLLL*RVSGKALLDSSQVLPIV*ETRA
RDSAVFYDENMKINT*LIE*A*LGNLTNSQKKKKKKKTRASKLTLTLINKIRKNVPENSI
MN**QYH*RLCTVFKN*SRALTKKCPDFIMRPPLNS*ELYGMLWKAITLFDNSKISHNTS
PIVYHVL*NIAARICKHTLTYILVITWVLE*SPFLPCFRNINQHRFSFTRNCSKLLLFF*
SWL*L*NSTAA**TRCQQISSCELYKKHCE*LNLSKLVTYLITLM*NTLY*IWGKRLDFC
PLKVLRPIVAFVCPRIFSETV*HGCAVRFATQDFGSGRYHGYRLPFGGGWPVLGFIPF*L
Q*F*SWR*LLFCQ*FKYSTVNILYQINSPSFLKKSSKVHQVHTLLIGTLLQYISIPTCMK
TKHGKLHIFFLMVLTAKKHSGKPF*SQLF*GDKTKILGSVQLRFWSLTPKTRCRFILQK*
THSGG*SMVRRNANLLCWKMSSFLRKPIAAS*HGVARESGFLSLH*TSFLICLTSLFVQI
YHQHAWYLIG**TFSLE**MIFKT*GLNR*KLMIKCSTYQIL*TSRVLALKNGIQLQGKR
IHDYLKRGSGKTKSFSLMGLIVRHSLNGTLVAFCSQKNLRRLDH*TLNFGNTFKKRN*AV
TMSRYHKDRNIYFDLEATRRINY*YFS*RTFLKLDSIN*RHLLPLHFSPSYLARKGGVTS
RNQIFSSASSFNPASGYILFYHTRFFEHQLLSKPSAFSGYNYVIAPRHSRRIHEFADANS
IRLPTHV*YLVRISRDRNITSMEAV*SRLNMGLDNKLLNEGLKSKFGFSF*PKAETSQAR
KRGFQGTSAPL*LAFSHSAHTNTHECHKTVLHIRSLSKMYDSFKNKNIFIVIMRLCER*D
MENM*GAK*ASVNESFK***QMEERV*IELLQLYAFEVCAFISLFLVKITSALTNKTNTM
VKLTSIAAGVAAIAATASATTTLAQSDERVNLVELGVYVSDIRAHLAQYYMFQAAHPTET
YPVEVAEAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSTRLKPAISKALSKDGIYTIAN*
GVMPLRMKIHRQ*KVMKK*NKKLLFLMI*IPLII*MYINIIDLFDQ*RCS*SIS*IR*T*
ERNFYTIVEKAWTEIKLTEYAQ*TTMKLEAYDFAALCPSIKMSRCFFFHFLARRVGPYRI
CVTSKNKIADQGSASYKSWYQTLI*RPSFLTLKISKFLGCDSFCVTVTRNKAEGLVFYQQ
*DRGW*DEVRQYRNVRFSIRR**VILP*NYLAFR*LLQKQQTYHRIVFFRYSLFV*VVSH
TRLKMHQLSF*DIAVSIWEWK*DTILS*HRHEFEPLPYCFSVNIECYDSEVAYYSNVWSV
KVRNILKWHPFKQMVILRNFYVNDVMVVLILQVNMFIS*S*KINNFYV*VILVVILWVY*
NKCV*IEWLVYGAKVV*RMY*EQLYNIWGRRMRYRY*NVDNRGSYG*MAQGIDR*GKCRA
**CGCI*Y*FSERWVMEWSAI*E*GKLRWYIL*HSCAYAPSI*VKVSMACGGGIRVVG*V
YVYYLRSFVNVSIWWVNNSIVSSRWGMVG*WQGKW*WGWIWVIGG*RLWWAVVSGK*RDG
WWLEL*NGMEQGNEWGGRVMEGTLRDRFIRVGLE*G*GSVRVVLG*CVGVVCVGVWVWVC
GCGCGVWVWCVGVVWVWCVGVCGCGVGVVWCVGVGVGVVCVGVVWVCGCGCGVWCVCGCG
CGCGVWVWVWCVGVVCGCVWVWCG