Protein Translation for a region of Chromosome XI



Send questions or suggestions to SGD

BLAST search


Protein translation of the coding sequence.

Other Formats Available: GCG | FASTA

HHTHTPHPHTHHTHTPHPHTTPTTLTLF*SNPDQPVSKPTLTLPYLSTRYPAPLNHTTPT
HHPSLYCHQPTVHHNRYPPITHI*PHYHLPCHYPTIHHVLLTVLLFYPPY*NVNK*S*II
HIYLPYHSNPTTHHMPYSPSLVY*YGIRTRMLRIYHSQLTLLSHSTPWPSLTKSVRCTHI
IIHGTCLSGLYPVQFTHKTHDYPHFNIYISFSGSKYCITALNAYIIPLLLHILTIQFIHT
YFNIPTKSPLKLPKHKNILLFNNNT*THSIAYLYHHDVINVKVP*YYHCLNGCHFKIFRT
YTDHTLE*YAPHYCNTLYSLSYNIVVAHTHAGAMIQWHPISIPIC*PQYPKRITDVSLIL
YVTLLIRRDYI*TRRYCDRYVI**DL*RNVK*FYGNITYQRRILKRTLRYCLTSSYHPLS
YC**NTNPSALFLVTVTQKLSQPRNFDIFSVKK*GSLNESLIP*LRNSHCPDLQSCS*K*
RIFYTARRDAPKNEKRSSDSFLWKDKVLRSHTLPISLLFIGHTLLALLPSTLFLQ*CKIS
FYVYHIHKMLHEHRH*SNRFIILIYIYIIYGIYIIKKKVVFLFYFVR*FSMSMETRS*NW
RLSLICDSVDTVLG*STGDSWSQSGRVPWDTSDNSGDLFSWNTSQHGGEVTIVENSFSNF
NWVGLTWMSCLKQVVLGQMSSDIGDVNTQFDQVNSFVRWR*SGSGWGSGNTSSDGGDTSS
D*S*FDHYICFVS*C*YKLNRKERNKNIFSKTYS*SSSIYTHAFISHHYLNDSLTSAHLA
PHISSISHLSHNLIITMEMLLFLNESYIFHRLRMWSTVLWHSCVFVCVECENANYRVPRC
LIKPFSVPVTFPFSVKKNIRILDLDPRTEAYCLSPYSVCSKRLPCKKYFYLLNSYNIKRV
LGVVYC*RLQIREFSANALVQLRNCSR*RRMVLREVDVQRIVYDKNKIVTVYKY*TLLEK
SFSPKMNVGILITSLPWHFFISF*LRTWHFFN*LYLINISFYLNFTKPKVIMVIKPQYIY
VYVEEVSIRPKRQYYI*VCTRQY*IYLPISINIPEKYRISFSGIKYFSFKIFICKLEYIG
YYDVHLKYRETYLELTYQTLS*LLKMKNSWAVTPEIPQKKEQLSRKVCRSPKGTEGATNS
FHKEFLSCWQKK*VTYYRFNFYNSIVVPIWKRSPQNYSTRK*LYQRRHLENLIYHR*NFP
RNLLKVPLNHLV*LLNCFQLHHFRFQALHRYFSFLC*KLFFLFFPLI***KSNRSFAKFE
*EVSTFLGEYDQICFPFL*MQFSVKYTYCVDPQSLQDI*NKLVRTNFSE*IIGYLYFPYT
VEKWYKFELML*KRSHK*ETTHCLNGAIFWRGIMT*KIICCCLIQNRSQGH*STNVMNLV
EPGR*N*IFSHQNLDVLRYKDWINFLSYGELHAIIEVR*THYHLN*MHLSKNPTA*TF*W
*TFLSPR**VECQAVSHEHEFVS*YFSVLMLFYTEGCPLMKNSFLDVPCLQNRR*FGPEF
L*RVKF*RP*IGSITTISPSKVFPLLDDFYSDINDEDLH*GPYG*LCQLSDHE*ICNVTD
RPRQDPPHLCTGNVKIKIAHAQYKKL*PKQKTLKLYGRLQ*PLALLLDGMLST*WLS*HP
LYNNFFYCPD*GKLLCADQFYDFLGL*QNNLADPLILFLYEQFGNYRKNR*QKNQLNTHT
KLHNLEAIHISIQ*HLVSLSAVGQSQWN*SPRVLSNDALFSSCYG*VLGLAISPLCIWQK
YLFELLILLDTTLVHKECAYCALKINISCWKEGFVLREC*AGIVLLAEIQALQYDEPSLI
LNISCIFS*VGPPWRKCFLYIHIAFDFEKSNFHRTVLLDRT*AFLLYKSGTTLQAFFYSA
YLIFFFD*VPYSSFSIDYGKYIATDSLFPKQPLLVTSAGQLICNQLLYI*IKLLSSFDVS
NIF*LQT*SAHSSFQGFL*FSVLWLFPLLT*RRCMEDNNYFKVLLRSRYF*EYSLWV*DN
KIYSVFLLFPFFRFLQAKHTYIKMPSDIQFSILLLI*NYITDTRIY*FVHY*PFGDVRRT
A*RSS*GC*K*IEFKW*RRY*REYLNLDRGA*WRIWVVYSSCFYSVQLFYLGGKFWLCYL
FSALFRE*YFCWWE*IRLCFYRWVSIQLWTFFCPSYNMALSYIFNSIHYRLRDTVSRGSA
TACSFFCHTLGNLSHARRFNWIRFSIYFHTQCHTHPTMVQK*KIFSLWYRNCWKRVRWYC
L*LGNAKYSTKEGR*MGAHCSVHNMHIT*HHCAYVDQNNTSRPTST*EILQI*IARL*CA
FKFRGLVTFWICIICYVRICCPFVFLV*FYR*FRLY**ARLIRIVHGECRLSAGTTNCGS
HC**IWITNSWHDIAPCHGHPLLGHVDTL*KFGHCDSFWIIGWFYYGNNLANNCFNCYTH
CWSSKASWYLW*YLDFYGGFCLSCPHNRSGTSFN*YEWKRLLSYSNIRGFCVLWC*FMPM
AIERVYNSSR*DCCA*SLFS*PK*IAFKR*VITYE*MSFSL*TIT*ESLKVTFISHCR*E
GDRVARKFFALSAF*ICLLVL*IMII*YNNR**KHFFLQIESLTGFLKENISDLLPTKIF
H*IPSRNIR*G*NFFRAIIFLVLYMFDGILFKEDL*SYVPHRFMCY*YIL*IKRSTQEMK
HFLNFCHQHKNMRIYAFVIPINLNLNAKPYFAT*CWFGAF*EKELGSDIMHRIYYLPTEL
LQTFRPSVID*IKSKFLHV*LWHIRAV*ESKVLLSKDQK*CISRS*LRISLFFSTC*SHI
YF*VQDDS*QLIMNKPGKKKKRKSCKRRQRWRRENINRTICWIM*PLLYTYPDYIVLATV
IIFLSGTLNQTLSLSILYA*VMSIISKTRCVILLHSTKTGIQRKLKRYMNGWYGK*NNSH
YKACGKFSRTEVSLCSFVYLPCICV*Y*NTQLTFHKICLRAV*KFSDHCSHFKYSQIAKK
GFHCRFIEILTL*IQGLYRANFLRKKTMRHTTTFTNSIKEIFKI*IKYQRTAVLCFNYLL
TIKL*AAFSIDILKFG*VLLMK*LVLSKK*SPALILFKVLNGFCRLI*NYFCGFIPHFVN
KNRRSTANHR**ATQFSRFM*KFLNIWSPAMENNTIKTKWIGRLF*SSCHNSAFFISLLI
LLRNI*TITRG**WDFHCVVDVKLYIQIF*THQLRLISLEYVESSNCNH*FYRLFSSSR*
RLSKFNCMCNRSRQTGTSSE*QYIIVIIDRR*RTIWTFYS*SHRCLTSIATHILFDKSCY
SLFFFQDNNQFTILAY*IQNSKWM*LPEVQWM*KRNENILPRFGPPWPCRFFNC*TNEII
PD*L*GSFGETKIRSFDNSNNPVNDPNRNSSVYPLNAT*TNNMLPTCIKEHCTKDDMKKK
KGFIKILPEYCKGKENHCAS*TKCCHPELPI*SVFTCCPSFIRYRITSICRAMNHSIQKH
HSSQPFVKHNEGSIFNPRNILEKVVSSREKNY*WKVCECEYTTSVCHISSNLNSTRLEYY
IFRIVFITVCQKNGMKHEISKNNDTL*SCR*ISCEYSKIREI*RMFASNGR*SEVSPYIS
HKLLLQ*NSFKGSVIHAMKNACKSHDSDKISTYNATIYVSDI*VSIETMQCMIVGFS*LC
IHFNWIC*VCTAFDIGRHMPRSVV*NVIKLRISHVLKSITITCTVFFDGTKCFF*GFIRI
TFFIQRFIDTIQH*LKRWFVRTYW**TLRLAGILPSNFLKNPRAGISDKQGHLVTNNCLC
R*CSCS*QAEKQNSAQDGRPMHYIRWVS*ALDKKDFITTVAKNHVHFLRLIYLVAN**YL
AITEFRVCCPRKEGFCSSEKNSEKQGNSTIV*NVE**VAC*FYYGTNDTPIFSTKSIPTS
IIEPTICQCNHYRYFILI*RVYFFITSKFTCFPVNPK*RQKRPGCNYE*MYNNHPVCIVN
FQLESHNAMNFDSFLCDILW*T*RTGNFWYNGF*PIWFISGAFAKSVFV*LCFLAERHYD
VIHCYGYLCSSCCLFLPKKVFSLEYILDHFIVKFLYLFKTKNGSIHTSPYQKHSISFELF
VRLNSVQYSKGYSRRHKISIFPYPCSRNTTLRFFLLQSIKSLRRQLEKS*NSKELSWANR
N*R*PE*NIQDHSSTLVSRLLSMV*LSHAFC*TNLAFSDIL*CGPIQILAHPKPIIVHL*
RANEHSYQFHK*LVLARRSN*LAYYNIIDVTFFHSEGGK*TLKKYARILDFRLVFNHFAL
PD*RLL*KTSWFGTILLGENFKIVQKIILVFLPH*LIQCGTTWRSFISIYYGTF*VCGSW
LTHRHFLTS*YRFR*IC*LYLFTRPDHNACNIEYLISILDIRTVNVCP*SS*LLTY*LQE
MMEKI*VYLQMKTLEHCR*RKNGFSRHAVYLFVNFWKFYIFCTIFFSTRYMFLFQ*KSSF
*RAKNTFDLSV*DNNIASSA**PCLYLPLSHLV*ADWL**RVICIKICSSLSF*QIRNTT
PDNNTKSFLGTSENWVS*LIVNLNITVM*GKILN*KGKKKCYFSILNEDSVC*TWIFHSI
RFLYFQIHFI*TFESWDIKLHAIGKVVMNSI*N*GRTVTEVFCYELFMNLELLIWSGSKS
SFFCGAMITQSAHII*SALYL*HQVRP*KFILSLDNERSYRTIFVFPI*SKTN*KLQCCN
F*NAERSFHQLNRSRRPFLN*AAL*NAEHFTIHHAIFNGKINKSLNCLHLNANYTSYI*N
C*HILFLFDTSLGISQKGGSRIQKNKVHSP*LMYEVNGKVRMVLSTQVIL*D*NLKLFQV
NTIMIPTMIPTILNIVIVNLIFHNLIYRLAILNGYQQTIENLLI*NEF*L*RRKCVL*GT
SIVV*KFYN*LSQCMIRPLGGFFFPTI*MQIVRSCNSNNKPLIPSSNWHIAIRMRGDGVK
DRSIDVLSLKHFESQKVVLPQDLFMDNFTWMFYEFFKCFTFRTWLLLLLLMWLPGFLSQI
KSINRIFPFKLCILVSCLVGIFLPNIYSFSHKSVLTNQLTQFSKEIVEHAPGTDTHDWET
VAANLNSYFYENKAWNTEYFFFNAAECQKAFRKVLLEPFSVKKDESSKIKSFGDSVPYIE
EALQVYSTEFDKKWKLFNTEKVWSPDNLEHVQLPKKTYRYKFTWVLKRIFNLWLFPAFIL
FLACIYVSWDKGHLFRILCCGGGFLLMVRVFQNMRPFSMHMEDKMQFLSTIINEQESGAN
GWDEIAKKMNRYLFEKKVWTSEEFFFDGIDCEWFFNHFFYRLLSTKKPMFDRPLNVELWP
YIKEAQLTRKQAPPV*EQACLFNL*IV*FIRCE*PKQGRLLLLLQLFFFLFPSG*QKPVY
*QK*IIITKKYEYKNKLQ*IVIFIKYKKKKFLFFLYFIIK*FNYLYYLNVVIYY**LYFI
NIYTI*KFKKIII*K**IIII***NNI*IKMIRLY*FI*FSNY*INNNLILTFPNIIKNG
YCQTH*LIIL*YFNI*FT*FVVIIINEIEKL*SN*LCNSLIFQIIKEY*VLVGTGHNYPF
*T*PCNSFPVYC*SREHVESYINTCVEYFTRIYCYKRALSNTSLISAVELTW*PCLMLYC
LWDLSRISPYFFPTDIM*NTNLSFRVAL*NSIVE*LGIHICGCCEYLDTYYDYQKKVKN*
I*EDFYSFGLG*VIIP*NRGLSFPVDHKYLHARSRLISNKSRRYCVWKREFFLRIK*DIM
TVTFN*SRDMFFQLRSYVFTGCKPRNALLF*FKICKRN*YTSNAHSHSQKLYY*FDISSI
LPSHTLSFCQKIFPHKGVSSVKYNTSRKICRVIRV*IS*RLFLLNSLQNLNHVINVKSND
ICRVKVDN*SFPILHYKTELKIQKYTLNRWAIFLPRD*SSISLHVYITST*YYAYFLPN*
LFLF*KCTCKSQTSCGLNNHLHAFRKKVHAFY*LLVANR*NIIDIFANNGKCVLTEVLCL
SAICDSFWRIDMNNGTRSEGLLSIVTSFRFNPKNFAAWRKASSGKCRS*KEPTTAQRNK*
CIKLSNLF**LFCRRTLPCNNIRMIVGRNQCKTMFGC*LTPNLLAIFSIPVIPYDMCSVT
GCSSNFKGGRILGHNNCCRYI**FCTKSNSLCMVS**EGNYSLTSFFIT*F*NSIHCSTK
LERSHSLEILTFKVYLCSKSIIKHS*SENRCFIYIFFNSVAGIQNVSISGNNHFSNSMKT
KYLELY*LFVLFKFFFNTPLFEFLQNENVTLYIPKLIFFSRTVL*TLIL**EAEFTN*SF
FSVFLS*KPHLKEVSQVTCKY*NNLLRMTVNLQNLR*KYNLALGRDDSDKKLVK*MLGAY
LPSFSNAKIHESCLGNISD*NLSKDIVKQ*HTTIILDRVLFAYG*IYLKLYEA*KIH*SH
YLRRTLEDWNDEIFFSISPFTF*SFLSRCLSRMKA*QPKRKASLSKNINKEQFMDRFYYL
ISLSQLSVSIST*MTLQKKISLFLSSP**NK**INAINSGTSHIPKESGFDSSLIIILGH
F*YGKRLD*ETPFVEHLTTISAKTVTLHRQNTLPLS*FTGESPFFFLAKVLNNLNFWNVF
GGLLYIV*ICSF*KVRHLHFPRQEH*YL*TCQRTLKCHESPRTKHAGDCNFSPFIGIENS
GTVLFFVISML*SFLSPNFLQ*KVSFKICYYVFYFSIIFLCDFSDDLFFVRRRTDATVKF
LLST*GAVIF*RQKHVCL*KKIKKSYCSKPASFLFCEIFNTVKIKDNYFIDKVNANIYGL
RTKDSEKC*NL*WLMLIQE*SRVV*SHYFNFY*ALNRTRMFQSVYFLQLNLVCF*GSGIF
FRVIQIFNSVICLRQKEKER*KKGDGYNLFSRQCPDVCQNVVPR*Q*HHTEHEKSKKSGS
LYVTFLLKMLFAIRFAIQLIEPR*TKC*TFHRDVIVIGFTLRMVETYLLINHVTSKYQFF
FFSYSLLTFDLR*DRYTFIEYERITIHPHIRMFGQTGHQSIYPFS*NGRALDRWHQRLPN
RSGSNQRLFFRLERLDAVNMYVLTVSST**SWGVASLGYFLNTGVPDQR*NITYYGVRVK
VKRYLTRAACMTRGNGKLLMATPTKPDKI*EMSPPSELHSHISYIDTVK*VIAHNPKKHI
K*YVNITRTNGKSCPLSR*SSGGPVLALSFCFGC*LIYKWIYNFQKV*THSMKNIARIMC
L*IIFFAGSKINSLSSIQSLIERYRNACTLLNNTI*FKWMDPHA*CSTGLSPLFLHSTVH
FCNRRSLYATLGG*EYL*KFGEIRFVKNDSQRLQ*FLLFTL*TADIRAGS*PRNLLH*TG
VFLFFLFLGLEPKS**PTNGLQKKKEAQDKRSTCVIHAEAAASIFDQLQLNEDYSPYRSQ
MGAKVSDRGSY*ARGLKLFLHLRAAKPTIILHQEVSL*ASAHHPDVHNSSLNGLLPPLLL
*CIRTLPGHLDGDLSNTYYLLWYYPLPKKKKKKKKKKSAK*STLLMYKYIAHHC*EIVLE
VV*SFSLRSKRKKSNSFKSFSSKRLNTATENMSSSITDEKISGEQQQPAGRKLYYNTSTF
AEPPLVDGEGNPINYEPEVYNPDHEKLYHNPSLPAQSIQDTRDDELLERVYSQDQGVEYE
EDEEDKPNLSAASIKSYALTRFTSLLHIHEFSWENVNPIPELRKMTWQNWNYFFMGYFAW
LSAAWAFFCVSVSVAPLAELYDRPTKDITWGLGLVLFVRSAGAVIFGLWTDKSSRKWPYI
TCLFLFVIAQLCTPWCDTYEKFLGVRWITGIAMGGIYGCASATAIEDAPVKARSFLSGLF
FSAYAMGFIFAIIFYRAFGYFRDDGWKILFWFSIFLPILLIFWRLLWPETKYFTKVLKAR
KLILSDAVKANGGEPLPKANFKQKMVSMKRTVQKYWLLFAYLVVLLVGPNYLTHASQDLL
PTMLRAQLGLSKDAVTVIVVVTNIGAICGGMIFGQFMEVTGRRLGLLIACTMGGCFTYPA
FMLRSEKAILGAGFMLYFCVFGVWGILPIHLAELAPADARALVAGLSYQLGNLASAAAST
IETQLADRYPLERDASGAVIKEDYAKVMAILTGSVFIFTFACVFVGHEKFHRDLSSPVMK
KYINQVEEYEADGLSISDIVEQKTECASVKMIDSNVSKTYEEHIETV*SLFIAL*GVFAS
LCNCISHIFIL*PL*HYIKDMIYDIL*S*NFCCINFLEGIRM*VHLNSAARNITAVNTSK
MVDYCV*EFKLFCLLLPL*DNNSNRKEMLVEQQIGKSGKNYFVIHFRPFRNIAFWFLH*M
GPEDSVRLDSHILRHYFSPLKGDVCLYTIKARPVQVSLHKLFYHRNLAEGSKYQDITYRI
HRTIAEKCSI**RYASQLRPIWGKKEKEHPRSYRCRFFLLRSFPNLGSKSIWYLPTLNSV
FPM**DRTINFETILAFFIRYLLYFRFGDFTKCYPSATTAYFFSLICS*SHFLHRALPKV
ISRSSAFAENFSRCPSPKNKKSFIYGMAYASGTGILLLDYTVWTTRRFK*IYTITQKKIE
LPYQT*QPV*LPSS*TIPMKTHL*MHPVFIA*LHKN*MN*QTLKLAHSLQRVLQP*KEKV
TLNHVTFLSL*AVSTPWVYQTKVSTTICPMY*TVKRIILMHLLFSSQLLV*ALMKI*IC*
GKSKIANSTVLPS*TCLVLMCLGNHKLLMTLT*QRKPWKRFLPFSKNLLVSSCLLILILP
ILISWQKY*TSSH*LMSTLSIV*EMVFSLMWRRRV***SQRMVSGVLEVNMLSQPRSPMF
VHFTLV*DLKSKLSVQVELSPVRMHLNIFYVVPLCYRLVQNYKKRASRFLNVSKKN*KT*
WKLRVIHP*ISSVGS*TAFNYRNLKNYDGTSYGRVLRFV*IFYYFEIA*IKDSW*MLIP*
FFGECIRNWHHTLGFNVL**MMILNTYTLK*LNQCKLLS*FIYT*IFISQHMIYPYIKTY
SRNIFQR*LLVG*KWHRNQKIMLKK*SHLFNIWGKK*RN*RICAYIYIYIYIYILHR*F*
CRM*PFRKSNLVLSTEFRNIVKCLFLYN*TVLSVKVNLWLAHPRYTNGSV*FDID*EPKR
NALILVLSKSPTTRGFNDESITGLSVNRIFTADID*CACAMSYP*ILTSTTVLSSLYTMR
ANDTTF**YRCCYSLPKLNIPYYAISASIFTFAS*TSSDRELFQQNGVSPFKYLSICHSC
IGHIRVYSV*AIPTTSSP*ICTSPRAATYGFIISKAFDLLIGFVTRISSSSKCKVVTVTL
RICHDVKCF*DYICHSLGS*YIASDNSSTGSGAQEGTSRNFYC*GF*TTLI*RNIFAY*T
P*TIKNRRISNSLWCI*ITINLGRSAIEIKNILLFFRSYDNL*FN*ASII*AIFARKLRC
AKMFNHFCKHFFYGFRCICLNCSHVFQYCSQIIFLS**PN*LYPFCVSCDLRF*IAYVIT
KSS*T*AAWVFAWIFYEKLVN*FFLENSLFDNQFGINCGSFFVQFFGIWRH*TG*NTSNI
CMMGS*SHIKYQFAS*RERRSYYCYVW*MSTTNIRMVCD*NITRL*FAFP*LRLC*YAG*
H*S*VNRYMRSVSD*VSFRVE*CT*KI*SLFDVS*NRSFPQLSTHLEGDIHKPMTENRQ*
DWIYIKFISAFR*CLRSLLVDLDKYMRV*NCCLAVW*NNICLGTVSQYGWALDNCSGRKI
INFEDRSVDPFVVKICFLGKTSIL*HVGFLEMGNFNQLLINRFFFSNA*FPNCSYPYIIN
YNSFVIE*ESELFFMSFREPFPKIPLVIIFL*YHQTGFSTFISEI*ISFQDYVLPRKRLR
*KVFD*IFRKF*ESFFHFQDGLWLTQDKRARLLVFFNNIC*ENAISGQDRRISMN*NSVN
AQ*ICNRYGVLPASPAKGN*PMLRYYMSFCFCNGPHRSCHAFVSYFDKSIGNLFHG*I*I
QILIDDIC*FSEFQSSGF*VK*FILIGPKNFGEELRNQTS*KEVGVCNGQRPALSVGCRA
WISSC*IRAYSE*PVFP*QNRTSSSSNSMDVKLRRLYDDPCGNSFKNMF*PPIAVPTDIS
RCSSHVKAY*GYVIIFIIACTRITYYATCRTR*NRFQTGKFSPIH*TTIRLHELNVGIFC
VAQTCRNAIQVLFNYRSKVGICDRTVSPR*KFYHWRDFR***NMRKPNLPGNITNNSLMV
WKSV*V*KCYRNRLDSASIKHFQNRSYA*FIWLLYDPYHFATITFQDTFLFIRRRFGKIR
VFREIF*SNSLIYFNYSVI*WHYLFYI*VEDIWPGLVSNQQ*ILKAFRSNEGTTFTISF*
SAVCS*GCPHS*TSHIRDV*RNTARNCLVFKHLQETSYAFKGSIWIVFGIHRQELDDSIM
FLFTCTNIPHTISESSTLIDGNSYVSFLHCIPRSYI*VFNAQNYYCLSSVLSFWHSFFNT
T*HLILSFFSVVMLWRSCSIGKAPEANKTIVEVFMQIILNRAEYACS*FQRLVKCLSLLP
SRNKN*LFR*KVVLRFHICRLME*KNIEKTIKKL*VDTQLLNLSCKHLIQRQELRQK*EC
YSSHGPCSFWRLC*AFGDNGSLACLFRVLEPSVCDGCGHSF*NAFSVVGKSPLQFLHYVT
HVHYNARQSFPKLLGLQIRKYMYDPLYCQKFSKILASQTL*SYHRGCSQKRLVGFWIF*F
S*AKEALPSLYKGDLSTLMQHPKAQIPV*VLIHFLNPFCGISLPYD*MSCLCDYFQ*FRQ
MLCPLQNAVLNRLMEKVLDAYRFSFLVFSIYLSVCTQNNLIVCNLFHFTMIISCRVRQKM
TVIVCHNFQ*GRKNFKDYLLSRHYVFYMIAVKVLGEIVENILKPWHVPIAPFDVCKPSYG
VGKLS*CRFNSSQISVSYG*PICGFFAFLILFQWPILGVDGVSYDRQKF*IRVPFRDES*
IVEN*CGNCNSQIL*LFSRCLRKFSIYSLKN*FINLI*FQ*FHTPVFIIEAIYQNTHS*H
G*SDILIAQAFFDVIFYI*RIR*FFYNQSYYVVCRSLNFPVRSYSVSK*K*QLPAFIYVM
*CATNLRQNFIIKGLLI*IYFYYSIENSIWVIIFHDKILLDRKNLHYARF*R*YCRR*CI
IVGLV*RYAISVLQYELYYLIPITHWQFITSQKIVGCCIWVVADINRQFQGRFSIFNIHI
KYVVIRFTLEFYFFVVSSSTCTDNITNLFP*RI*KLMSFYSTLR*FDYHNLTLFAPRRL*
NFIR**FRLIKFYCLGTYSGFFHLRR*FIYFILGSPS*LLLRKYSHKIITTSHNNITIRH
TINGPNRDGRKCNYLL*RTIFL*PYTDCSVFAAAYNISIGQQFNAINKAFMAFICS*YVT
CMHINQLDEAIV*TTDKMAIIHHS*MSYYIIVNPTESFDHFIVLPQFNRLIGGSCQEFIF
*EGYDFGIPYRGIVCLQIVNQRSFFPNLCGFVPTTAYHNTILEG*TTNVPLVANQGIQGI
LS*GGKQGHTVDHSILTSKKQQLLLGIITHTI*KSLSCINYRTEPLVIFRPQANCSIPRN
TSNL*IIHSYHIPDVLIVPFKCCTQLISHTPNLLLYTLLSHMNIYI*NKPRQWPSLIISV
LKSHMIYFSWS*TSVKNFEKLAKEMPRSATFSTSKPRSYCFSNL*TFNIQELAHARIAAL
LLTHTTNLIPAY*S*KGKGKIPQV*IRK*EKGLETISL*Q*R*YLYTRIFSRLDMTGPIV
YVQNADGIFFKLAEGKGTNDAVIHLANQDQGVRVLGAEEFPVQGEVVKIASLMGFIKLKL
NRYAIIANTVEETGRFNGHVFYRVLQHSIVSTKFNSRIDSEEAEYIKLLELHLKNSTFYF
SYTYDLTNSLQRNEKVGPAASWKTADERFFWNHYLTEDLRNFAHQDPRIDSFIQPVIYGY
AKTVDAVLNATPIVLGLITRRSIFRAGTRYFRRGVDKDGNVGNFNETEQILLAENPESEK
IHVFSFLQTRGSVPIYWAEINNLKYKPNLVLGENSLDATKKHFDQQKELYGDNYLVNLVN
QKGHELPVKEGYESVVHALNDPKIHYVYFDFHHECRKMQWHRVKLLIDHLEKLGLSNEDF
FHKVIDSNGNTVEIVNEQHSVVRTNCMDCLDRTNVVQSVLAQWVLQKEFESADVVATGST
WEDNAPLLTSYQNLWADNADAVSVAYSGTGALKTDFTRTGKRTRLGAFNDFLNSASRYYQ
NNWTDGPRQDSYDLFLGGFRPHTASIKSPFPDRRPVYIQLIPMIICAALTVLGATIFFPK
DRFTSSKNLLYFAGASIVLALSTKFMFKNGIQFVNWPKLVDVGFLVVHQTHDKEQQFKGL
KYAQSPKFSKPDPLKRD**VLYVIK**LL*IQNVKPKI**KREKK*VKK*KNKKMNAGPR
GKNKLFIFFFTLSFMVIYIYIYIYIYLL*ATIHEGVRPYNVKFFSLLYRVSFNYSHNS*M
NFFTSVDFIRASPTKNPWTPSFLYFSASSLVVIPDRAIRRTSFGIDSTKLLVVFRSTLNE
CRSLLLTPTTLAPISRALCNSSLEFTSTRGSMFKSLL*LYSSFNKG*DSILTIRRTVSAP
ANLASSI*YLLKINSFLKTQGLSLGGNFKSRIFLTFTKSCNEP*NQ*GSVNTEIADAPAS
AYLRACSAATAFKQMGPFDGEARLTSARTTALLWDDDNTV*KSCNGGARPKS*LDCKS*K
VKPGILDCSLTSILRRA*IRSKIEFEGDDLFSSQVPPLTFKMFLIIR*PSSVKMDSG*NC
TPSTVYFLCLTPMIIPFSVLAVTFKQDGRDDSVPANEWYLVTAIPCGTFLKIPQLS*EIG
DVLPWTISPA*ATSPPNTSNMHCWPIQIPNTGIFPVKYRIQSLEMPESVFGWPGPGEISN
VSGFKAAISGTVIASLR*TLTLAPSWHKYS*TFQVKES*LSIRTTCLLIGFVAACTDIFF
LLLWRSM*NQTDLVMC*Y*PAPCRTFCVP*YLL*IRMSQRAIDDHSMITTRGIFRRQ*YE
*HGEVQKR**EV*YWLKGILISTS*AQILLCGTSSALLSRKQHLKSAICCAFFKP*QKIV
QKGL*EAKKVKNTKKYSSGGV*KGGKYKM*LCCYASQRRKKKKKKRTSHLQAKTATGART
TNTNACLCPAGKASLSVSYFLVRLTSL**GGRNDGVDCMMRNQIGTTDSQVTRNIF*SPV
FSRA*GAFTDYPLLVKL*SCIHVIVNNIRALS*IAITLPCGIFSCSVTKGAGGK*R*KKM
IKKGL*VG*ATANRWI*ANKK*D**QSKEHITIAMSSNNSGLSAAGEIDESLYSRQLYVL
GKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPVQLADLSTQFFLTEKD
IGQKRGDVTRAKLAELNAYVPVNVLDSLDDVTQLSQFQVVVATDTVSLEDKVKINEFCHS
SGIRFISSETRGLFGNTFVDLGDEFTVLDPTGEEPRTGMVSDIEPDGTVTMLDDNRHGLE
DGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRIGSVKEYGEYKKGGIFTEVKVPRKISF
KSLKQQLSNPEFVFSDFAKFDRAAQLHLGFQALHQFAVRHNGELPRTMNDEDANELIKLV
TDLSVQQPEVLGEGVDVNEDLIKELSYQARGDIPGVVAFFGGLVAQEVLKACSGKFTPLK
QFMYFDSLESLPDPKNFPRNEKTTQPVNSRYDNQIAVFGLDFQKKIANSKVFLVGSGAIG
CEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLNRQFLFRPKDVGKNKSEVAAEAVCAMN
PDLKGKINAKIDKVGPETEEIFNDSFWESLDFVTNALDNVDARTYVDRRCVFYRKPLLES
GTLGTKGNTQVIIPRLTESYSSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQGYFTD
SAENVNMYLTQPNFVEQTLKQSGDVKGVLESISDSLSSKPHNFEDCIKWARLEFEKKFNH
DIKQLLFNFPKDAKTSNGEPFWSGAKRAPTPLEFDIYNNDHFHFVVAGASLRAYNYGIKS
DDSNSKPNVDEYKSVIDHMIIPEFTPNANLKIQVNDDDPDPNANAANGSDEIDQLVSSLP
DPSTLAGFKLEPVDFEKDDDTNHHIEFITACSNCRAQNYFIETADRQKTKFIAGRIIPAI
ATTTSLVTGLVNLELYKLIDNKTDIEQYKNGFVNLALPFFGFSEPIASPKGEYNNKKYDK
IWDRFDIKGDIKLSDLIEHFEKDEGLEITMLSYGVSLLYASFFPPKKLKERLNLPITQLV
KLVTKKDIPAHVSTMILEICADDKEGEDVEVPFITIHL*VTN*PK*KNKLNIYIKYVYIY
V*LLTTFSLVKTYYYYYYYYY*CSLEYLSMF*FFVLYFLWV*LLWLETIWNNSPRLLYKV
SKLPRSTTLPSLRTAIELQDLIICSLCVITIVSRAGGPFLTISLMIEELTESKAEVHSSK
IRIFDFLRSALAMQSLCACPPDSKVVSIRVSKP*GDEITKSWIPTYFNASYISISSISSC
KP*VRLSLMVPLNNKGFCSTTEISFLKLVKFQSFTSVPSILILPTSQL*SFVNKSTSVDF
PVPDSPMIPNVCPQNMSKFMFL*TKAVGADG*ANVKF*IETIGFFSLPW*V*PAIPTVLA
LLFSTSRVLCFSSRIL*IQLAARWPLLISGI*LTRLVHDIIVNNNKVKVVNISFEVYS*I
ITSFRP***IIAWIHMTIMFVIDIPNPVAMARLEAICCIFIFKSW*VN*K*NSACKHLMV
LMLVTIWYRQFSN*ATDVL*SVSHFCKMPPYIAENIIMSGNIEIQTKLNFQPDTNAQISP
IVDTVTKLVIALKNSETKDLKSRKSFKTRAEISEALLFSPENQSIFFLVSFSITSFLRSI
TQYSLQQSNRNPLAKLKIPSAAATPRTRSDHFAK*CEEPVFPSVDGTIPSSKKLNVYEKT
GFVAPAIREHSSPKIRIFLYLMLLIILLII*IMLRSCGPVELSVFFCCFSAYPIFSSSTL
TLLVLTFDLF**IAS*KDN*SVSSYPRLLKHDPSFGVSN*ELKLSTVCIDFSSVSVSTIV
FASE*SFCR*YHVLNVVVGSARSSDWVPLSTTSPSFIKYK*SSDSIWLNSCVNMIVVFPF
LQCLIAFINRLR*TISRADTASSKNNIGVSLMNARAIATLCCCPPLSVTPPVPINVSSPS
GRSRINLSRRAI*QASLIKCLFSLVLQSAFLTESVEPKRIFFLRVSLNRVQRCSTTVIFS
ISNFWSIVWILWPLIDIDPL*PS*NLNNKLDNVDLPEPDFPTMKVNCPAEKFKLTFFKTA
SEGLLG*ENETLANVRSLVA*SSGNWWATVLFKGFRLDPSFNRVMIFSIATPPF*RTTIW
CNVLFKVEPSIMHEWKQVITSLMFSLPFLIIAEPNQNPCTNIVNVKNLKIPAFAATKKQL
LMKKVLQFSMISLNFFLSRRCVQYNLTN*AAFIDHVSNWAALLVSEFSFSEYT*IILENT
TAKNVIIGELQRIIKVNDQE**NDVPRSAHIATKFWKVMADASAELDLSSSTHLLI*VKS
PNNFSLLSYHSIGFSSKYASNICDRILKPCLSPMCIQLVRESHITGTEAAPSAITAIDLC
TSWEYKP*CDPLATKTDSRSNTLPVRIEVIAGTRPVATVPIIIIINSL*SFRMFTYLKM*
*CFVVLKLKKFMT*LVLCFLVEFSAALESSLCERNNGR*FSHIQVYKLWYLNDERQ*CNS
FHI*NNCICAKQRVNFPIR*LHGKKNKKLFS*STFTLCGKQ*IV*WQNREKKKERNIFVS
ARTIIV*KKRGYY**VITAMSRYIYYI*KLKNRK*NFKCPLWELNPRSPHYECDALPLGQ
KG*VIFIPAKFVAPLYFTDLSILKMIHLAKMTLKMKQVPFAYSLEK**WLFKKLAARSFF
YRALKRLNRYILFSHNYLYIIFLRFFVFSSFVLLIDQKFTALLGKEALNKGERNIARKKW
*AMEVIVVRFRKFLKRRSLCLGMEMYPANNVLP*SGR*ITNYVKANIKNT*MNTTPSCFT
TGKTVALVVLSILPTISPLYGRNS*QRAYLKEQ*TTNYRQSL*RGS*QTQRWVTVWDLIS
*LIRASQNMNTGACFRQFRTSHLSRN*SYSTACQTFQ*D*NCIPLV*I*ISAANVP**AT
VVIKTLK*AKQSLISSLYWKNPRECTAI*TTGSC*K*HEITRRMNRWIRARVSSRKLSFY
*VNWRRTELPHLPSRIMGVTTGSYSPEDGCKR*ICHKDLRTVHIHI*CVLFGDYSTGFRH
LTKNEEV**SIVMLKNDD*PAFTTTSLQQNRQNNKQYSTS*GAADVIR*PAEVLGPVTYF
DCHGFDGCTQTVHHDTYNGKQCK*STTKGKVN*MAISTMGTIIDWKRWEPVFRCICCEEG
ISS*GSH*GKAPSQGQAAGWFASWRGS*SLQRSKYV*CYDEHG*G*YGQFHPSNYYYVVG
EPFFCWIYSYATTFPFDCQIQRDVTDRYYLSGPGCEMG*LHFMVFYFCARAKSSLQPDWV
KRSGHGYSGRDRWPSGPPRPSTITG*QSNACDG*RFDYHSA*DLS**R*AKGFETVYVSS
WLYMHLYRKQIYFSVSIV*IYKFISCIRHSVCTLP*YRPDKLYNWWRVFDNFLRDYPL*E
LLRI**VVPLIGQTTTVLNAAEGFRPLRRIQYLEKYFEDRLINGYLVLETGRSKM*PVID
HRLLIV*MEVR*KLSFIVEIKLSERIYLLWTYNHTIFILHCI*RVPNAYFRYIILAQERQ
DDLYDEIIQIVNGHEWCSLLYGKKSSLLIVENFQSAAILHISVFI*RVATILWSV*WSHK
FH*VFRI*RLQIFPFICL*IQQPVNTQLWYIPYAY*WQHQAAHRMFLWVLCYSFLKF*FN
FLILV*VAFFLAGYSLWDHFQAQSEKLKN*LTKKN*NFFKFHQLV*EVVGKQPIEQVFPV
KSRNARTDSAAGKCSERSTLRCGH*ETSHRAAKWD*IIRECIGNLYIIGHQREFK*FVEV
LRTVHIDRIDDGGRER*SKWFESGKV*NNQMAQISSFGQ*AN*AA*LFNE*DF*SADYFV
YVNVQ*L*WKPVEQFF*RSDESIPSGFGYFQYEPVYRW*HSSRS*IF*QALFDD*FGDC*
PKLY*V*GISVKK*QYKRLDA**RYHEIE*CVVSVFKTGRTNCVTMSRIDQFYLGLYWEF
YLMDRY*FNY*CK*LLSAINL*IFKS*RNQNFML*LHTGHHL*KNETNGQTGFSEYDQFD
QRIDLLSSSHINESPNYYI**FRSLGKFDQVDYFLWHRIYYHY*TSQR*SKIGYIIQTIG
HFKC*FHIIGENNTNTFGIYE**V*FNNSKNLPILVKLSGFLEKI*SIFTKFCTIA*GFS
R*FPTNLL*KNEVFRRRGHTG*F*GIQRNRKI*IKKFPGDHRGN*PKSVFK*HFSRNFSK
PNEL*KRKLANFRANYLSNLQFK*MYQEQLFRFEQE*NYDLTTFANFSTIFK*IVNDEGF
LISH**RTNPNTIHGINCEKLQFHIFN*C*HSKCY****KVSINIEYFHELICYVQ*KRK
RQTKVMVFIYKILEVDKNQFEKNPLCQQKFG**NN**DKSSTSHKSNIYQRPRDG*Q*YN
F**SVVHI*GYWVYNHIE**QSGAHCCHCQHPHRLRYIGPDINSAIYTIRGLYYPRSFAS
CDSGMSSHSYGYWYFSERFAHWSRP*ESGQQYGCQQKINQ*LFNP*IL*YS*GYISNILF
FQ*VRKYPRCI*VYLCQVNSNFK**NFTIYQ*ID*IDLIVHRFKIMGDD*FSWVLISTDS
YVSHGHRLLSAV*PVTYSAYQQSPFYYRRD**TTRPTIKQ*QTYRHCSHSHLRK*EYRGH
RFV*R*NTIEKGLLHIFTVIY**FRHFDTIVRYKQSNPAGHIKRFGHLYAARDPGNINDE
SVTQCIVQFYQMFWEWDLLG**RHQ*RSQP*NRWSQRILHHEMCPNNL*NSVQSNIQVQY
QRREFQNNGI*FGKITEGAIYRQQQPHHK*E*MCKIFNSDLPSTNPITTGIDDSVG*YVN
HNGSKAIRKMVCR*FHFCFKARSIAFRRRKPENKKKMQNESKSCNYIYTNI*IGNM*LDL
SFTLV*QLVM*WH*KCFFIYYLYVTYHYFYVLRKE*QTFSFFNFKEIVGRFKKDQVRY*S
I*MFQSLSYTKN*HSRTLTHTMELNDPSIISSSQFSGELSDSDTAAATHKSQQAISNLFQ
KLAKKGREEKPIGSVESSTDSSNISVATSGNNKESNKKKNKKTAMLNFSSLTDPITNYKP
MDLQYKTYAYSMNELYHLKPSLASASYEEDPLISELVRSLPKRKFWRLRMGPPDQKHANN
HHFNGNNGGGSWKAGYKNGKNDERRMSRTKNMQGGKRRSQQDDEEKKIDQEMLEMDKNLQ
LGGDVGHSIADFEDWKAKMKELELKKLSKSKGISNSTAIAPRESASHETPTDLRPVIPRG
PSSITDFLNLKRQDKKEESSQQTPGIPVGQPSLSKTSIEQVNELETNSDLGKSSSSRFSS
FFNKSATSLPSLDNNNQVPSSNVSVVNNDGNSTPHQSGSRLMSFFKESRSSTPNAESQLL
SASDKDNGKMQTLPQFQQQPQQMQPMAFTQHPPNNNAFFNGLLNKGKSETSTPPPPPPGL
IAHQGPQFPVMGVPPNFPQRMMPPPPGLVQFQKDSKDVNKKEDRQLRQNKNPNGTRNSKG
KQEETATPDLPQQQYMPPPPPPGFFPMHPNFPNGPMPPLPQGFPIPPNGMLPVTGQQPQP
PYPNMMLQGNFPPNFQQGFGSNSPMPIPSIINANGKNVTNQLPPGLNSKKNIK*DA*RAS
T*QETTKTQ*TYYLKACSFPFHFSSLLSRVCI*HVSYIILSYHHHLTCYNSPIYLCFRL*
YLLVEGTFFAVSNVTLGTKH**MRCIFIQHFYRLYTTK*FSIH*NYQNGHQPI*CWHRFS
TDVACWISLSTCSGTSKSLNLLISFPVNLSVMRFNTNMALAFRMAFLCSFSTL*TSSSVI
APLLNSSLAFITGS*MPVSSSIFFVGKSKPQLIKGSKAKASRIAINEPLLSLSTFITFSQ
VIRKLPSIPLTSIAYVNILVNLKGTFSGNFSLNIAASKQSPKSI*MTFPVILSNIKLLGW
RSPNPNI*PVMDITASDRV*VVLRSNHVSDDLLFSHNTL*RSCPSVLFRA*VKTSTFCNN
VKLS*SGAICNMTQCSMFKGIFLASLCSLINTWNVSLFGTQPSNPDFGDNGIAGYCWISR
CLLKHSASFCKSVLTSPNNCMTKLSCLMSSCPFNTYL*SLPSLPLIQNFLGLCLDEITEN
TGSNLDILTIGFPPLARVPGTANSKSCADSSFGDTCCSSRVCNCGNCLPIFLKTL**MSH
AWFKLLTSLDFL*FISHS*ASFKSLPKEFWNDISLKVSGPLFSISYRGSKAANIFSVLCS
PKNCLLASSRPSYHCSCQSTAIRINSWLTSSAWSTKTGLCILIFSMMDKAAFCRERDSDL
IATIKGYTNACG*ALPRSDNRESNDLLTI*LG**ILEINCGNTSNHVPIWIRLKPSCIAW
VASGIPPKVNHKVNNLNAS*RELDSDKEME*KKPLIAGITCLCIKLEE**TSLASNVLTP
IMPLSNSLISVTEEASLPSCFFLETDVSIEMTSKLASAQLCHALYHVLSKCVASK*EPRI
ESGLLNLHLGCKQTLHSPCFKKQRAKSLV*SST*RGTLLLC*GTL*AIILFGSKPKS*AI
LDVKLINCFKASSCNPVAHKYFSCA*TTGGDALAVLG*SGSSVSSSNVFKTFLASAILPD
FLHKLANLILT*ASSFGFITNDLTRRILCHTSIFF*QPSNLVFQVSLIVRRLSEFCGNFL
YLMISSNSAIICALTTTLYALL*LSLTRADNSVTRRSLALKM*TSAFLKLFLCKHKIAS*
NSLSGDCDFMTLVYWAISSHCSKPQAAPAAKGAIAFFTSGFAVPHFSDANLESSSHSPRA
YNDLNFPIITSTESSPAASFSLYAARASSQR*SFSYQVSFSCNSLCCCACFKIPIAESVW
*S*LLMLINASIVEFFGSSKNSTSL*CSAFAKA*HFWAYLPNVWIGIGNGLSSCSINSTK
FNNI**ISGGFSEDDKALHNA*IKSSWYDV*SSTQQLENEALNNSLANG**TLTKLEQDR
RQAEGDSFRS*IDSLLIHSCQSSLVFC*EQYHAFFRIFWFTGNFVTCISSS*FFLSGTSF
SLSNMIFVGKHSLFSNLLTS*SYTEC*ILFLNNALLITGTKTTKSVPSCKRSKLSVFMVA
FVSSLSPLFKILTNA*TILDDISERLIFFANLPKVIMEIFFRLPAEYSVILTTIGIIKWE
*SSRFGPKVTKDFNIRIGTILLLDWSFSRISRKKVRVSGTNLLNSPSRALDIDSMTEIIV
ICSLMIGKNSLITP*IFSTWGLICCLTIEMRDPSC*K*KSSWDGGHERMTKMIPGII*SK
KETHRKPRF*KICIIA*IAAV*WIDNDGSFNIFIRLWITTVG*YSSLDGDTPCISNAMSI
EGAFCSTELFEFDVTSISLCLYGSRAPNIPIKRTVPRLI*GLFSVLRIFIKMPSNSG*SS
KGPTT*PEEAASCPNVVKAASLLKEFDWS*NVLMINGINSFK*RVISFPPTTDSSPKTFK
AVDATADEASWHLGRMTSRIGSI*GFATSSLEFISVHNRVALSSFFFGIFENFNCVNSSS
KVFLKEGTT*AGLTELNLPIILIASN*IPKISSFSAMKSRRKLSGWAN*GSKFDPKC*RI
SNLISATGSVIAIINSLLSTSETECKA*TDVCLHISSLINKSHDVNAANFLTDESSCSM*
EMVISLTNSVKEY***ISCSILKH*IKIWASVISSLDSPVFFMKLWFLDLRAFSMEN*LL
KSYWFD*INFSPDKDIDSKFSILELTVDSKEGIFSLRIIKVSCIWSDIGQFNIKLRRSLF
KCLAKAGPKAQANLPMQ*NKSFSNCFLTLNFVLKPSLILSRISVI*GEMLEPTSNAISPI
ETNIKGLSELFAAFISMFFKYLK**TIILSRYFFVKMAGSKAAKRGKIA*TSLLITSNLY
SLYFIVDL*ISSYLSLR*GAFKLSNSRNTNRVACTESFVLRLKPCVQP*NNL*NHCFPKA
GSLS*IIVRHLPNATAASNRIINFASLNGTQILSKIELT*GYKR*GELSANAFMINSAAC
LLYSNLELDELLSAVRVSQSMQVLTSNSTKSDVNVPPGTVNLPKVLAANLITSMSLDGIK
TRK*FASLEVWFGSSSVLR*NEIRVSTARIPPIFSLEVNP*ISSNILLFKLLLNL*NCSA
DTSLANEVKVVLNSLAPEARSCGTSLLSLSKIKFKVENVVSSSESTKDILPI*PAEPVIT
LPESLGPL*LESVFEVVDISSSWECDLCVSFFLVLCLPSALCRKDNKLGGVVYLLMYLFI
FHMGKVKIRNLFEKDNYLILMTMLFMHPVYFPFLLLLIYL*INTSKAQLRK*LVSR**KL
VFPTVITFLPILIAAIYVSLYSNIFSA*KGISG*IF*HRPRNIRYNLKKRVVVS**H*D*
MYV*LIAIS*CYRVTWYNYHDSVELFATYHWRQNAAVCKK*R**IYNTNA*RKGYRNEEI
HEFSVRFSDF*LLCPSSCFFFSSSSFFFFSSSSCFFFSSSSFFLFFSSCFFFSSSSFFFF
SSSSFFLFSSSSFFIFSPSSCFFFSSSSFFFFSSSSCFFFSSSSFFFFSSSSFFFFSSSS
FFFFSSSSFFFFSSSSFFFFSSSSFFFFSLRFLSSSNLA*A*SSYTIIGSLSNI*IPFLL
TSDKVGAKRSKPYEFKSKKELLLKFKFDLKSTGFTSTVLAGV*SSVLSSRVVPVSSKVML
KSEKFLYFKLSDRSIIFPTYSS*TILVT*SNVVWFIDFDKSFHIAFS*PKRNGSFAGELN
LGATLMRN*CNNFFFSINVRFWQY*ISNSFCLYAVTLKELYKLVNTSIKPAFGIFL*IKR
TSSMDRFLKEYSETLLESKSFDSNFVDDISFKRFGFHELILGMFGYHELILLHFFNPS*S
NQNLNSGK*AVFL*ASNAYLSGT*YSLCKQ*VCL*GINAGTPWKTVLIKGDSSSNELKWL
FLQL*SLSFSLRKYLCLGFNLFSMVLDFGNSSSSFFKRSFKSVSVGTLL*FLFSSLVM*S
RSSVMFSVAILTNPSSTLSGKVAVSPFDSGILLISKCSSCNRSSI*EFK*SLLGAEVLAR
PVISM*RPVSTSMNLASILFLPLPLILTVKESLTSRK*RPLPCLGSSNIRDWLKY*LSNC
KCLMGICKSKSLSQGKAIPL*R*PYSVP*DNQDMMPLALVNFWNVLIIEFNLAWYSCLSL
INVSTLKNLLSRWNPIPLYCFTAPAS*KNFLCNAGLVFTEFFKLFR*FSL*AENLSG*SF
FCSSNSSIFLEASNLKSEGDK*TKSLSKVNLSVSSISSLYRELTWSLLTNSWKSLLWLNS
TSCLFFFLLFVELMLSLIYSCNRPDCTKFFDFSVCKGT*YVELSDSMMEMDSGCDCVVKM
*FLACNW*TSGLTLSYSSFI*NCVLNLKPLGEPCPSGVNSLEQCFFSSFESLILSWFLAA
LYHSFCAYFGLSYRNKGSPSSVSMASKDSLSKADWKRKLQGRTVLSMEISLFSSWKVVQS
YHEKGNFSG*SASLFCKWFSTTDHVRRGSKS*NFNSSTDSSLLPFRGPILTESRSFCRVY
SLTHLGLVPNFKFSYNVLANWILRSFLKDEVRMLYQESSSLSSSL*FGRR*SASRPSPLR
CGEFDQINVIMMICSRISGRRMRLNG*CLTRSRPDKNRL*SLDDIR*SITN*FICVKE**
RCDAVSSAVRGMVYDKKRKRASLI*LFNIVADI*KGGKNQRCNYFFIAST*SKQ*GIEIR
TSRELISNLKPRK*LRRSEGTRNNT*HFSFFFFFFFFFFVSLGFCAVVCIRF*MRYVYHR
PEICGVQRNKIRAETRAEIRAPHQIFSEDSLRRFSFSSTEYQAHCIAMLV*RSFLALANL
C*MLRTDGNSHRREDWSVAKKK*KYRK*LLRMLLFLVVDMKLELYIVRFRNREVNIIYSA
AHSG*VEAGT*EDAALELWTKLLTMFRW*CTTLCGEWPRTRAEGAEGAEGAGVAGGSSLS
VRVASWGGGVSLSVNKASAGT*VAGGGGGGDDAKTVAVGEGWAAISTIDLMGTRFLRNGF
EVGVVAATSVAIWKPRGFSYVVVLIIGFLHTYLSLASTQVSIPWNHGSSKRSSMV*RVAA
SGSASRHATRDACPFLKFLAK*YSIPGPGR*LPRLRNARS*RRIKFS*ASQ*SRKPVSKL
QDSKNGMTLLTRVMRIIPRP*QSRARGSYGCCNSVS*CFLES*NMTSGGAYGGEPIIPAH
FLTGLDRSCGSVWYQSEIPKSVSLHTPSGDSSTFSGFKSRWAMP*SWQNLTPHATCLNIQ
NFSARATLRQPDFCIIANKSRRPSSMTNPHPRVV*TVVGTLTRRKVFVM*T**LSCFAMI
NSFEQRL*NFSGVSL*IILSFFRANTSFLRYLERILRTSHEPPHPMVLFSSSKTKLSLNW
MLASFISSGRYSFGSTIGIGSMRILESPS*R*KPRSGSFFMEVETDESDVLGVETPYGLY
TNRSLLNLEFERLREVDECLFPLEMDVLEPAGGRILVEAEDKDLLLLVV*AKEFARREVF
NEFGSFGLEDSLSLVLVEWKSGGRDAFFFNLFPWLELNSFFPKNLNADTEEIGCWDIFVE
*LCETVIGWWCDLMRMLACGVKMVYTFMLIFLDVMQGL*IHGGLLPVVYG*KKKEIDIYI
FLLCIDFCEKKKR*GKMKKKAYRC*EELSIKR*QAFMLYMQLRISFNTS*PVSTVTGIFL
GFFLFTTREKKCVM*FHQYFSRPACSHNTIGSCHVISNVRRIFCPLKGNALCSFLLPFHI
RESRLPMSMEFSPLGISPFLSFWNLS*IPLNLTNSLVEILGFVS*QASNKSFIVTTAVSS
EAAEVLVFVSCTTSCCNRVFSRSLFSSLRPCSLILKYSILSLPGTTSDWSAADSHLCTDF
K*AL*QSPCKSAPEKPAVFSAINFKSAFFSNANFFCPVSLSFELTIACKISNLSDSVGIL
QITLLSNLPGLNNALSIKSGLLVAASIYTPSRPSAPSIWVNN*LTTRSVTPVESCPLFGA
IESNSSKNRIQGLTDCALSNNSLMFCSLAPINLFKISGPLTEIKFNPHCCATALARSVLP
QPG*P*SKIPDLNLRGQLTKIGSYFVGHSKVSRRTSLAFAKAPISPHLMFVSFVSFTPRN
ADGVNALSDFEKSSLVTTLSQSLSNCKS*KIFSVNISKSSGENPSVSNDKSLNCKSRFSF
MIWFFEKKYSSNFALACLSGALKDHVSETKCLSNNSGLI*VFCLPENKTLIRLLSLLNIF
VT*LMKKFKSLLALSHWPLLEGSPSLA*GFPNRASTLSNTIKEGPYQ*QKEHHSIINFWV
LSKFDVSCNVSQSAYLTKM**SFSTSFISSFNNLVLPIPCLPSNIIAGVAIIGDVK*LTI
SFLILFTVMKSSSSLLVRETSPVSLTW*CLGKCLSIISLTSSLPIWVTFH*TDSLEISFK
LHNCCSDSPFFISIIICSVGSIKLLVNKLPPNNLEY*SPLLVGTSLPKYLILTVAFLPDI
IFA*FICRNSSLIFAPFIGCVKNASQR*ELNAM*FSGI*LSHFIKTPIFFEGIPTDLLSE
SLFLDCLKLHFTIEA*PF*EGNCAPSLIYTTKRLSLGKSILHTVLLNITFFKSWIAPFFS
IVLLL*PYSAFTKRVLLTFGATTTKEPSVILADFIDGSTLSILNFVTIPSK*QIKVSPGV
TIRVWCKISPFWNLIALASIISQSSLVSGVTYTSVARCVWSYRWMYKSTNGDF*FKSYTV
AKTGLIRTTFSLDPESWPSHPR*TIGISEL*EWTAIPNSWIA*LVDSNTFIIECGNLKKF
PTMALENWILRFSNFNLLVVVI*KSSSSGVSCYCRPFQKKFDDDNSRRDIPDLYNCGYAQ
E*IAIVIGYKTIKSS*LGWRIRQITMNIEIDVFFCPRRLISHFFLSGSQLPCANKKA*NG
CTKTTNKGIRQYSIMDSCHRGYIELV*TKTNYPLISMVRVYIIV*SVRI*YK**EHS*RV
TALNCKNCHVVTQSLKAYKVK*ETVVISYALPIPFSEFPCARGGTSSIFCYI*VNTSSTN
RAQRFLTLIIHLQRKCSSSSIIYISCFQKKNIAIRLHGQVG*GVRLLIARS*VQPSLGSL
IFNFFTLKKQINSNTMPMASNQPLVIIVRRIDAYIVYYLNN*FDLKDFCFPCCCHWLSKL
HKADEKPHYAENSVWMHLHDDATRIGFFSLLIKHFGTCR**LRFVHQIIQLFTSL*NILN
RFVQNDFRLIQFLLNFHDSVSL*RILIFANVSVQLLHFQCIIGLSHICPLFLRMCD*IFI
QYFV**CVCWSDRIFFVGDQNTTYALTPGINVANIVAFFYTLSLSCTSSRSDRFSKKSHK
LANTRPFKETKL*QVFNFTQL*SLFSSRAKYTDVVDSHCQNNFSSDT*SFRNALAWSNAV
KLCQRLLYIVHVDIYCACS*FHTKPIVLYGTPPNKKKREKEPNFGLKTYNAEIVEHQLPT
GSRLDPKSVYYQ*NASQLSRQECVQKQAVNSSGKGVMPTPNKTSHGVLPSVR*ELQSGKN
SGLYNGDSFYGWCFIFYCS**EASFRLKEGRIR*NRRGRAFQWW*AITRK*R*QQQQKR*
KWR*QRQQKR*N*SWPSIRG**NWCFKSS*RW*IGCSSRRRQQVFRR*RY**IKGINQR*
*AIQ*RQCHR*QSKG*KHKF*ELGRKY**QNTRQQCWIF*KKRSRTFR**KIATGTI**Q
DNY*R**WRRRILKKNCK*LGKFS*AI*I*R*RERRTKKTRGKANGSY*RRGSTRRCL*P
RHW*DKLGLSLLGRYGPWTLW*RVQICIFLLRLF*S*TKRYRLC*KVSTYARLFQKIPRA
LCRTTKGNI***GTSRQSKGQHNRISAKCFKRKGKCCEKSRAIRCEKRTIE*GIQTLKSP
ENLPNVKSIKV*RMIHVNTVILS*FNDYIWYNM*NIHELMHLWGG*V*SLYESSYTSNRI
LLFTGQVCHIF*VTCSFFPAQ*IFPKFETL*VSRNSFYYHVLECCISVTVLPHHPR*LNR
NSFSKWPT*SYTLRVRFLCRDQH*NANHLKELVPCRRLPVHYVVFSARQCTCLAVAHFSY
*RE*LQLGKDSTKTANGPH*NLSVKP*IFR*NQK*LYES*LASCTSCLDP*ISNRTSQVA
ESPTE**RLDEFCVNGP*PLYPTLDHRTHHHQGSVSTVCLILPRFP*VLAQHDSKL*GLQ
*SDPVL*KSL*NNCSLLQNLL*QRGKFCCKLCRLILKS*KFLISLGKECKRYDHRLDGTS
LV*SIPTVHQKLHFYVVVKNQRSVGEVRYTIYPFYRRSDNGLGNSSVLNRIPPFLHP*FP
P*TCHQHNFPSDQTFPKESFCKSKASQLH*NQI*TFVVTS*TLSIC*KS*HHLEERTWIQ
EIVDLS*KDLASEIPWMS**LESPTKRS*WPFS*SRKHDSKEHCENNAILQVVFSYCETE
GRALSYCICFSLCSSAALLFFMLEVFKGEL*LDGLFSFF*KDQNPTLYIYIYIYVCVCI*
KKNHFLIKISLLYMSHQSSVGMEVSS*SVFFYTKSYFPVE*GFPPDKWSPSVIGRTGFHP
SSQRIDLSC*RRPICQLNLTGGSSFPGR*FCWRSRPK*LVLGFSLDLQSW**NYVTDRAL
QDWSTLLDFQFFLIY*IGWTISSNSLKDVS**VLVWNFYPTKFLPSLTDLRRNRVQ*NEP
YYHLILSFSVISKWTDFQFWKCCSARSINSPDQSNFLDF*CA*SC*TTGLETLIW*AY*H
*RRYV*FCYRKNQGQQSCHGVKLPLRLCFRSGSV*DIIVSNS*TYKGSNLLTI*FLDGPS
Q*PLHHQADLVSVPNLQ**SQDLYRLQPQSCVFRLFLHYLC*LNSYP**WLCGARFLPTS
CYFHSKGYTCFIFQQYLNI**FGAKITNNEKKGGESKV*Y*QGWLYRYIYIRVNRSIYIH
TNII*HGGDTIQYNRAGTDT*FASGLEAI*STVSPTLLNSSATLSGISISNSSSIATSSS
TVSKESNPKSL*NWVSLEICLLAMLGEFLSNALITSMTL*ET*SLLKFAE*NLCASMVLD
ITERPIIVRYAEGATREEMRQTDLNMARKVLY*VSCVVCTNYTASVTILPFASSSPPFSF
TQNPFEGAKKEAIDK*SVFRQQ*YMSRDSDKTPWSLFGVYV*KE*YI*DIYRISLIVLML
W*TSECLFKYAIWLNLSFYMYLVLLFSLLFFFSVRSSSQQEEKRLVQR*KS*DD**WISK
WQR*KIVQRLKNGSCTGLIDYSVGRGVSEGGDT*N*QVFILGAML**R*AYATYLGLLQC
RASRGLSGTAPGVPKRDLAVS*RFNQGLLVDSKAAAIEISPWEDKVLGFS*HSVQCMLCR
RGRC*TRTCRSRGTFW*RMFERHPKLARGLLIRNSIFGFGTGGGELSEGIPRLILQNLFD
GKRTLL*AFVTAVQYFEGRPALHKYHIFPSEHLCGRRKIRNHT*HLSRSRRRRPGGCVRK
K*RAVWSARQSRQHLARGLSSFPFDHPTGSEITVFVYCVSICSYFRSGFTWHGNGAISLS
NEALQVHACGKNSGMYRYSGQHAVAT*YKRNYQRAGQAYQNS*EKTLFICCRKAKCGQAS
KL*RY*YLVHSRL*PKRYHR*SIQRVLQAHYYTL*IKLGLERRGHMDREMGCGLQRRH**
NRAEFGRTRYHLCQHNFR*TGV*CS*GKIY*HIKTTASANAPGVRGGRRRRFQTTDYKTY
RLRCRH*RYCIHFSISTAESFVERSRKRFRLY*G**YWSGYRRRYFRCRTWLWI*SRRRY
EKGKQMTLIICFPRLLYLNPRF*LINYLIIKQLTLYMEALEISRQNGIYIPCEVTAWKAG
YHLKNH*FLF*RNAIKVLCAGVVYTEHLVAKTW*LNGDQNP*KHFYFLKWVLLLPKLWMV
F*KIQIVCTLRSEEKKERGN*PILLTLTL*TVDRDEIERLRKRFMKLDRDSSGSIDKNEF
MSIPGVSSNPLAGRIMEVFDADNSGDVDFQEFITGLSIFSGRGSKDEKLRFAFKIYDIDK
DGFISNGELFIVLKIMVGSNLDDEQLQQIVDRTIVENDSDGDGRLSFEEFKNAIETTEVA
KSLTLQYDV*D*GTLHSFMVCQYF*EKKNNTRYCFLRKERTLAQLEC**YIHIYMYM*QT
IRKQ*YNIEMRESIYVSDEIYQDGS*SHVITAGCTLIIFGIPLLLIALISDIQNTRDFPQ
KYGNAQRGINSYIN*DYYFFFVLCVVIHYPTALSILTYQLPLNPMTISQSSYYLLTPYMI
ITSNTNARRQTIFDSYSNKVKL*YWFIG*VHILKRVDNTSGVSSK*NLYGGLAEWSKAAD
LRSVGRLSARVRTSHPSVIFFFNLFLCCKR*SFPLCSHKRRLDMNYLLPI*GACTVDFEE
PIAPNFGFCVRKREDCSKRK*GGNPLIALLEK*K*KVVSELFQKWH*HNIYRR**LLVLT
IRFNLGVVKPKNTCYP*EAYCT*SPV*IIRKSKTNV*EIQKSRLGHGILVEEKPQDPFRL
CQVDHRTTK*IQLTLADSG*QTKGTRRVHKISNWH*TFYCR*YGSSPNSGSH*RALYCHA
SCRRVL*TATSFCGFGIRSKERMHAYILYMPWIL*G**IRHSRLFSLATKDHIFNVEDCG
SCSTTKGLPRYLFNGREYDY*MYQIRTTL*DYIKGPSTMEIL*VCETG*FRNQYGIFTNI
KCRIYCTS*ISV*GILQ**D*YHKIH*MY*QVNGSWKLRNEKAEH*TVGLINCDKI*QRV
DEYIYQLPRKLKAHNDFND*QI*KLTT*SFQRIQGDGSKPKEVKTCF*HSC*KQR*TIDV
F*NFRFRFSGFYFS**KRIHRSRN*FLAAYNFVHNRSF***CILK*RRQYNFSIISNEQS
IIHLNTFNFT*FKITIKLGSLYKKWKVLRQWVVT*IFKSKIIYRKVFICIKREK*FRLLY
FYVFIQKKVGTGG*GSQYSWIRYMELSNQP*I*ALSQDIKLL*NNLFIQFIHDLDPPLAM
YVTSPFLLPFLF*LFCSSFYCFLVNLMMLN*MVGKIVVISY*SPAL*VM*FAALYLH*TM
H*IWTFLDLRSFQKDSG*FLIYE*CWIL*QLSDLSTSAPKVAPVDPRWHLVQEVFLHYIT
FPSG*TVQIGIRLYHQILTDSYENAINLSCGKLILTRYQNFAHFRTSFVPFLGLLQMYIR
RAQQTWVYDSTSLP*LTFVGHQLLILRTNFLLY*MHHEL*WRMVTDCLPSTTAVNHFWKS
FAPAEVTYFQ*LNPPNLIIAEFLLNLHRLDHNHCDIFL*IVQYCLDK*SVP*MSTYCPYT
AFGVNKILRNLYPQFYAALLTWIDDFYWESPLSAKARLEYEIMKIYRNRWAQ*LVDDFHA
SDQNLAPVLELDWQVLLKEYFQTLSLNHHIPLYTFHLLVLFRHHLY*HPTNH*TCSISI*
YRVIVVYFSSVPQIFR*S*MQ*LIIFYL**NQPSYHSRVP*AVRCLH*VCF*KILESSIV
PSQLRPKYI**QMQ*QHHK*LLPLFLCLKIAPNGKMNNQRFLVPSFALLAVQFLHCLNVD
SSVKI*TNFPKMRLP*LT**NSVESILVMNWRRRQLSPVPKFLHP*H*CLRLII*MNRGS
NPALALIADSVIMTSSLKMCKYLLSNYPEFLKQIQQKLRNRKYGD*IDTLRVESLKLSY*
**QHKVLSCN*SVN**NWREFQGSSISPTISL*SLRIELLLVWTLIDHLK*PHEETAMF*
CSEE*PV**IK*GTSYHEAKV*TKNLPFLFALPPYD*SCFLYQLLLHHLLNLCYVWRLSL
TLLCYFHLPLYLLRFLFPLQFSYFLKPLTQNPSYQFCCY*NWNLNCKAWLATILCMKNAV
NLLYASDKMQKLLRSL*NLSSVTFNCIIIPFESFPYSRRTKYR*QC*RRLFCTGLRTR*Y
LNIILSLIEQSHQYHHLTFTLLHISLPPLIFRRVVKTLR**L*LTPKEYTSKTKEH*LHI
FQKYE*LPNYY*FLF*NLNKAIK*G*WCGMYYNSI*EIKITL*MVWYN*KKVIEHLRKRK
KLCYQMCIIVNRSI*IFWCHVGVT*LCSITRTTCDICIIGRTTVVDSGYFITIHLFFEIS
IIIITQVMVAETVCRNGRTIPIRVNFAFPIRHRSGHVTTTPSVPPPRINYQSCGDKRQRK
CCPYQPCIGGTGFKHNTIFIICRTALYNGNHNGYDNGCQYSGYTNANV*S*GNEP*WLFE
HISVKVQ*YNKNHGKEGKDDR*EVQSQNRPHCWHILVLSV*KFPF*VKIVGANIQGVQIW
LEV*CD*CVINNRSKIQVLYSMWGVTI*DLVFQVSMA*RENG*AIVNRNFQIL*YIRRHG
VQFFCGNRLDGFGIR*YI*NGQEGLRVFLSPGSQRH*R*KCCFRISGCP*KTEEIWNVLY
GA*ITG*ARL*FGQDGQSFVGVTRGAYHII*SN*LLSRLSCICHRS*RLDRSDNHCRVVR
IFHQLG*GSKRLFCR**LSEVLFQQIR*SAQCLICRGGLV*QQFHCIKCGGACLRH*WLQ
STKRVI*GTSV*NCVL*LS**CLG*RR*NSSVHQGRQSRHCSCLVRGESE*PEYR*QLRL
F*HCQIIQS*QCICGILWVIGVF**VQNQSS*VTGRVRACGRQRSRN*P*EAI*CFSCVV
*ILQQPINLCQLPRARSRIAADR*GSQFGQ*FDGYCGVVSIRQKRQ*RRQRGSISNIFHG
AKNIIQGAVRSRQSGP*YCQNRAYLRDHLAYIDVFDIGFTDVYIR*GFVVGGGASSGYNN
QYQCGEHE*KAHRQYRPNNSLRQGGTVLFDPHVFVVFFAFLTLRMRIFDGAG*GEIVPHV
YIHYKKVYIQLQ*TLVGVSEKRSSRCHRQ*YGITRNTIPILFWVITSPILPIYHAKKNSP
WVLEVPFEDCSHSNPHGLLTS*LR*QNRKDWKVATHLKILKFFTTEFMLSNFFVR**HGG
SIQFRRSERCSAKLSNKLSDGSPLF*HAGCNSTEKCAIEQD*AKAKERLP*TSTSKAR*P
VDQLRGVHTTSAFRY*KV*M*VLAVTVI*IVFLLLMKQKNARKTLSFLTFGALCSFRG*T
*NHFSSDFLIKVWCEALL*HWCSSFHSRKLSPGR*ANAHPSVHA*RLNYPYLAYPCSRFR
ASVPPRYP*GPPGTMIASTVVTAPEDPL*PFQP*K*KGHRVGVFEFFFWVFSYYLLLTFF
SI*FCFSLVERNLPTKFLAENPRVCKPCYS*TPILHH*NHF*ICGRR*SAAGKCQNMDPI
EVLACSYRWVDFCSQCYLVEWEQSRLAPSCLCRFRRI*LCN*RCISTCRIPE*RDSLLLL
GHVVFVRPGFATFAEKLLLARRG*H*ILFCSCLD*KAVRIGPICWSPDHPNALISSS*MW
PLFVLDLRHSLP*YYYWCSYFCYYCY*FGVLPDDQPGGAKYIL*KQVSYLLYAFAHPLFT
FFFSVKPKHKSFYTYDTFNFSWLVVAISAIHTGSHGLSSCPIKEASVQIEQTVGRKESRN
AECAICPISVL*FGCH*RSTTQPAAFMWNRKEIGALPLLYSFN*RFYSAI*PSYPHTVTK
PLLRKEVSAPPPSYFYSLRAFIVASLASKKLVAFFYLKKTHLTD*FSVLGY*RQACV*FL
RYVSNFGRAILFLRIGLIIFLTWIEPAIQIIIKLFCT*C*YIIVKLF*YVYLIHGTPQNL
QTYQKSFILVHSFYIKK*YFSY*GK*KNRLEKHFEEIVYSFIEPKSVIFLLEIKYEKSIH
SSFRLLLAPAQKKREKKLQNSIFSYRSCPILITFITILILSILLFSV*KKHFS*REKQKN
VKLIHQNTTACIICWSGFSCK*LLL*QSFIAFIFQFIQ*YQQEQYHNR*QYKFSKS*EVF
VSFAQCVANSFPNIFG*RNTWKKIKYCTSIATSYGLQSNFLINTRQFTRIQQGKLISD*F
YKSIELWVWLRFFL*FTTSTTIVRQAIVRLFI*ETGAPTTKPTITKASAIITQSSFTRKR
STLP*YIKTYI*LEN*SYPLV*GYKLSRLC*NTRRSGSFQAIKYTQLN**SK***FQLRQ
GIGID*VVQVPFPV*GII*SYQTNSFDSRS*RSI*RSFQQCMEYYSSRHTADESTNQ*NH
GAHDA*RSRGLFF*GEIQQ*RFNIQSNY**KIGSRS*TSKTITWKFISHAKCQSQKDEQF
QSFANKKIACE*RHSIEQFQI*CKETI*EQNLKASIKCFR*HCKTIGDETRQR*LQFCLC
IFISISLHTDEKWQDEIKIILTCASQGIHSKPKVTQLS*ICSRLSPSKPSKIIKFKHNEK
GK*KVQWLITHSSHHKSVRVVSFE*FALLEAIVVAKKARSAM*LLWSSI*KNTYKMFERF
MS*DPHKG*NKHYEIQWNRQRIRPRTQLRN*RVPLLIL*LHN*DSRELIHG*LNLFQLIR
DIITKQLYISLLVCAK*TTNKNSFSFIFIRHAAASSFSSPINFNLRRADIFAHFEVKSF*
*LLLRNRLVILIFILKSKMKSIYCTEIAEPASNKLKIQS**CS**KGQKNFSFLGLSSRF
QHGFCFKFK*VRFFDCSTTFS**SKPLNFKLTMSSTQVGNALSSSTTTLVDLSNSTVTQK
KQYYKDGETLHNLLLELKNNQDLELLPHEQAHPKIFQALKARIGRINNETCDPGEENSFF
ICDLGEVKRLFNNWVKELPRIKPFYAVKCNPDTKVLSLLAELGVNFDCASKVEIDRVLSM
NISPDRIVYANPCKVASFIRYAASKNVMKSTFDNVEELHKIKKFHPESQLLLRIATDDST
AQCRLSTKYGCEMENVDVLLKAIKELGLNLAGVSFHVGSGASDFTSLYKAVRDARTVFDK
AANEYGLPPLKILDVGGGFQFESFKESTAVLRLALEEFFPVGCGVDIIAEPGRYFVATAF
TLASHVIAKRKLSENEAMIYTNDGVYGNMNCILFDHQEPHPRTLYHNLEFHYDDFESTTA
VLDSINKTRSEYPYKVSIWGPTCDGLDCIAKEYYMKHDVIVGDWFYFPALGAYTSSAATQ
FNGFEQTADIVYIDSELD*RIYLTTTFARETEGVGKG*MQPLSLRI*VFMNELYTLFKSQ
RMMIQENSGIFPVHHCTPLYTKVFFYIFFTIFYNFFLCLVYIC*KETRSFLVV*MLKLCL
FFLFTLEKCRRKNIDICENQK*STNCTYKNREKVHEQNVTTV*QDL*IHPLLRIVHHTST
QAKIDHSYSDRRIFISKEASTIK*KEK**KKNQSAKLQGPNHRSKTSYHITNSRRRSRDS
TATFLH*IMKNT*YSLAEVGT*Y*AP*HLVRALICPIKPTHKTPVSMAQTCLYSTAALSF
GSMAWDMGWKFPTAAFCTMHQDGYQMVGKGFN*KFC*LWKETKCWTCSTKASRHRPANST
AKKHMPSPCAAWN*LSGPNIQYTIAIITTKSKPFSPSKTSA*TGAMTW*TIVTKH*PYAW
TCTVRTYKIKTRNNTKIQAWRLRVRKISTPRILGLETPFTGRPCIRTTGWQTIWMATSLW
TTWSLGVVQKQVCLWSSTQIKILLAERTPETMNEQHLLWEHPAVLCGLVLYEYGYLPSYI
PFYTK**MS*GPVWPREGLVKMFQQTAACEKTRRRSASAFHARAPTAPRRPGYSSVCSAS
RYTRCRHGSLLPWPPTNDGQKLHMPPSQA*LRNSDLSVAQVKRNC*KIQIIANNTLLLFN
AFGLTVSVPFPITEKC*TIHCDNNQRLQSAFWHFWHTFYRLNHLLQTLFLFPSILQDQLK
LGIYIIIYIYKRLSTKL*GKTKNIRKKKVLIDKEKEPREKYKKVHWAFSYLLSLTLQRRT
NNFFKRIFFLPFSIY*FFFSIQFKVKYILICSLNISEKYIKKRNYKNIIRKIRL*TRIPL
FLVYLFATPNCSIIRSLWTLTPQDH*PYLTVL*STCFWYQPLHFSLLRNYKNNLIKFCPN
PLKGLLQMTSLPHLLN*WGNSLATYLL*SNLPRSVNSIRS*TFA*QNLKTVI*KAMTFTP
WLLNYYRKTTQL**RLKN*LKIILPPE*WLRDHLTKNPTLLFLGPSARVTHNW*PFSVVK
VTPTTTLKNCVIYIKLIMS*WEI*SSSPLKL*VN*LELL*MLKKSLLKV*TYWNGWRTLQ
IPQTRTIYFPFQFHAP*LVSFNWLTT*LLPSFWVSLQVS*DLT*KVLQVTLKVWLLLSP*
LRRIPGNPSSSP*EKQLLYYSSSVFVVTKHTQTLPYHHPSWKIPWKTMKVFHLQCCPFPI
*LKNKFKTM*IRLTLICQLVNKLKFL*SMVRRI*SYRAHHNHYMV*T*L*ERPRPHLDWI
NQESHSAKEN*SSPIGSYLLHHHSIPIYWFQLQI*LTKT*SKTMSALTLKIFKSPFTTLL
MVQI*ESFQVPFPRESSTASLDYLSNGKLLHNSKPPTY*TLVQVELPV*VF*PIVIKMVL
VFVLSLPVLSTLTQMMITDSSKKSLMLLVMV*RKIQTGWKNTIQN*LRTNQAKFLSKQNF
LN*SVDHLYWFLV*HHVLFLQIS*LLPQMLVIPLSWPVVVTFPQQV*PPLLILWFLR*KR
VVPSVST*STSIHLCYNGVFH*SRN*EAKVIQFNS*PLVLVSHHWKLLVNT*RH*V*STW
V*NQVPLMLFRKL*TLLKHIQTSQ*LYNGPVVEVVVIILSKMPTLQCYKCTPRLEDIQTL
C*YSVLVSVLLMTLTHT*PVNGPQNSIIHQCHSMVSYLVRGS*LLRKLKLLLMLRSVLLL
VLVFLMINGNKPTRSQLVVLSLFALKWVNQFTKLPLVVLCYGRNSTKPSSTYQRISWYQL
WKQREITLSQD*TPISKNHGLLPSTVKPVT*PQ*HTKKLQRDWWN*CSSDLPTLGLMSHG
EPLLVISYVVSKNVSLKVRHCL*SNPILY*TSLMKLLKKYLMLILPLGNSS*MRKILITF
*ACVKIQCKNQCLLFQFWIVDSRFFSKKIRYGNLSTWKPSSTKTFKEHVSYMDLLQHNSL
KSSMNQLRALWMVFTMVTSKSYYINITVTMSQRFQQLSTLVVKAL*TYKVKLILPLYLKT
QLFLRQHPLLMKKAGLRLWRDPKLTGDMQVSYVPLSLKIKCLFLTQLEKFSSQAKEWLLR
FPTAILLQRLLSLFQNLFKVN*NQLLF*SC*RRT*SKWK*LRTELWMVSPSACHCCTTST
QIMVLLQSLKLWRTETKELRKCTGNYGLMSLSIWTLTQEMSLRAKISRSPLKKFMTLHTL
LETIVKTSFLDLIERCWPQWTLLLLSDGEPSSRPFSLIRSMVTY*SWFICLTATR*FLAL
SHCKLVMLFQLLLLLNLSSTNLQERLSMW*VHYREMASLSWKSPPHSSTEATILTLKTLS
KRLLNLFIKCTSKLLKI*LSCALRSGSNWTMKTSIC*TKL*LSKLKLKLLSRMLTSSLQ*
NVLAQLKLNCQPKKPWRSVLSITKPVPLTVTLLLIS*RETVPHWNKRSI*KILFQLQYLI
RTLQVPTNHTLEFLVI*IQFTFHVILPLTQTCQVLSRTVCFLLLPSVL*LKTGLLTVFHP
GYVATLVNLLTWFCLTLL*KHRFNMLV*SMVEN**SLKLEMKMTL*F*LVKPKLNNLLLP
SFSLVKVHKNKVWVWTYTKLLKLLKMFGIELTTISRTLMVSLS*TLSLTTQLT*QFTSVV
KRVRGSEKTILL*SLRLSWMEN*RLKKFSRKLMSTVLLTHLDLKKVYCLLLNLHNQL*L*
WKKLLSKT*NLKV*SQPMLLLLVTL*VSMLLWPLWLMLCLSNL*LKLCSTEV*LCKLLFQ
EMSWADPTMV*LPLTQVESLHHSLKKLCNMLLRELVREPAGWLKSSTTTLKTNNMLQLVI
*EL*TPLPMF*TSSNYKKLILLNYKSPYLWKKLKVICLRSLTKLPRNLLSSLAHLNWREV
LLVSH*LVFLFLSIPPT**MVLNHSRVS*RRIS*KKM*RLLDWPESTFQT*LQNHSRLLR
NISRTFMI*LAPNLSRKSSTTGKSMNNPNFLSDYITVRNI*L*NSCILMFNIAGL*F*FS
SPIINRYID*VFL*YTWD*QMLYEFFFPPQALARAGQMLKKKFSVPLGYV*KSTIFEHNR
*P**LAKFCSKEISFKNSSIISVNCYFNSLLEKLKQVSIPHISAITEPSRFSYNPTSADS
TV**S*FEEK*KCVSVKFLLVTLTQSWVIWFAKD*VSNQLHVH*KNLQMVKRQFKSVYLF
VTKMCMSFNLVLHP*MMTLWNC*F*FLPVGADLLGKLQQSFLNFLTLNNVK*RDTEALLL
QGCWPICWSWLALIMLCLWTFMLLKCRGFSPNQSITYTGALV*RNGLEKMLKTMKMQ*LS
LRIQVVLKELQPWRIL*RSTLL*SILIVVVLRICILKTRICNN*S*ESNQC*GKIDRSSD
KVTIQMRRKTLF*VTVFKLLGSVTATLSVTMRQTMMKTLS*NLTANCILLMA*TRMAWAV
HMMLSTPKTKRKSQFSIGNN*LHWSETSVVALPSF*MI*LIDLGHLLALLNIWCKIVVPK
RFMLLLLTVYSLETVWKNLKSPMPLTQLWSQIHIRFLANA*LGPRNWLLSMFLQFSQNVS
VVIIMVRVFPFYLTLWQLCKQKRVCAIF*FLNMT*IIKKLCMFARFQ*ICKSINYRNLGE
LNHLLCFMYHGKNRTFIKSSMKF*QVSHFPHFIALQ**II*IYAML*VPAAFHLM*TQDY
YHPNTLQHPYI*LAPFFEKILPSKMLKVIKFREKGTDLVRADLPEENRSRVSTGLCFFAR
RENEAHRPSSMGADRDGLDLLSHCNGNF*H*SFNG*HKTTTNVFSAIFERANKESSRTTN
RLKWLDTVLLPLTLLNPLLLVVPTCVFLSRTPEKLLKLLTVGN*PRLKNTWNKFWTTKEL
FLSEDLTLPSVELLKVRNLVSPRLDGQLSLLSSFKVCCKTPLPTLKYVKNIICLVPDETR
MS*NSKCAENPL*SREIEYDK*IIQKVTITRLE*TVKLKSN*GLPLRVYDFVRKILKT*Y
FFPLVSSFSIT*PDQNFFY*QHNYFYYRLKVWMLLNCTFLISKLTKLQSKEEELTELTVE
STSTNLLHPTLN*LSLKRKKLSPRLLKRRSLD*LLDKEVESPPKSVLLLK*KMKNNDNII
LC*F*SFIYVILSPRHIT*L*NKFFINIIILYRIILRSKY*T*FYNEQRYKKCS*TEKIP
*IR**EMLLSISICQSLLIPSLVRNVCVLHTELLEFSE*RHLSIYAMN*TNACSYFFCSP
KSSVEI*RRLCRLYYTNLRCHVAANINHIHAHHEYESV*TDTVKEEYHPCHFIL*NDFCK
TGK*LL*S**FLVFVVV*FVLSKICHWMQRFIIHP*VLGFHVNTLCTLINGSVVIIIGLQ
IPNPFIKLRIVAF*LRNF*FKLTLF*VSLS*LLFQIHISRTKSVSLFSNYW*NG*LVSRK
FPIFWNTNNRTRWGHFMGRTIVHLSCYTRHHTCSLVEVRTDVLYFF*VRL*FFICFFESS
YLLLQLVHRFFQFVSFFLLSRTF*AVFRQSSLELLICR**GTFESIIILVFRANVIIRII
FVYPKLNFFQCRKFFFYLIVIRIIV*FSSNSF*LRLVRFRFRHNAI*LFF*LIYCM*C*F
PFLLIGCTQQCIFAFQLVKF*FLCM*LSFFFCFTSCLCKSTT*FLISFL*LIYSSLRSFQ
LLCY*IIFSNPCRYFFLIVFLVTIFVSITFYIYIFRYFGL*CLVLLLYIC*LFQ*ICFSL
FPISSFFLPGRIDFLSFRSQSFCQCFCRALL*VQ*P*FQSLIICIFG*LIF*VAYFFLKF
LRVINFAQFFQRTL**RLWIRSL*KLFVYVKKNLFREF*SLCQIINFTLVLLNYFIHIVQ
FFLRFEFFKFFSLSG**LS*IQGQGFFILNLYNISIQFSLKIR*ICLGPNIQCMRIY*RI
HCQIIFDELI*QSEEMKQLRTIYCTVFIQNS*TYYFGIFMSPKIISFVT*HSL*Q*WFS*
MTQVTTTTWCAE***SELKLWVPKYSLIMSGDMMLFHVFLA*ILVCS*KNGQLSDRANSL
VY*RLFC*STFGAKAYFCFELKKFFLCGTCINFSLYLYIIQTLLLFYRKK*KPK*QKSSK
Y*SKVYTQFVIFTAKPHIS**AHRYII*ATIH*KAVFQS*SCKNKILLVQ*I*CDTLVLR
ACSIF*TMFV*A*ILFF*SWRVAKTFPFKIGACRIMKLF*IIESNF*ESSK*YFVVKALS
LRDVRDVPTFF*VYFIKNIICFFISKQIFFAFILRFSRIIWNPIVDIEMRL*YWCTYTGR
IVFCTRGDIVLRVCRKWVTALFA*GQLV*QYAYSFFLILINESFPHVKYKS*FDGTQEFR
VHMQSIRT*AKD*KY*VRHQNIKPYIINWSARVKFNNGIPDGAGMGIFKSIVSFYLL*IL
NKGVNRKREHD*NNNETEYQQPCEPCQV*T*IGTV*NIPNVLAFFIKHEQY*GGINSAHK
*PYKHPHGIQNSGNPCRRQ*VLATVVTSDTISKYL*QI*KSHDHDRCEQANHKVLDDFRP
**KIR*NTICLQNCMQVVNDVGNGT*YANIRTNLQLDDNITPTFTIPSREEIVVTPYCRI
YNTR*IHCKKPCYQNDCWNILGM*MPC*RGS**YHS*QTKPYYC*LV*HENFDSILPFLH
KFNCL*S*KAIK*NM*ILHKMNTWEFRNYSYLKHPLIYIYIYIYVFSKDFCPNCGENSAS
P**RPNETHPMMQLLTKFQSFRHYSFIYTLIVEKFPN*CHNDRENCTSASNEN*HPYPEF
INLAMWYNNIGLVTFQL*NV*RLEKRGARTLLVV*IRRSHLK*FCSDNCIFLERFGCLKD
SSNQEKHYKACLAGLLG*NNKFLIMVITVNDYERVKQRMVVLW*EYFGESTN*SCAMCDS
LMYQKKLKNE*RKSYI*KKKISYTS*VTWNILNM*RRRKH*PALQ**TRDEKIRKASESR
SSLSIPLSSYNIIALFILFSTKLTQFSKLVLSLPILPQEKIFLVFCFNTYFLFPTKFSS*
IFWLLLLLLLPVNSLFNATSLMSLERNDTNRLLV*SAFNRSIFIEFVILLSDS*PAGHAC
NWKKLLKWVKYIVYFGNSSRGLFIKPSSISESVVKISA*EELPGKIS*VELRSAKEG*HI
LSKASSKRSS*EILWQSLFNSTFFSGNLYDIFLTNGGA*DTSPTLGEPGVPIQGYSSYSL
IDGDCCGVVSDNLEVACCKEDELEVLCIFPAVVCSLSHDSLCFKEGLG*KN*EIVGLLLN
QEPYEPGWLEIEDDR*CNELLPLLKEDG*ITSAKDSLEDTDTEVFEFLRLGICHPFLKEW
KLGDPMLLELTLLLL*L*LLLFSVRLKRLSVEVSVLNSVSGLSTKLLLDLFLDTADESDL
MFSRRIVICPLYFGSNKADKMNSNLLATTMFPDRITILDVFSSLIVCL*SDIIIAIRRGR
KPSFGPSLISIQLNILLNQT*TNSLNVSG*RKSLGISDIERKPGMTLFCKVCTIISISLG
*CVLMSIFDNFMTELLL*LPVFSCIIRFLVKKPMSIF*VWVNHDEMEDHDSATTGNNILG
MHKLIAMRLYWCV**KILVMSTKSELGIVLILSHCVKSEDLTGEPNIYSFNSLGRICSIE
FEIFDVV*SKISR*LFLHAI*PASSMIKILNAYVFSLIDVILSVPRPPLFCNVSIGRL*G
ISLEPKSFSFKSSDI*SKMGGEVVDSISEGFSTLTAVSKRAPAAVLVVPVLAALQYTGTL
GTTEEKSECSELFSKPDELVLFLSKLPNI*TLPLHLLYKATHKTVLTGKWYWRLSPMGFK
TLQTHALLFFFIYR*QRKLVAERYTLKQINQSILRTCFVQTIH*KKHARVPKNRDKQTDK
NNNDSYRLK*NNTHVIKNPRYNSLVFLSSLTITKASLLLYSSNKKKLQ*LLTNVP*TPCT
TLAFDLTHL*AETENTVVKQVLAAS*YTQLPTTQVNHKLLLSMNCSKCGHSFNFAPLKLL
RGL*QQP*G*WTFLERQMR*FHLLVYHLFIHDRFDISELHVGIS*YSHKHHSEETQENGK
NSQVVVVFSYIVGAVHTWGPVCAVVIGCLR*QAQ*PI*VGQLWSFSKCRIYDHYFTIHAI
ASDRKIKPVQGFSWIAFGYLPQFFLKLPSPRFRQRIVGTLC**R*PCYRFTYTLQITFAF
ALTLTCGFAFEF*QRS*FRKCSL*AWLCNIFFQCF*K*PVDYKG*R*TPNEKENVPN*LI
NQKEIRRRVL*PKQVHSALAIRAARIYCMCPTSDKVFSK*KKRATWMRGIRR*WTIR*QG
SSWPCMRGK*YRLRS*KPIVVP*EFSFEPPSSFL*IARKLWFQPVVALFFVTFGK*CN*E
SGRIGRHTIPSRKWFIIPPPSSLRDPFFQITVYWYANLSSPCITQISRRVYYFLH*QVRF
VKVLGIFHFFKFDDP*FCRRICNDVTILHCFRI*MGCHFDYCRSRWWISTIRCIDRLFHL
*R*YSKGSRTQHGFFTERYCRVPISNWFTNVPNWYRI*RWTSSSSRRR**RNETVP*LRH
NLLEMVLHWRFANSSECPFHLIN*NYVYSFYISLFPLNNGV*SRSYIIYHIYDHRQDQIL
VLLYGAHHHNRLSRFPHFPQRDFLYYF*DAP**NLLQNYFLQTLSLWFPSLEYVQHCYPL
VQKQFLPHHWELEP*CHLPRVI*NYTSPI*NKDQ**LKCRIRTPLKHNSLF*KLQALALV
GKQKP*ITRATQ*KQC**TNQTYT*FLLARFG*LFFS*TAPRLTE*KSQNKDRALQRL*K
H*MRPLKSKLADLKSMILSYSIQQNSWGLLTENPVRRRSIYRSMV*PGHD*NYIPHEKM*
*SSQFRKTVSFLKLGALKKKTRPPNQSIL*KCSLLVEPYDW*KANHYLAGLTLLV*EK*L
QRTRITIPHSTYHVEYPSQEL*LRQLKQVTY*NLVT*N*TVGIQ**RKEMRFYTLIDYYQ
SEIARTSKIEIYLCGILVEEYQ*I*WHI*SNKHRLCLLFQ*ILQISNSRGLQQSQLSKIQ
*LCKKSSVPRILGWSSSSESKKW*VERLQK*YWYS*SNSL*ALTSQCTTNILISISPGPT
WHSQHAVPSEILKQSHQEKATKTIYTLH*LKNLAL*LTDHH*LAQWPY*CTFLKRDSLVL
NRDRQ*NLLTITIYPTPDHN*NARPPRSLDCHLHEQWCASYQTNHSDRNERYSPLYYQPV
AYTLAFFIYLTYFYLFYCTMANKYTDWYVLRQIDDLFFWLILMG*LMIVKASLRKF*CRK
GLKNFKVAENKALGHYLPTADDC*LLLQKRYTIAPNIAKWKVTIYSMSLEI*SELILLTR
MKKKVCWMSKNNIKPIRLRGAATTMRLRADNLPR*EVKRNLEFP*STLMVRKWKY*WKLR
THSHHRLHW*SRLQNEQSCKSIQFLHN*KKTFRRLDIIETICYQWLTFRRG**MLVSLDL
FTQVRPL*WIS**STHTNAYQICLRM*NLDGNR*DTWII*NKRLTGVFPLNLMVPLYSAP
I*NPSLE**TFWMHQGMLILWMKRQSHLQQVIWF*S**ML*KVLHLW*SN**NKVLKIM*
QCVLL*INSTD*F*I*SCHQWTHT*S*II*LQISIPLRRETCFHQ*TIT*YLRLQSWASH
SLSRNLFLIITPTPYLLLR*TTLPQGYGVAYITIKVISGQNHLKM*RSTRLSLNLSSSRF
IKYFPTLYLWRKIN*RIC*GLTLELI*VKRPSSTIRNLF*NTFYS*YLGNKPVL*MR*PD
VINHLNYSTIRQLIFQFQENLHQKALFGLMY*KLWITVEQSGPLYGYTLDF*REGIQYVY
LIHHNLNLAKKDSCMISQRRKPPTKMKMKMTKRLHVRSKKLAY*VADMSIRFMKHTKDR*
Y**KVFQVHILNPRRCTL*RVRRT*NS*NFSNL*IILPRQFSKLFFNLYCQGNYPSYWMP
*TKFRNTTQALLLKLRNLENM*Y*EMESCIWTVCCMI*ERVMQR*KLKYLIL*LFFLKVA
QMNRSLQYL*VIRYLALVRKIYQVCRLV*PLNQWTLK*FRI*AGTHWERVKTAWILTE*W
TTQGNYPKY*EPSMGGIRWHQETFGLFIMATC*LMTLCQMKSVLNYYPNIRNK*YKDFTG
L*KRGLWQKNQFMVYSINCYRSQYLPT*TLTL*KVKLFR**KKPVTLAY*QQSQFYWNPS
MKLTSRSTPPCCQ**RNL*RRDVEAGYTKQ*KWQGHHCWRFVDKFRLLNLQDSRQI*DYL
RMVLVCVSCTFGTRYGGRFLVMFWIKMRLFQN*NPHLSTV*VVIS**KQEGGRVFLQVDL
CQMMVLRLKSI*ALNYTLN*EKMA*YRENLGA*ELSNMSTIFLFSRIYI*LRI**YNYSS
GLKIFYFCLNTDEMSFIEFYAVKKLNGNKAQLVEQRYIENG*RFQVEGVAFASKGN*KS*
KA*K*PKEKEIPRIEERRTNYRYSF*FEKA*EERKEGRC*EGSCCRY*RISKPSPF*KRE
KKVEKRIEKNARTGRYRSSKAYVWR*R*IWRR*RGRRRRRRRRRRKTGS*EIGQK*L*V*
R*F*V*K*F*RG*GCRC*RRKRGKGRARRRTRRSIVRRGI*F*CRCRSTS*TNRQQHKSD
ETCLRKGTIAMEKTFIPRAPKRYIRN*YG*TY*GHIR*Y*KGISILQAITGRCFSST*RI
ETTKSTLQKTIGLFC*NGEK**TYGQD*G*VD*RSQ*QEGT*RS*KTKAIEEIW*ASPKR
YLTETSIGEKRNTGKDQIFEEQKKAQRDRSLRVQRRCRGRS*RKKVR*RQA*RKESRKKR
*VWPRRHEEIQEEE*CYLFC*CQRLFFQKNEGEDQ*TRKE*TCQKILSRYVGKNTVYIQN
VKYIQLSIISLYTSIK*N*IQRSPKRLL*PCQDDGKIKGKTLCFCPKTLAPALILMAGMK
RSRNFVYGVALFL*VGGNRLDN*IQ*QQSMGDGGSYVPFGSSGTQVRRYAISKRCYYSNE
EIFSAKRSKRTNVYVAATASTKWESDVIITFITTFLWYSVADIRLSSIESQLWKRSTRLN
GN*YTC*RTSF*QGQ*Q*YNLFQA*EDLQNGT*APITIYFSTTADKIAAGRCRK*SSKP*
RRNRRSRAGRSVWQSIFIHYRGGVRSRFRLYKASE*VAKVHRGFV*VQKQCHSAGTNQRQ
WKGKLRTLELTGCNIDSKQTSKR*FFAREQ*FVKSRRFYFIKKFAF*GQTHPSAQKQPAN
IYTPVQLRSGKEILIYN**QQQ*HNTE**ILFCEVKVFTSNSKFCSSCVVRFKCFVTKFS
SDYYIIDLIRATNKPQRYDGFDSEASQKFFELAVYSKEKGDYRACTIS*LQGHDVPS*EV
YVNIF*K*LFSRWVCQ*CFSFAGHG****HQ**EHAQ**Q*HLRKYASTSKI*ARFHCIP
IFKFFFTFDDVNS*NEFEPIEWKRRWQCETRR*GYGNTRSSVG*NHRFRRMGDHTGML*Y
*NWCW*SDKNCEVQRTPKYQETCAERSSHMEDFEA*QNTPPFRLEA**QLCNVLFNGKN*
RWYLIRLGNILGRIQTFEDTICREMQIDHFFKLTTIICIKVHAFQNDCSW*HQIRKLSVT
KRR*KIGLEGFPMRFWNELPLR*EACLS*RYF**KLE*WQQP*KEKKY*TN*FDKVSHNQ
FFT*RPN**F*R**KLKIPI*KSKASTVYTKRNG*LQFTFIKASQSTILFFFF*SISQAS
LSTSTTASESLSWEAQDNRFFKPGTRTF*IYRISALRFARTSKILRCKTFKIS*NAYL*F
TRLLSIGN*RSIIIFL*FIFSIILYKGVRSHEFRCNYKFTVWFID*FSMYCFSFRTSIRY
LGLGSNAIYNVSRKITL*S*VRT*VTLSD*SRRI*PIFFSSGL*I*QEKK*RNDWSRLV*
HSHWMFDD*LG*EVEIEKD*RSPSKRNEPKRGHSR**WLMTYD**Y*LH*KNTYIVLTFF
SPIL*IITNFIITITKYVNKYFYRIFDASITYLALFIATRATCENSEYFFEQP*IMLLND
GWKKRDL*KSSDKL*SVDIGIADL*NGVSSTL*DLDKPYFLTSQHDISKICHQGNRQFRC
TISRMY*SNKERVPQESCNGWRQNSLCYTESKALDSKHYGDSQHQPCQKR*YLSRNCRKV
*TA*HVQKGWLHRCIRRYCLRFD**KYR*TSGDKNYG**WLCR*NTERQGIQ*DMLFGK*
GHIRIKVPPFSIH*RYNQGTVNQQKSFVVII*LTTCIYCLNFNV*L*L*KRMNVLLTFYS
LELYSFSCLIL*LHAVNIVYKIFMWNHILGSNSYFSSTAYLKVCQQKSFFLVPIERCDIM
RFFYLWPTLSLRALILRIP*TGFYAAFPCKIHHKTYLFLSKLLSKDNAPISLLYKQRHNS
NSQSVLDRNTPHQQTLLELRKALIQLYPFEHEPSFPKRFEIQNLYRSHIFSIDHADKREY
FQVLNHNERYHDHA*T*HHEAVAS*NNRLLTDVIGPLISTYRPAYHKGHQQGKIPLLQ*T
KNCLLEYQIRLEYWGLVFYHFCGSGSRNAQ**TQR*SLYRTSLNHCLVWVSILSQHSICI
CYHDMFQMGGSPFHSVVWHTA*LHRKLQRQRDQQDGHNYLEK*VLARRYTQPVLDFFLAN
NFVNFYEFCLIMN*STSTHHCPMMRRDSLFLDNLPFLAWASCGCYR*DFDRFFSHGLSEI
FLRLAEEIKRFQYRIHFYDV*IDQKE*YLILV*IMIPVDVPVRSYLSLISQLPLITLYYV
HDFRLRKL*SHFAQLYIAHLLLQIEASSPNFLHLDVTSWCITFHYRIAWRGEDLDMMLLC
VKPSYCSHLCNYTAPGLYFSVYLCSSHDKV*GHCLNHLVKNP*PIDCLMNLSFHLNCHMT
KQMNFLNVDAVCHEKYEKQIFCILVNC*QFPVLPQI*SDVW*DYY*HHFLSV*MDVTGPG
CNTSMYNYAGVLENFLDLKFVRIRLIVLVAQSFSWVR*KTIDKEFG*H**DLNLLNEAA*
KGF*RTQKMTLLFLSQVVAASSPPALPLMLSMFLSPSCN*TS*LK*K*NFLIFHKKYAEG
KKRDPRADNIQHNPTYCTLNYILICPISEF*IYIFP*RAMFFDIYMNKLIERKLI*YFLA
VQLL*SHFQEEERALFCQVSLSLYLHAFYYAYQ*SLQRSLHEIKSPVCMERFFACLRSLS
LSRQTSFLDYRTAKWVGSYAKKLWHPYVHCGFSFEKSI*DLSIF*DRLESAVVW*WR*FY
SKILTVVQP*TSSYCSRLTYVILFFY**VLWPILTDILFSLGEKS*ITLNVPVF*GRKCS
HNMAYMNAPLFICIHLY*IDVRRYIHVHICMCHFFIMALLDSPRIYNQVCLCFFLFLFLL
LLIFFFFQLQLSH*TSLKFFH*IHIWILPLNSIVEFLFRVSVKLRSVTLALLDWWFVRRF
YVSC*QFLPYHFVKPRMVLDIFTSIL*VTQPFT*VSGN*LLQ*VLRVWMEKWWELQFGVQ
YIFVSFHGVRIVKWSVSGKHFID*HTKTPPIH*FIIRFCTDHFRRYVIWCAT*CVCDIGN
VFCEAKVGYLDMAVFI*KDIFWFQVSIYYILTVQIFQR*AYLCGIKFGYWVGKSLRFT**
RK*FTTFNVVHYHENLLRILERSPHSNDEWM*NN*KHSAFVIGVFNLLQLHYSVLFQCLQ
SVKPPIVIGTN*VNSPK*ASSQSS*NLKVT*GILS*GISIL*HWFFNQTNTCRRFFFQLS
AVSSIYLHGCVGRTFLMHRMCVYRNVLSNVIWSCFCLGSNA*FPDFIVVHRINIHFVQAR
SFLVQPPIYNMINVLFNNIRETFLLLKE*SPINFLRRLHKVSRMSTRVSYR*K**SRQNF
*DQLVKSVFSFHILIEHNFIFQWHRRNPVAEATEKKYRKLHNEAIH*KESGSPVCVGNVI
*IYICICTYIYIYIYISEYFNVYQVLIKIATWLEINAFLRTREYLKR*RNFAKMHSRFSS
DLPKSLVPGTTF*RMKSLSS*KK**MIRLIGRWPPS*QT*ELN*DHGI*VYVVQASLCRP
*FCRHLLYC*RISDRFAIFIPPKAR*RELSEMDSLKKKKYLLMDLHVQLLK*LGH*MEYG
MRL*K*LPEAHLEKKLSC*GNRSWKV*TIVNFFAP*AIDVVALFSGNDDWQVIETYPNQ*
SLKNSTFHQKLRN*SSCGQ*MLLSL*L*CKL*IFRMLFAFKNENLWPFLVLNSLNFQGKF
TSNILALSPRYNSVSFSIQTSKYNYWKGTRC*GEKTADCVHY*V*LGKMNANSNLFQRCA
FFFRCIAVTRPAIKKFTSKNC*YKAIEVLDEFKFFLAAISFDRSTLSKR*RQKLYIFKNA
PNG*YLDKAQVMYSLMCQNWPLWL*LYLN*TRESVEVFNSVSLNASFVC*FENEKLRHKI
LSSNNRKITH*FTITEDFYLSTVSVANV*RLLIYPNFFLFRFIF*NEFQDLDSLILFSAI
VAY*LGIT*KKQIIR*PEKTGTFSLIHFY*LE*GYRLVFPLDFASFEAFIELFNR*IAPV
FLNIHIGKYIHSGGYVNLLCFFGFILYDDIF*QHMTEYFQNKHEQR**DRQTIVGNGYAN
IQPRPLRS*KVEKIQRQNITHGNN***DCVVLEVKF*IQYT*ACGQ*PVGNYQFQHQ*CA
HQERIKNWQQSTNRLQ*K*RD*SDVTSSKECDLK*KEPDY*NS*HL*PIFIFLGLHFFDF
VLNFNPLYHVTSEQEVEKGFE*YSQNDKGWCEG*INDQ*SHFVIIVGLPIM*NWHYKKRY
KKNYPSSDL*LSW*PLS*L*RDN*TMSNRQHGSHQGNLNGKYSTRVGIYPGMYFVKSIKG
TEND**PC*MYLVQVLNFNSVK*GKCR*KNTSYDPQYIHG*LSHPTNKRVKRQYICN*RK
RPSMEKSIYNSLIN*YNRDCY*NSFPRRGTFEEFLDT*T*YGSICKNIAPKV*WEKKVHV
KIERRMLVEQNPI**NSYGTKYCMA*W*RFLVINYIL*YE*FQKYYKRKKDPPNKPKCNN
SSNESPIIGCQIM*TFQCYLH*FLCKGDCFLFQIVFSFRYTLN*GFYLF*VM*MRLFNKL
EVFLIKKLRVYYLILLD*VLL*NASCVVVQCGKLVTFFSIDICYW*LTN*IFRIVHTNQV
*H*RSNICLLDIISFNARKLPIFSIVVGYRKRIMYWFIQTRTPSNKRGPCVVRMTVTM*S
KCTHTMICCKNKCGFVVRKKLVDFVYKDRDLIINIFDIVIILGRIWSIRMSGSIAT**M*
KEYITVLPNFIIQC*VQCGIVE*LIQVSKDKSIQLDGRLRKILESMIIHPSVNFIWVRSA
IFEHR*NVR*TE*ISMSRLVEKTIEIDRV*LPTFCDGTNIFVKPSNHSNMTRTGFSWHSG
M*YTVGGIIHYQRSNKRCQKFCFSGYWMSDFIKSGICT*TITDNQKQSLCRRGWSTLIWA
HTMNER*NEIDIKNRP*VK*MK*DTNSQKRRSGFVPHFLQISVV*VLRLFNALVEDGLLN
I**RTVLFTFKVFFSRLMTAMQKEYTYYLRGINIYIFND*HPVV*DEKTHMKYISMKSTA
P**FNKIK*VTLTSR*YC*IKNNNENSDTGSRTPVSTVKA*CDSRYTISDYKG*KIET*W
NYSCKY*RTLFIYMDNW*MLWGMLDFIAVKGYNIMCTEYTVCDNILVTRILLNG**YACQ
FS*ILTEIVTNIWHYKMTTICFLLK*ERAPRYTK*CLRNILSQE*LKLHPISIP*SLGTI
KFVGFFSGKTLSKYKVRF*RNL**FFRNNNVYSIKK*TNFKKKSEEL*SSFHRFQKKAL*
NEETN*EEKNEPTQIMPFGDRND*CTEYATMTLCFHATMRGKLMINS*ANR*LVGGLHYI
EFQCAHRISCRSFLTNIGKKYPGHRWPSYLLG*WTNQQHR*HQLVVEDHRIGIVCWQR*N
QFYLYRQSGYHPLSSFLKCHCFYMFQQLLGQCH**LELELEMV*WLQKLKLWLGFGHQ*F
GRLEQQ*YWWWLGFDRHQFEKQQQQWF**WLGFDRHQFERQLQQLFW*WLGFDRHQFERQ
QQLWF**WLEFDRHQFGRRLQR*S*LR*SWWWLGFGRHQFERQQQLWF**WLGFDRHQFE
KQQQQWFW*WLGFDRHQFER*QRLS*PWRKQ*WQLVQQQYRK*KSNQLYHPCK*LMELKW
TTGPLEHRQLKM*QLRRRQLMIFCIAFSRIYY*GSFVVCFFLIPVY*LLFS**YYSYTVI
EKIGQLCIK**RSCSFLYVRIVALRSSY*KNN*YTSVLIFGQERLTGHSLNPFRYMG*MM
VHRIIKASNRAPRRIYVRHLNFFY*RCFYNWQDIKRLLIINDDIIKSKLADLSIFMRSKP
RHFPMTGMLCIFHMRYTLTPFRPTVSLKGQQLSKK*PKKASGFEELLPK*ERQNILEKKE
KPNEKSAGAK*NIIEGPRGDKRRYN*IIKFSL**QEQRL*DTLLC*ETVRYSVRKLFNY*
LNVYHFTCHRVGF*NVQPF*VCAQLFILNGSHYITIIVFLPMYFLIILRQQRDDRRIRTF
IDANV*KMHPKDNFCTEYNCKNTLRA*IGKVTGKLA*ETLFGTEQPFPNVVVVEGVNRPY
CTLLPLNLISGPAQFLGG*AVFLPHREKLLQVKGDQTISKLIIDQRPRAF*IWHISPSTE
IEGINHASPGLSLLHSLQHAPNQAYIRFSSFSMLY*FVSCFV*H*NCNLRFL*IIITFTS
IRNLIKQVLFISKNAI*KAISRLRFSCYIFSCLCSKGPVVHFNSISYLQGWYNRLLFEFR
YCY*SRGYQCFLRRLI*SKESRLSDR*WSSTGCHYYCCCF*EIHRCCCFSNN*RSSSSC*
VYCRCCFPNN*RSSSSC*VYCRCRFSNN*RSSSSC*VYCRCRFSNN*WSSSSCQVYCCRC
LSDF*RPSSGHYLY*GCCIPNYRWADTSI*NYQWR*SSK*WPSPGYC*SERR*RSSRCCF
L**Q*YLVNEFKQGYLNR*EG*NWLYRCQQTVPIRWSSTTSWCYLCCWLVHHPRR*LSSW
*PGYFLPMFVW*LL*LV**AHWFSVP*SLFASYRFN*LLNDASINRSRPPLTSRISCHSH
SPHINLFYGILFI*HVFISKPFLVLCIHLAFARESITFSHIIVRRYNKNSYRIYSDLHVV
PF*L*KKKFYDT*LPKYNSESNILIAICMLLGGPAIKISFIILYILSFNLVAIAEAFPEK
KFVKLAAIAKERLRYRKALSWNAKR*FSN*PRKKLVGRLNFIVL*SFRRVYCKNC*TSID
KRYLGH*GADPLLV**TTPGA*ITPTCGGGSSNWNCLLATVEQMLPLLSVKMPLFKVTFK
ALSLLRQLFF*KQQQCLDM*RKKRKKRWQKKY*AITAM*RCFFYRNK*RSQ*Q*LLWLPL
*SYLCRFRLKWS*FSIFFTNQSTCTVFCGDSNDFNLAVNDLRKNVSLNRGRSCCNCLDSD
TEEGSKFSSAA*GSSRRS*G*PWLTWHILLGRNSIVKLLSNQYIWATWLSFPEKDTI**L
CCTFTL*TSVNIKNILNKRMQLP*RGQDSDIKWKSVSNIAQASINICIYTFYVVYVKLSI
DQAESVALLSD*AQWLFVAPFRFALARWKKKNANHVLTYDVLGNLQD*T*ICDGVLK*NE
HLTHPQQEIFTQNVPKKKKSYAFTGTNEENDRIWI*AYGRNCSY*VKNMRARPA*G*L*L
FNPNLSFSSHPSLIVPYIHMKVQCLDSVCTYDVVEGYLVY*KSYLVRIPL*YYLNMGLLF
AFVRVVGN*YLVWELRNKRGEDMRAMFFLKECLLPMK*IY*T*KCR**KQRLRSLTVKNV
FILIQRNKRNHVECSTAKELFFMSSS*GLFPFCDESVLLSLGLIHFSTKSATSSTSQLLE
ELLIPL*MFCNCKKSVMKHILPLRLSENIESEYGCTIWLDPVGRGLIKLFNNDIIVGLDL
CGVSTMKSLCSGILFLIVINISINLVGI*SSLPGLTWDRSLNICSNASSHE*SMALSKLL
DFCPFLLISTKHCCHPLSSEEYLTKSWVVYFITSLSIKIWIGSSM*NFFCKKYGETG*SC
TKLTDPGIPSKSFEGILSHLYRGTMKYFIFWNMLSDKVDLRYDIKFLQI*IAWGKSV*IF
TMLRS**G*SFNL*LTSSHLARHLLNCGSQSRMLSNEKGSSFAVVVTGFLCVKKFSLFIM
FGKFCHSM*SFKEILAVWPLLIPFVESNCSKVNSG*SDFR*T*ILKGCNLFIIQSRQKHL
*MISTFL*KY**AI*NGKENLRED*RGNHVYIRIIANLRNGVSYFLTFWFFPLSEGTAKP
PRGLSLFAIFEVYTNN*EGEQAFYIFIIDSVCAHLLVVVFCYKNLSSK*FKFFF*VEEKI
AVILICILVCTIIDIYIVTWGRR*NWAHFCYIWLSRSVQ*FTIFMLSILFEGVFLLVNTL
K*IRAYSHKVLIWLGCS**WKLAYIGKFRTITG*NFPRRMDLYNFLRNGIL*R****WGI
TANRMFSNNFPEIKYFLYNFVS*FRHTFDMLEFESKGLLT*EFLIYIMPH*QIWML*CIL
YSNPFFRIKF*HFL*QFKRFWISTR*YAFKRSSRDITELKDIIIHLLRGNFLQCFLRWCS
KYL*NMIQMIYIILPFKHWFPTK*FGQDTAC*PNIDSFCAFLIIQQNFWCFIPYRGYITL
NEAVVNLVVF*ITTR*PKITNF*LAITINK*VFWFQVTM*NISRMYVFQSTQYLIYEALK
VCVFQALFGPYNLRKVTFH*FFI*INAI*CPIWVKYYISIEEPHYIWVPS*MS**FQFTK
SSLAR*FIAKRVWYFSDSHVSFLVRFCVS*RTNKAV*APTNLTCQMKMFI*DKILAECTE
NTPLGVSRHLIVNLSSISNYSRPN*SGGKSPLVILPFCPFSSSLKRQLGLTLNRLFA*YN
IIKVPSFVSSKKRQ*PSEKNVIVENYKVCGSAFYCSKSIAFMAFSIKIRVLTNSYGASCI
D*SRVTIFNSNGSARVSPVLFKIICLLRLITTTVNGNSEIYWGLSSNE*SCW*KYFYFYN
*QIF**RLVG*KLRRLFFR*VIPSLD*VRKCRYCVTFARKRFSCD*PFILVETSLKRDGD
GVLMSNYEVKFIFKPLHVDYFPAVVSIFEVLKVFWHIFFCGCGPEFPVRNKDMLKTK*HW
KLGHSLQCYT*TSQQEIEMIERMVQEMIH*HSSKFCNICKYYYQTLVEVTMLLPNFTGAR
KIKIT*RQRKVTSST*AGAQK*EIG*ET*FCYFK*FFAVSPTFLL*MFCRCGTESK*TVK
*TE*DSKKELINCSLKFFLS*MSSSYLKENEIFIQLKCRYYLLFHQMRHQSGSILVS*FF
IVRN*YVVL**NHAKLVFNFLQFGSNYALQHVLFFYSVIPSI**FAVEHACAY*KCCSGG
HFRDKNKFFSPLSELPLFFCT*LPFLGFFGVVTV*ICLIA*FHGVLHTTFPGHNIWFEVP
SKNSLSFSMCRIKSLSKNKRT*EVQKTLEVC*RKKYGNQYLYVTCLFCHDFTVQTTFLFK
IIALVRQNRWERC*TKR*QHWK*TTTKNTFERIFFRFSCEFVGF*WYEGKPNWTGNHHY*
SYVEPRHHTYINITILLST*TAFF*NK*PMFS*RRFQSYLTLFRHFLIYYDTYKIINS*L
*DYLIIFKISLLSVEIGPKIFTP*R*N*TKTAISVTNCKNSENGRNKNV*ND*TLVKQ*S
TNNWKRNSNKDGENYEEECHKKH*KQLTSHG*KKEVNKKAYQETGPKIRYEIQLFIL*S*
KISFMHSGQKK*YRNFIVQDLWAVVPNAHKFIITAC*CI**LV*RRRRSQFWPWK*HR*W
*RRF***LRK*FRARC*NAK*WRNRF**RGGRLGRGEDRPS*KRQRRLGR**R*IIRS*E
KTIFT*VIYILYFKATTRKHLSLLSQQIASPS*SSSSVSNIDFGGKAVLTWSANCICPFP
SFVGHLSMVIAPTFDFNNVKVPLLFLSGLLGNSWLASNRCCWSCCI*LCICLCGASSHLL
KSNSGGGDAGGDIRNIFSLSGTFKYCLVKFLCPSCKE*LKLKFSISKARDASITC*DIS*
LGQINSILLNLFKIINCSGSFSLI*NFLKIFLDSQTWILSTLSLSTMSHLSEVIIIVSVI
ILPICSSVFYISVGLLLDLFGPLFFMELLYLKRKPYFI*KSLGRRVLSTSRLGTTPDSNL
RQDSKIA*FKAS*TLQRLAAVW*TSKLCMLHVKRGLEHLRRDPFHIYYPSTLRLFVMMHL
IVWQMCYGTSI*CALRQIC*IISI*FVRVVN*EIM*TLYQEITIEG*FKKSDIKRYLKTQ
VA*YANCSVAIIEKRS*RFFSNRQSSPLFKVYCCTP*VFI*CVLTTSRRQ*ITAHQCNVE
AE*INSPKICEDHE*TPSVHRN*SRLCEVPKNVTITKVCLHKSLTKKQGKDIHNINYH*L
F*T*DRNTRMYY*PCLPFFNW*LQSEFSFIVTLIFLSSAAGKRDLPN*LTLIEL*LQ*LR
*YFS*TTTSSYFFLFLCSLPTFEFLLTYILY*LYPKVRRTTKMTSKTPNREILPDNVVPL
HYDLTVEPDFKTFKFEGSVKIELKINNPAIDTVTLNTVDTDIHSAKIGDVTSSEIISEEE
QQVTTFAFPKGTMSSFKGNAFLDIKFTGILNDNMAGFYRAKYEDKLTGETKYMATTQMEP
TDARRAFPCFDEPNLKASFAITLVSDPSLTHLSNMDVKNEYVKDGKKVTLFNTTPKMSTY
LVAFIVAELKYVESKNFRIPVRVYATPGNEKHGQFAADLTAKTLAFFEKTFGIQYPLPKM
DNVAVHEFSAGAMENWGLVTYRVVDLLLDKDNSTLDRIQRVAEVVQHELAHQWFGNLVTM
DWWEGLWLNEGFATWMSWYSCNEFQPEWKVWEQYVTDTLQHALSLDSLRSSHPIEVPVKK
ADEINQIFDAISYSKGASLLRMISKWLGEETFIKGVSQYLNKFKYGNAKTEDLWDALADA
SGKDVRSVMNIWTKKVGFPVISVSEDGNGKITFRQNRYLSTADVKPDEDKTIYPVFLALK
TKNGVDSSVVLSERSKTIELEDPTFFKVNSEQSGIYITSYTDERWAKLGQQADLLSVEDR
VGLVADVKTLSASGYTSTTNFLNLVSKWNNEKSFVVWDQIINSISSMKSTWLFEPKETQD
ALDNFTKQLISGMTHHLGWEFKSSDSFSTQRLKVTMFGAACAARDADVEKAALKMFTDYC
SGNKEAIPALIKPIVFNTVARVGGAENYEKVYKIYLDPISNDEKLAALRSLGRFKEPKLL
ERTLGYLFDGTVLNQDIYIPMQGMRAHQEGVEALWNWVKKNWDELVKRLPPGLSMLGSVV
TLGTSGFTSMQKIDEIKKFFATKSTKGFDQSLAQSLDTITSKAQWVNRDRDVVNKYLKEN
GYY*EKISFLAILPFYIVKYLYVTNTSSKLGLLIGLACSGCKHT*INKKVRLKILVFIYF
NPCTLEINLYITAYFVFEKISVFLRCGKNFRIG*IS*SISNLVSLYKRSLISITSNFIVT
PSNKAKIDIPKWYVSIQ*MQRNWTSE*NNTYR*VAKRKEYMWWKILHQERQEL*RKTFEI
FQAVATYSG*DSGWTYELTVHCRGI*NSDDGELHSQQLKLLLFFYSAPR*GEKRKFTNS*
IYFLFVYNRF*FKIYCTQLQLLKQESTN*RH*SKVQDRTS*TLSAQVV*TSLQFSHTPKL
QLPANPAQQFCAPQLVVRQSFLRVHLSEESNFITRQMKRNLLQKKSINKVIQLWNQQGRF
YHI*YTLSCHLYWLFRNAATNCTIYISYSRM*NIKVLNILILLLYFQLLTISYFLFTCCK
KSLP*KVDNFFITSKFEN**SSN*RESSNSL*DSIAFLAF*RSSFFNCLILSFSSLWNFL
TFKSPSPLICVLAAEAHKSPFLLFLASWYICLENDRETVHFSSSPDGAHKSIIT*PLRLT
GSLIILGQEFCVSSPSDPMSYLPFTFSFRNFLISFNVFSSLCDLSNIK*E*FKIS*SRPF
LLPVPFSLDAFP*EPSHEVARSLPFFNSILNLGRLMLF*KLQNFKSLPSL*V*KLGFPTC
KGHFL*CGQGAITFRK*LLEMFPNSASFLPLTVTPLDQGLGIFPNSSGKFSGLSVICLAL
AIISNPIGLPRSIITMWPPGARIFK*CSIFSST*IGN*FPS*RS*CVNIMRSYSLDAGIE
DRKLVIMFIFFVITSPICSSS*KFLFRLSVSCSFSVDTFSSTVSTTSLSCLLKMILALSC
ISAFPKITASFRSGL*FGPKISFKATIPVAGPYPTSRIL*GLKLSGPTLFCNSFRLWKIE
P*FCKKMDAICASTSILVLQGRCNEFGS*ISL**FVATLLRLLGICTAIILLLIALLTSG
FNSNWSRYDWP*SVLESNLSSLELVA*VVLAVSSLYDGRTLIPLLFESIKSAKSNFGKFK
LVNFELNRTFCGRILKHLFIILPKLDGPPYVLKCQRFCCNTVLNFSPFTFFI*WRKKIRD
MENKYEPSLNLKKMRRKEIVRL*VSVLIN*LLLYHCCLLA**HTGSECLVIHLLLPVYW*
*GQP*R**QCKRHPPRQGSSKKVINHLLSLQVLKILEKRACLRC*PQIQ*DQLLFLKNRY
QQRITMVPASR*WTSQAMSSCVINSQII*KQEPNLLKG*YLW*TQQLILRN*QQQLSSW*
TYYQLLNLVAKMVLIS*LHAIKANCSLQDHHQRSRML*KAKFKRLLKEGKNR*TRLKEKL
TKKIMQRIH*TFYSLPTGSNLQIWKHL*LLLRAVLIKEKFPNGANG*MKNCNIIIIYN*M
NDR*FKNKHLT*L*IPYAEKDIVASSTHAISKVTLFDCWCKKHSRWGSNP*SSD*KSDAL
PLRHAS*YLFDVPAVI*SNYAGK*LKISSLMYFYYSIIFSDLVIASSVFFLLYHNHCTRK
FCS*LLC*LSMVKGTTNED*IW*IGGLLATVHLICPRVGIKINYRHQLVVILPVYYLIWC
QMWT**HKV*ETVIEVRES*NTRINNVIG**NI*NGMRNNRDIIM*KYRFLFGDAYILEE
TLPVYSVYII*QPLSTLESQQLSQNSPTSHGAYSSCM*LPHQCSIMDF*LILSTIRTAHS
AFPFAIGALLLERIRGVYIKLRCKHQGYCYNMSCHH*LPLIPTYCP*RKLFMRAQNEPIQ
LIILLKLLPRQAEKRCRRIM*SCQTNVILTIYSYLI*NNKLYKSISLIYSVRKMEGKRNH
QIIHSSDLFLTLVGNSSGTSSGSFWVQVVRWLRWLQVFVQFEDQWNTSWDVQLSNVSIRD
TFQVLNQTSQGVTVSGDHDGLTTQQVLGNDILPVWQQSVNDQSQRFSFWQDIWVNVLVSF
ITLLREWRRSVDWGRWNIEGSSVGVEFFFTELLQSFSLVLTL*VTVMSFVQSPGSVDWNP
*SVSLFQSNVSSLDSSGQLGSVQDVWVDLLFLQQFTGSSGFLLTLGRQFNINPTGE*VLF
VPFGLTVSN*N*LWHYCNMCVCLDY*EE*LQKKLQRKVITTELRKDKKEEENQFIISSLL
YNKPK*RFGHTLKVENHPPWQQPQLVTIVHHDHETRCQLKFHLSGSLFLFFIVPLTFFHQ
LAGNGKWNPI*RASSFLQEKTKLVCGCAR*YLSTLRNIP*RLLRHHYGYIYIYIYIYIYM
*LSTIARASLHVLTEKFGEHFTDTVI*ICRLHCTSLSLKS*AGAFSCNCAACVATQHSVV
YPVFQGFIVRRFSLFFLLTNLKVIHCTTKCKHA*YSSCQSITLASYPLVAALFAVRQHVF
FTIG*EYLI*LTFLHHNTIQFLGDQAAHLGVRVSLLAYGIT*SFEFYHIGRQDHSTFGVA
FQHFFDFAILSY*EQSISINY*RDLALMFFKYISYDILNGF*H*GVPTQAGSNYHNVDSI
Q*GIDFLPLFVHINV*FGVTHTKVWMNH*VWGVRFNDRTSVVFADDMCQITAHQGCSIGA
EIRCPCIIFASSNNANSPTRLSLMKLWQ*RWYTSFLRQLYQFSMRQFC*HFQ*YGSDRIE
LVLLIKFHRRLYTYLHLYIYIY*ITLQDPSHRITSHHSLFCPLQRKGVVCGCVLLLTIIR
VHF*YASW*Q*VNELGSFAMTFSIPPRNAKLSPSL*RLYRIRNLLPLTIQTSKV*DQTSV
GTIARSVSPFEKRREIRALDWCLVERGTYIRMQFARNARLC*VLLPFPSILTF*SSQTNN
SITYIG*NNIPSQKHVFQIIQISLKSITDCSRYSCYSSCYRILFCKP*PTFLCLQ*I**S
VQR**QMDRLANI*NRGGIPRHQKVYF*AAYRRLRNGVGPSICSVC*ICHTKGIQCGETI
HSCE*SFPEGSLPAGRQAL*RW*NDLTFIWS*TK*HRFFQGSYYEMEVAT*SVQVNHLVR
CRYRYQPSVPISSSYS*KPKRQDQS*LAIWEQDSSGHFTKEGTGCVEGKVS*QVQCYLLC
*RQAR*PRL*W*N*FHLQRFYSGACSRSKGKHTFVCLRSPTIYERLLR*EEVT*GPR*ID
RYLEQFGLLQGPSFQILSMEESN*YFF*FRIVQISKYIKNIYIFMCMTKNSLKKAWL*AL
IPSAFVIEISLKS*I*R*ML*FVVLHLSEYLRCMQEWHNFPNQYPFLPLY*IETVLSN*R
Y*TVYCLGDSYFFDKLPNY**IQDPRTYGDSRPSTKHAMYPVLFPEFLTNVFLAGTCPTP
RTVSRRIWNHTHSLLGNS*YQTFRPRHWINPNLFHYCFFLSLKLTY*AVRGFFYYA*WRP
*T*HANGRSTTIEAANLLVVARSLGCLVFPL*YLAQKKA*ASTSA*YRHDKRLHWANRGS
A*YQYDA*S*KEEQYQKFLHDTDFLC*LSNCYFLGHSNLVVAY*NPTLSISRSMNLSLCL
*TI*R*SIPYKKCSLLHNHHVAEALNVSSIHDYRQ*K**GLGLQSHYCSMI*NHRVFDIL
VVWLLT*NPDHHEYFENLQE*LIDRWESSHGFVTLLYKFGLADHDSTLVQQFAI*S*AK*
*MSAHLNF*LHIYVRHMTFSCSFFVRARKTHIWLMRKKIGELRKCLDKKLKVINK*INK*
INSKLINN*INRVCIRRNFM*MYINRYIYKLVSQW*KSANAQKKCN*RRV*YSFP*NTMR
FKLVGSYSWRYGRTFLFVQSVIDNPSVFQSHWGSDVLLPG*CMLHPMFVISIWIILSCMS
TTGFLSISSGNSCLGGTG**VL*LQSFNQVRIPDH*SIGRLHIIKGLLYCSNVPNTFI*R
*LCSKDGNILLHSLFHIHSNFCRRS*TISIS*FIQVCDGFFTQIRR*WFVWQPRL*SVSN
RMGNSTTKDNKIQQGIGT*SIGTMDRNTSGFTTSH*TGNNLVFASFFING*CLTIPLRGN
TTHVIVDGRNNGNRFLGDVYTSKNGCCFRDTWQSFL*NFRR*MAQL*VHVVLFLTNTSAF
SDLHGDCSGNDISTS*ILGRRSVTFHESFTFRINQKTTFTTSTFSD*ATRPIYT*RMELN
KL*ILQGETSTRNHGITVTRTCVSRGTREVCSTIATSGNNGLVCSESVDGTVFLIISDDT
NDLAIMGQQIEGKVLNKEMCVMS*SLAIKRV*KSMSCPVCDSACSIGLSTLTVLLGLTTK
GSLVDLTVFSS*KRNTIVFQFNDRFGRFPGHVMDGVLVT*PIRSFHSIVHMPFPVILVHI
SQSGIDTTLSSNSVGSGGEKLGYTSSLVARLGKTKGRSKAGTTGTDYHTVILVIYYVVLP
VCRSGRGTVYRALRLAHQS*RCKCSCVSEQSQLGER*FF*R*HLYSRSSSYYEIGFFSFF
LSFFLSSIRGWGGD**KEYRKCKVYYWLVIMCLLVY*CYLSFKPPRRGKRLESRMPEYIT
GLSKQTTNRRGPDPLVQRLLGAAFCAVIGPPPPSKP*LHNDFPASLVPGNRG*SSPPLLL
GATFSTERYILDYCMSKSLYRRHYY*R*SER**KGWLPGRAFFSYYHLCS*GYEIRRIDG
Q**KSGKQSLLRSV*GIASRI*MEKRFQVALEERRATTTKKITTEAVQESRMRLAHL*RT
ATVAIATVIVEVEAEVENLVELQVVC*KSRRCL*TMKRCMLAYPTRRTLPVTMARLK*A*
ITLSHMW*MPWHAT**ETRVTAYNCKAETLQEICISGQTTILHHHRSISTQVNLHFPPQY
LHKRPHSRIVKGL*AFLPLL*HLPLTLTTTRRRMGIL*RQ*AWRPHR*RTKKSGLLVDSE
DLL*YRSAGNITLMRPYRIFSPGTLLNF*PCMATSLVKIYRKKRRRRKKLKRSQRRKLWK
RKAPS*FLVNTGAILTNHLR*RRCCSC*SHLLGQVCFSYQRLSITVVGDLAPFVYSRVPS
FLMDVSYH*LPPRTK*A*MGTVTWVVYYMGPK*NLPFFRLSPCHKSGFLLHTLFSLQLIC
RSFLKISSI*NRAASV*PPISLHKYSSLSHYL*QET*PS*VGPR**QIYLFYWDWFMFTF
TPFIILLLMVSHPIQCLCSIKRTGRCSSVPPYSPLKV*AYLSPFRSQ*NTRSISGHRCPR
*CVSWQ*FSYHVVSYAMPLLDLT*KLLFY*IFRRTLPILSLFNYCMH*PFCYPRRCSYFP
RYVFWKTGLFPQMHLVNTTRKSNG*KTISVALLSS*HLSSLG*APTIWTNLYHW*APSRV
SH*STYTRHCCTIRRPSYLEPREPGFF*I*SS*YLELLSWPTRHGRRLKCGASNPPFLTE
YIMYRHIYIYLYMTRYLYASGTHIPCFNYD*HKCTILVNLVWLSLPGREEKV**IGLPNF
ATRKLN*HAAYYTKNWVYTVFSKEMRIQSNIQLRYFFEPS**IKEVRNYTECHQKKTGKN
TRHLWKTMIKNLMMTRSYP*QKVTFKS*NHTVQLHTQPN*SKLRMT*KTLKRESKKRPV*
KKAIQG*HPPIYGILWVIGRDWAKNIPYKSLVARRSLRGMVKVTKLRQIIITAAIAIVIA
INSLLMQTKTMKMPST**ILSKLPNLSSD*VNVFLQQI*KKVCV*VSIGRNIILNFHCLQ
GLTHQLL**PLKKSLTLLIAMSVAVKTKLKS*EKLSSCPYYLQKDLLLLVLIHQRVSYYM
GHLVLVRHYVLVLLLIELMQLLLGSLGLS*CKNMSVKVLVWLENYLKWLVPKRLALYSSM
KSTLLVVLVLMMVLVVIMKFKELC*N*LHS*TGLTLVVTLK*CLPPIGPTL*IQLY*DPV
ELIVR*SFHYLTWKVVQISSVFTLNQ*VWNVASDGNLSPDCVQTLPVQN*DLFAQKPVCL
PLEQEERWLLKRIS*RLLIKLLADTRSLVPHRVICNIIDVNVLFYYIL*EGLIKTTSTTT
TIEIKRIREYPLK*RKN*RI*C*RKFTFIIYYYPHYYCYYYY*MFY*SQWRPYLSFPPTN
ESHAISLTTT**GICWRFFVLRSFFILTLNLIL*LSSFLQFSFFG*FWLHINKNFSFDSE
SNFFIYIEI*FRLFIHGPNPCTFFRGIIAPFE*HILWDKNVIKYT*Q*NFYAFCCTFRNP
SSYYLT*KRFENNGSKCNVNIG*SIAWLQLAFLDG**VVNRNT*TDIGNNLVGELII*LM
CDCRYCIAMELIGRDSYQVSDF*KDKHITLFNEFSNLNSTTECLYTTR*FLPNNASCVYF
CTWLEYSLL*YEIN*SV*RD*KFVK*KF*AMSIA*IL*ASKSGFLPNPTSNQYSISKTLR
GI*KARRCRRNLALKTPKGTWWYTDPMMILHFMIQMPLRTFWFLSPIQIKLLQKQIFEKK
T*VQQNQRVGGLMWEKQLYMVLILMILNTIILNI*SQ*VSTLKTPSL*HPKAMNRRSKKK
TLKIYSSNLSIDVMKLRRMTRYLCFKEGWQSQNIYYTNKIPPMKLEVSNLI*ILH*ERCL
KL*KMKHMLLMMMLWLKTSAKRHNFKAITMEKKKRKMTFSHNY*GAVKQKMKTNSRMSLM
SGILIM*KILKMKTTLRKWRNLITSKTWRTWKISIIKLMFEDFKKITLY*KSITRMMNFL
MQV*TV*IPLKRKMCWANCPLSKTKARRGRRKERAVKKRVPCQMYLDFP*VQVPLRVQRR
*QYWMISTIKSSMVTKIMRKN*KRTKNKITNHLTCQQKDLILSQCLMTFWTITNWRVVAV
NWLRKIKKLKG*RKLLMK*AKVNCLREEIVKGKRKRNLRRSPIH*AA*NFRGVE*DEKAP
TLQVLCRHVYLA*NALMLKYILPTG**L*NAAVLFVDFGERGWRKEVDFHYSNIVLV*RK
PACIASKSRSN**PFEISCLTTRIPQIKYILRKEVNTHK*IAGRKCLTKLNYCRSKSLNY
KT**RSKV*LSLRQESVCWNCS*INKSTT*LILIRNSLNLSRRNQDPLLNSMPLILPQMK
I*WN*SKNYRVS*ISSRKGLSEDLLTL*KKMMMTL*RHCLMQMVIFLLFQTECSLSR*KN
LKTSQT*NW*DLLNSTKDCHQL*RNKKILKTSWKVRWKPFTLMRPLMKRFLRSWKSSPKM
S*MMHLMMLPAI*VSPLEEEPKYGKQKMKKNEKSMNKRA*VPGSRNFPHLYIYIYLYTYS
FEYIITGFSFNETYVFRGIAVKGCSSGEKEKKRIQSFPPISIPILFICD*KLYTNSLLYI
TLYTIQ*S*ASSNF*PGPF*LAAVARSVFRSKRLVLV*MCTGIMISRSPHRNLRTNQKLP
ITSSKNNKRCLQ*WSS*D*ISRLYY*NPPPFQEQLP*APRGGCFLIQLEQTSFLPHH*RM
WPVK*TPKRQLLKNKY*TSKEQRDLFLHI*PFTSHN*LGTCLLFTVFRWCLWD*VSTCLL
YSSESLVY*VLD*LPKRFLIGTIRSFPRLPNGPSRVPLLTYLQFTMVAPLDT*SGIPLRN
*H*KAFTELVTLSLVSPPFSVLIY*LYDSLRRRTCFYTQIYI*PILYIRSYI*PNTALIY
SLRSL*PKMPINTNLYLLGAHFLFFCLSVKYNRENKGTNKRKNRKR*RKSNHIQQNISDF
LQISR*FLSGYLLKLLFVTGKKKQT*AVIFLLYKVNTRRIIFEE*LGVQRY*GTRKEERK
QFEQNFIILALF*KTVFWQNVLPLFRQIIDNRLHYSRLGIHRKHYFISP*TYTTTND*PF
RMANKFLNVLR*QYHRRKVKVSSNYP*NVCNF*YICRGSFGKN*RQLYLDTA*NPTDF*K
QI*Q*SGILTSRSFDVF*CLVLQY*KT*KLTVCIA*FRLRRLDGK**R**IFNCPLEQTT
KIEQVLGFFYRRICVL*HSKLN*IHLRYNKSGQGHLHRILSRLCSNVCCIFVE*KIESKS
LPFYSHSTRYDSKGVAQQNCRYLGQIIARLYVSFLW*ENCVTFSCHLAKNFTSNTFQFVY
RYRKQDTVQLEVV*HSTETKDCFLRKTLFNDQCKIHCSLVPNIKISEISNV*RV**HAKF
LN*ALPNC*FSY*NKYQDSHSFNLWWHRFFS*Y*CDEKKSTLQLRL*C*S*QL*TPGFDL
GQRCRYLGHC*SLEVY*IF*PW*CFSED*PVTTISKSG*GITKHDMEDNSSNAWSQL*NS
LGRPFSVVCTS**SG*GPQC*QFKVLKTSVFY*CHRRGQRK*APG*YRRSNP*GAAKTVK
CLSGIIQRFTTTRCQLFDNCAGCSK*RMKRMREKPY*TIFCLG**Y*R*SKNR*TKERIY
VRFIHNKWIS*EVLNILMLVDTGN**SN*LPFSIILIWLKKVT*SSIFFVFFFH*WKRKT
ST**GNFTY*LPMRC*KMDGSDSKIHLEKKRRSYQCIYSLCILAFFGLFLFH*YF*KTYL
*IKLILALFFALE*HRDHTA*IIW*QCPTIMAILIQRVIAEIIRDPCSERGRQILSP*RD
HRHQREYGLIVVTSRIWTIYLLIG*IQMTNQATRKVVVTIIYLAITIHPFKQVPDIKVQD
TTIIIRRMKIGLKA*KGMKQRLNSCLICQRGPNLLRNQDIIIHPILVMI*KMAIMLQNTI
TTKARKGGLS*LRKFQFRF*RSKGARQFT*G*CKSEKEHMVKFTRQKTRIQRS**R*KN*
DYKERGKAFP*PLYERLNYYKVLIIQMSLL*KK*WSNLKKLYI*YLNMLTTT*VDYY*IR
KSKFLTHNANISSNNCY*EWNIYMIIRFYTVMLKAQTS*SITRGI*K*QILD*RGK*IRE
LITLTVSLRCGTDHQNYCWELQIMEQKLTCGVVAASWWNYSIKLQFSRALMN*SK*NQFS
RLWELLQ*IAGQRFTICRGFL*LCHSKLPSMSTIFLRNLKAFYHLQNVCNWRLICYVMIR
RKGLVQPKLYKATISRKNQSLNL*FLMDW*VATNMKSNWQENKSVLTYYPPTQTIRVMVI
VIIIIIIIMTMMINKDI*PIEISRHKK*INNLFITRYP*I*YEHLISCEAA**IEGLPIF
TRSLYVTWLSFYASCLSIVPTPSHFTSYKLAWPLTVLPLMPYCVFPSICSI**M*LPINQ
LPCTLPNWPTKFSLHCFDMISSCFVVSCKFV*SSLSSCAS*LYCLCLLAFILLPEILCVL
FVLKFKCSDMFYFAIYLVDLSSHLYKKITLISMGMI*YEQYKTSKPS*ECYFQTWIYKQV
IQ*LNYIQMKFLYQ*NDLLRIIQKNFGAFLMEIFVHLGTL*IPFL*PTAFLSKVQYLSLE
DI*FSFGKTDGLFNNLNDLLLGLYFFLLSMAS**VRPLS*HLWTWRPKVNCFMT*STFLN
LSL*RVF*CVDILHGIFHSRPPATGLVNLNGPNIGVL*LG*PFKYVSFLQSTDIFFPSLA
SLCPFVIPFS*TF*MLLYFSDYKVENGVPCIYTYDSLGRFNHN*SQRYKSRISSSYLEQL
SYI**DGAKQRSADDLET*F*ATYMGAKSSRRTTGSQELEDGNIQKMCKFCSSNGRLC*G
KWNESFSHL**ATR*NEIVPPVLSNR*EIFRW*KG*NCFRKNQQA*KVMSKTKLYKISCV
D*CF*FTSFKDFLIYPFLYINYIHTAQQ*KGKINTKGIYVWYNT*VHYNGRL*SE*IEEI
L*HYIAARNIGIVFTTRRYTV*VAT*FQLLQPLYSLGIICIYLCGILRWSEIK*IIQIA*
SC*SIQHSCICICYIISFIKIQ*HIIVSLARNFIFCHAF*FLYMFSFNYILNILFAFSPI
*VGLEINGTYSTQFH**FL*HFW*KLLQCIGDHWKFILT*IINQTFIIWHRKASPIHHSH
ISHI*FMCLLCGQF*DAL*HTTR*SSM*SDYCH**RHLC*SFLLNKVLYKNIDF*LQI*E
IVGMLS*QPDIVALRNI*L**HLWI*PSIKYCTNLFGHLIVSGAMS**IT**YTAVVFYC
VLSF*QF*ENIQDFTDE*FLCIFNTQLGQSLNSS*NKLRFIFHCVFL*FCQQQSTLFQVG
RID*SYKDIDLL*LDVKRIVELDIKYSQFFG*QLWIFLQYDPNIFQSNILHFRRRRHQ*Y
KSR**SFHYQTVRGIFNLRQVPYDYLYCS*NNGWINVL*MRSYSINDILCL*RIFCRIFR
KSS*YDNSSPFRTFVQS**EL*NVGLDQT*KINGIHIHIVNFN*CCCCVCND*RI*VI*G
IDQIFDDTQLNA*ILV*LEKFCDTYHCGFSNICIIIMQGTAEWCFNVFQDFVNSYH*HRS
DCHAAN*GIWILCISNECVNGKNT*FGMRLSIIHHIKINQFFLFNVNCGNVFQDVWEQRR
DIFSQRHLLDRFLYCIFPSLWVLRY*SSS*FT*FTLTGYFWRNSNGVF*KLLDSFIQWWH
S*NCFLSAVGS*AKKKTKLQEVSSYPDNWCIMTIKLQQITLSHWESVLYIVGFLH*KELF
LILLQDLKLIISFCTRKQ*M*Q*DMKYIKE*Q*LCSVCKALINICMFVFQAI*SMVFRPF
*IMGLSIYKIMQFFFLGEKNSSAMNKRRWQIMASIKHLLCSLRLVRLCYKFHRIATAFL*
HGAF*NISDTFPRVF*PSPF**MLFKFITIFSTVRIILEKGVPDFRSYRPIK*VAVISCP
VSK*MAESSTPITLIVH*DL*TSF*CLIVFHNVKVINIRNDFFIMK*LIQHSHLCLRVCF
TILKEVSAFHEAL*HISLNCFSSPVMFANLCQNSYILSEVLHQDTW*LYKISSTSCTTYV
LHMSSP*H*VHCMSHFMEERFNFTKLQKTKTFFRSD*YWRKITHQRNNR*LKVGTVWILT
DLDG*EISFTGIYLPRATNCEMSRI*SLAISFE*ITINYADDSFLFRYHIQSSHVWGPCF
SLISNCWL*SNTIYLLKQI*QALNDIS*CKIIAYFFGIGRV*RVELEIFASIVIPIPWSH
ELQYFVRVCSQRLLKIFGLEFSYKFQFICCLLYSIVH*RQNKILNIFRILCHFTFQLILC
VTCFVH*ISQDCP*FD*VTQSFNLFVRTTVKSGPQLFSYHLIFTTF**CISCIPKCRYFI
ILPFYIFI*LLQ*KCTHFTIIQIFTWYLHRI*TRIVCMVDEFLTY*TDFLR*LDKLFSNI
WIHIDS*LFKIIQ*YFTNFKFFCA*LRRHFWIV*NRL*YVT*GNISVQDIHEFKHLFMAI
LCCPNKCIIWMC*PNKLAQINNST*RIA*SVQVHNIG*FTTLAKIIPHFVEKFLCLLQRN
LAKLTQTIWRSQIRVLEKSGFIFFKKIL*DLAIISILTINISPI*IVVENLLNASWTGPR
DCAGCGEEPE*LILAGR*RYGGIGPGFQYYRAKHY*YYFRRLHLMF*YLFPYTFSLCK*I
HHLF*F*RYICIFLTFVHEAVT*NSPYPMRNRHLSAFQHIDENLEEYIYKCKIYIGVPST
FLSSR*ASSMSSLNLIISEIRIAFLSSFLDALKRPLCKFITPIP**ARDNALSIL*SISL
SIATFGY*FSLAKLIILL*QSAEYCKQEFWFSCNLDRISSKGSDFLYGSLSIAYRLPSNF
SEFR*KIDPSSAWASKMSSRGLSASNIHSSVVILLFKAPERLLRLRQ*RVYKSLAVRSSF
MKTHCSLSGSFIFNSCFLLEFKCIW*SGLDLPINGRPLKFFQSSCWLFKSSDLERTFLNS
GEFSKNSR*ANKRCIINNVALVSESLFISLNLTKI*RSLFNKKNFLFVDLSVVLLSSL*N
FFSMSPYKAVASLYICNFSYISPILISIPVYSSESRSTFSALHSSKASR*YSRLFW*FAP
SFLISECNPFLNILATGLGKV*CGQ*THHMLKAMKLTMPVDNTHFCNLLLLLNGILQKLC
SFNVE*NLKR*LVNKLRLVSRSTVPSFLTDL*RYFHILNEHKFLHYNIFIMLFLRSHFVP
FYIS*RI*FNFRNFRAAEYPQIVLCLVCITSQGLFNGICYENQITHKSPQSFSHQDKYER
INL*GNCFIYIRYKVSKCGRKNFISNESLITLEKLECNAIV*SKSKVTCRYKRRKI*YIP
GCPWQTGPLSISVIAL*DMIIYLKTILASDSCVSAIALCRYTVIHIR*QEQSSLTHLFQG
RSRHFEDPAAC*HFSYTGF**MREDSPVLGIGSTAFQPLTQI*SQ*HNLVDVLADQVRET
PFSQLL*Q*QMLMAYHRTWSLNGRLNFELPSHYLRCLIVMRFSFH**IHNSNPSDVNFLA
NPQILNLGIVDPLKYKPFFPCSKSLKPLSQLSN*IFDILLHCMAGELQECPMCLCVHCNP
*EKGR*FLMDIQHHGTVSLSYFVQIRH*NRLIEKLLYLWNFQ*FETKTCIKKLHR*CPR*
*WRNRLYFDQQLYFQGPVFQLNQFLLCTIGNFS*RSIRELRLLAVRGCCTVISKNYLLL*
VPSRS*NTLSRKWLHY*C*YPLLWRLARKM*YTYQSRPFAAVAPDAAIWMSKI*ILSPYH
LFPLYVGLTNYLGDFPRAPTNGLFEVKFAFRLYHPSASYVICCRPNEQYYSISKSSGNWS
T*LKFH*DKNINLKNHY*PKLGSLPHQRRLHFRL*FLIFFFLGTPAILLCIPIVSKSEKK
TARFEMLKMSTPE*EPIISVLKAYFLCYVMRLFMYIYMFY*LVVLICSF*AKN*RPQFFN
LPNLSCHLVATTSNSSSKALSLPSKMECHAADKV*NSSSELTGRISCKKILSVSPIFVPS
SSAHLMAN*TTSKSSRLLPIRKDSIIH*ENFTK*L*VSSMANMDSAVSVRSSFKVLDKIS
FCNDCVR**FSKSNVSTHLTNIEAIGKITLSNESASGSNSFLPSLINSDAL*LNTQSL*N
LNFLTNLIKVVLSNRSVATLRK*LMNLFST*I*DERYRESKASICSTNSQVPGVTLISLS
LLIFKCLVLCKRKIKEGLLCFLFF*EKCLE*SEDFTVKSLKLVLNDVLH*SGSFSKRENT
NKK*KKKKKRDFNFLREYV*KYM*CTFGMLRGMHEEPFYKRLNIYIFMLITSHHHHRHRH
YHHRQHFPPAFCLLLLPMQKLNRR*TSPPDYSDYH*WVQLLHFQTVHLLVHLKWYCRFGL
ISDL*RHSLPLSLQQAPYFLCLYKESYKQ*EPNLLCFHREALLKTNH*VHLCL*IQYRPF
LMATPKMIRNLESRMQLRISDPLVGPWGEGVVVLVCLQLQLQLSPLTVLYFFQPLLKVAS
IPGFAWRMRICGLRRLSLLRLFPSMRVLSCVSSLLLQQGLQMTLLVRSYPV*DCMLPVQR
*LPKITDSQVFAKGEVAFLQHPYDFYGYVYAYE*ICVYSFCF**VSRSTHLDS*VFYSIW
S*QGVHDARILYLTCRCHRISVLNRLSLSGQCATCLVVCDTQSWDQLLSLSFHLIFSNVS
LIPS*KAC**VDRIVYY*QG*RPSNRLGGLLSSLV*FYRHQFYNLVYIS*HSVPVFVQ*Y
KMSFLLR*TLFSIFELICQI*SAGIPPLSKKQLYP*FLPVF*CTILSF*THCRISNHP*K
PCIQVKTWIFSLFYPLKVWFHNHEA*RTCFHPFSL**YAEFLSQHQYAFEETFSMLSGF*
QPCCTSIYHACLLEQIEILEF**IRLSLQVEILFLVSWHLLK*A*LPQGCPHPKCNHQHM
NNLEIVNKIFRRIFRKFVCKRNRLS*YEHFLANPNILLDVALGDHHNHLVI*FD*A*LF*
YRKAQLLTKFPPVHLHF**FCHLLLEAVSLNLCQHHQEKLWKGMYLSLFQLIQLGPFEVG
LYFYR*YH*CHR*HLQRNV**QICWPLIRSMDLN*IS*VVEQTPGQRHWSLHEQLQ*SHS
LQQECPVDFSPRLNHRQLYCQSI*WGSI*FFLFHKFLAQPSKSIG*KSVVTFH*HN*YIF
AQKSCVQKFRSRKCLESQLIYQHQEMPAKIR*PYRQSSRINYYKLP*QGRLSPQLLGLGS
KVHDKLSLSSFHDWFA*FFPLNILPVTKHQPATNKRQNQSLRYLLPEHCPLHFL*RKCYQ
STELPPAS*KFGLVLPGLNQWFS*PLTCLRNLLRHQLYLQ*YSQPQQCKYIAQAFAHRTS
VYMYQMLP**IGKKYESFFRS*FDQQLFVSLANNL*YYLRKVQIVS*I*FLDTSRALKNC
CSAEF*HNRMTREVD**QEPYL*SSQSILNGY*MQLQYIA*YVWLLLSYRHQTHQK**HT
DFHCMI*DCST*IPQ*QTRVVELQVYFFLYMTLKRHLYIFPNRGTDLH*LTHGQYRYK*F
HS*IFFSNFH**IHQIFLTKVSNQKYLLLSFYLHQM*PF*FLQISSWAP*RPFCVLPFL*
QPLTVISISLYFF*FKCDQQINVL*LDCC*FARGQLNRDCFNPL**ITLYLLVTANGFLF
R*SSSRGLLYKCKSISLPLVRKAMELASCYYIIVVQDRRSACRVIRGGY*SLF*CTGYIF
LYESI*RGLITSKPIFSVASISIV*KREWT*R*KLYKNKKGTKNPLHSYNFTYAFFILYS
NVCSHLA*ESDDQSERFNHFSKCLTHYLKRKGFIPSTLLYL*KII*ITHIFESPEWALWE
NSEPAAIGRVDWYFHDDSDDFTCVQVINWRML*VSQDTLNDT*VTSKRDEFFFA*QLIK*
FK*SIQCTFVHFSTRFSMIRKPQFIIFWVIWYILPMYSVARFRAEILVFVNCH*VSHSFV
TSVRAQRLP*TFYNACRNFSSGR*FLRLR*HWCPRLNECFETSSHWRTEKHMR*HT*LLC
HW*QDIRSCSSNLIFTQRCQFRVKPLSMFIARKQRPIGVPFLHTVPQYGSIVVTLTMPS*
NQQLIVAIFGISRDSMIQFLPILMVNQF*VIIFRGV*SLKTLTWICSKISWDCSE*HC*I
TVGDFTQQSLGKKSLNNIQISRGFFFANDTFYFFQY*LAPEKLT*LAHACWVISESARN*
DYKYLFKRCTTTQ*KIISVNFNRFHLKTLSLFLIFTDFFAAQV*PAKYEPLLFGIRVWY*
SIVGTKD**YYLCFQNIIVRERPNCHRVYRKLISKD*PCKPSNE*KDINEGRNGSSIK*N
CPFPLVKLSKTRQKNF*VIYCT*CYCPHVN*IETFSEHYR*TINEIL**LF*SHLTKSII
VKYKIQ*ISSQKNLPYMIWRNR*I*G**LL**AYYRESIIDF*RSYQSVVLRARVIPECL
DNPNINSLREVTSCQNSLSD*FTECYLSYILYKI*IILSGGSAESRI*TNCSGIYTLGSS
AREGRVLSHVVRFVIRLFHMCFMNVQGDVLSY*HISF*DTTQSRLKALLAQSVARMTLNH
KVRGSSPLQGFLFKTGC*SRHRSNTSGSFSREQQCPQFYLQFYTIDVEIFLSRI*PSRGS
LSSPDKCQMYDVTTIVSRWFQSVMRNKGIQYRQCYTCK*KNDVLKSAFSLFEILSFFTWY
FAFILRMQEKEKGASHRFWSTYKHSLSHPLSVQ*CKNR*LTTQLNSKCHF**ILYQQLLI
RTKNRVLQVYVRRPRFSWMSLIILRTSFKQQCNLSLMAQREPL*LLEEMVVSTTMLS*TR
LPQ*VLQTVSES*SLVKAVYFQHQLLLI*LEHTRKSVPVVVSY*LPHTTQAVQRMI*VSS
IIYLMVGQLQRVSLTLSGKRLKN*LTIKL*RTSPS*I*TSLVKTKNMAHC*WT*LILPKH
TFNF*RKFLILT*LKAS*RNSAKTKGGSCCLTP*MVLQDHMVRLYLLMNLVYRQRKFFKI
GTLYLISAVYIPIRI*PMHELLLTGLTAKKLPLEQPPMVMVIGI*FTVMALLSFRQVILL
PLLPNMHPKFHTSPNKVFMAWHVHFLHPQPLIVLQQKRD*DVTKFQPAGNSSVPYLMLKS
YQSVVKNPSVQVPIISEKRTVYGPLLLG*ISWLSTIGVTLKRKLRSKLFRTNFGTSMAVL
SSQDTITNISNASRPKKL*LF*VNLYQGQTFVAPTSQLMSL*PLSIVVIFRIEI*MAPSL
KIKAFS*SFRMGLNLF*GYPAQAVLVQQ*DYT*KSILIKRRTMAKQLTSS*NPSSTPL*N
S*DLKKF*EQTNQQSAHRIIGLEQALIFQRCFN*S*FICRGYM*YIYFLLIDLSISFIIQ
HCFCFSLLATFFAAEPRYRKTRSKHAPIGRLKKCLSRTSQR*STLSSYQQQLSYFSLPYF
LELVCLCLVKFQSLYIL*YRLLYNFFVYSGKLTLQSSSHINKH*YSS*KCILGSQSLSLE
NLKKKKKPNIVGFFTPLKRKNSRIIKQLRGNMMLQLLVHL*TGRAR*IHQIHQWSRFVFH
TMHPHRPLLYEIQMVVIQKTRTHLKI*MKQQILVLQGHPMMPPQVQE**LSKYIMVMTLF
YLFRLPQASKY*INYWPRVFHRHIRRLVKK*ML*LHNCPVFK*RTKVQLMKI*SLASQQQ
SSSHLLSCYQGLRP*IPYYISPLNLIIQLQLLKQSMVRSLNLVSIRYLPLM*QGNYLI*R
LMYLQEFRPFFCPRRHGNRRWVCKTRSYRPFLIK*IPIKIYI*ILSICPST*VLTLQLVL
DYIITTGSHWIMAWVRSILVLIINLPEINLCPSMISIF*KLSVRVRLVK*CKSERKIHKK
YTL*RQSENHTLSLNPKSRILWQKEPF*HVLIVHLLYL*SFLSNHRKNYTLF*RLSMVVS
CFIIYKRKEGLIYHVPDFIPQNCYVR*TTCIN*MLSIVI*NQRIFYWIIKATLPFVISGY
AN*I*RMMIRQILFVGPQNTWHQNYC*V*AIQRQ*IGGHWESCYTRCSQVFLLIMMKMFQ
KCIRRFYRSH*FSQMDLIEMQRIY*LDY*AVIRQEDWATMVPTKFGTILFSANYHGSAC*
*RVIFHHINQLLVIPWILVISMRNSLGRSQLIVW*MNT*VKVFKSNLVAGHTLEMNS*VA
QWCKVEALDRLSEYIIN*FTHDILYIKRKVFFSVTYCVQDEATVPMAQFKF*DLYFERGQ
YFTHVWLVSHGHSVLPQLILIR*RISSLTLPRSVSMGRQKIKKKKGVENFLLV*KIF**A
SLVCSSFSF*KYKGCFNQRSTLN*PKTPLLKFLP*PRTDTLSGKEITFVQDNS*QDDGF*
EYK*TTTPGLCSSYRSKKKEGPVFR*YWPGNPSTRGDKR*SVFSGHV*QVREICPR*SG*
E*FNPDRHNCQSSSASEQES*KN***ESQYSFGYLI**YQQDRILQGNFPHTIYHKL*EV
VGIASTHSK*IYIFHQNPLLEYTQMVARRFDDTGILFYFTNQTDSVSS*YA*IFLKDDSL
LDGIHRYIFGQIFPK*K*YSEKVG*LHFKFAEIERLLL*ARIPNLVLTDRKDYFD*CRVT
K*IR*IR**CR*R*SRGS*SRG*RRFR**FRRR***KLWEQ**RVKVWSSRR*SK***RY
GHH*RYGRY*RI*CGVDAGNQRTFHQIGLYLNFGKHACGRASDAGEFRKR*RRRSLQHSN
NII*NACSTHVLYQVDSIYHVPCFTTTIRTNGFIFSDTDRYFVCRQRSSREEN*VITIFG
VVHCEGQETIQNSNYFRCKLFNVLVE*IRYRKRRRS*STWRYGKV*TFLCSISSTLLHFL
FQT*HLQRYRW*LGV*TGQILSKNGHFKI*PIKVL**KCHVDVCSYCPTRKRRVLFQHN*
K*QQ*KIEGNHRQS**RQEGKFRTSKYHIVFLVFSHSTTIY*LTELLPI*SFVSEKL*NF
NEGILHRVE*SKRGI*K*WVG*LRSFFIGIFETCPSQTNDTL*SPH**LK*GYIA*MHLT
HFLDF*IL*KLSIFIFHSVLFTIFCILERLFVLVTYYVRALHSQVYLLKSFCGEGFLSQN
LSYPNSLYLDYLAHIYIQ*SQ*WVLLIEINRTSSNSSFFIYFICN*EEEKNLKVYKSNVC
HF**GFG*FFW*SRESES*LQSR*P*HGTNSPYGFRFCSN*FGFLNKSFYYVCNINAHLG
SNSGICHLLW***IRIRRRERLRYTNFRNSALFVW*KT*WHLVGFEFCIPWRV***DRSS
GKRT*RITKDVSVRG*VVYKSERVSNDEPANGEGLWHVFGQ*RPAVY*GSWHSKLFFATK
H***YRRIWKLSTQFYCPG*TRYSIFKVQ*ELIHCNELSPTSQ*EGRSVFRS*NFQTYSK
VQ*YIQYRFDYCTISLFQGTGHGQILHCIRIHR*TEDK*PLHCQHIITKIGRR*HGRIRL
QI*NRYNLHYT*WEKINGCNTKYWH*SFHWNWRV*CRIYKNIYEGWSIGRPG*C*LP*SS
L*RQRY*SRQRSSKSSRST**K**NDVR*G*ITC*FGPSWVRLYRSQCEKICVWECLWPN
WNSSCV*WNRDQEGYYFTERRRIATKIC*H**FLW*YEGKRRVIL*DNGAN**APVVCWD
V*KNLF*L*QRK*CLPRQS*NRR*QHR*QC**QR*ERWLQ*KFAIIGR*WQ*KTGKFKYP
P*SIRWSYQ*EP*K*IY*KTSKKQRQIF*KEEQIEKIRDIMNLVFFTIYAYTIYTFLLAF
FSSIR*FRWVYI*IYIYSILFHIQSPSIHEIFNAFFCPCFYFFSFLKLQSYHCYFAQH*L
FASVL*QFS*PQDRSFRHLC*QLRWLNQQCLGCSYLLFFYSILLFCYFSSSTVLFFQFYL
EL*IRLVGLMH*VILKHLYSY***IYSSRINASYEF*RTLWCLSSVLVVYTIWRRAFEMD
SPQKGEHCS*CSCQWVSQTCFPVQLGLLICSRREALLFGSIEDSTIETFSIVLAKIVSS*
LFKSGAAYPAFCHK*KVTQIAELLSLLLTLIICICAHPVPFTSMQTYLFQLDELRLSLAS
VVMTNSLH*ENTGVRKLFYRIASTSIKA*LSSIQRSKHDVCK**MFRRHLMLIMVYGK*L
VKGRGNRQSITSGVSDGSALLYFLPYTGKEMKVLIIPHTLCFSCVVYDQSF*FNHSITKY
LKRCNCRKKNSQLFTILKQSLR*YAPYWCDDSCESIFGFV*VPSFLYLA*PPIRNEKSVL
MYR**FKMRKRVFIKRVFASSRKKF*KQLTGNLQAYTDFSKRLPLF*EGADLNKIFILTV
RQKQGKFTSASRRRRQLHYYSVPF*SLPT*NYYLCSRSL*NVQVENKHFKL**NPELQRG
*SQCNPCKSQRKEPNETFEHTRRQEPTFLYCRFKKKLF*I*WRLLCRYNSCSIKVH**YR
LRHEAEKNTSQKLSGFKWVQ*TQ*E*PMVFRPIR*EIFRKLSRRTHIY*NI*KKGRIRTV
**NVLSSRVENSRRLQIYNLPGRTCSC*FRAIQEFNMLLYVQS*W*VYGYWL*RWLFASL
ESHKLTS*EIRNGTLRKVSQCL*SKLTKDSKTFGEH*FS*RLHIK**FEAERPV*RTFQT
ITFIRTGFLF*CV*GFYGARFRYFGCKLVQKWISNNSINGQNCKTMAP*EEILIENFCSP
RFCYIRNIFSQ**SFHNYRMLRSQV*TVVYTGQ*GFLCL*LQRFDNIPNIISSWWGIYNY
RYIQWIHLCFTDTWIKICIFIPCI**KHSRNH*E*LSSIFRIWKGPTRPSNHGFTMLLF*
GGQKFKIDSYDK*FKNSNL*FK*KKTFRAF*RIPKWFLTS*RPIPNDEK*TCSFHGK**S
LVLYLENAVL*SFSRNELHCSA*KETAERQYEFKRAVENCI**EYE**MFDRNVKPKQLT
HIYQLIKKCSSNSNCWFSSYQKQSLYIISCP*LPCHMCFHCSRRCN*KFVLVKRFDFRTD
FTVLQRNGPKLFRI*GNM**QT*SPSYRNRRIQLKPIERCE*CWNHSNNNRQSRSNPCFQ
N*YLTGNTKKNNRKVP*IQFIPPRSCW*NQQPQQ*QHIGK*NG*KKFHRG**V*HNPTI*
HAQ**AKPRFL*AAS***PGDFRHAIKS*CYFQEFDL**IQWKFYIPKVKK*KYELHGVW
TA*YSESFYHLSEVEM*RLQWI*F*MCFQKPHCWR**RFHVC*LWYNPQ*FQIENQKVRG
KTICSTVFRS*ACLQIT*YYYLYL*RSLLFFITDTFSHRTIYNPKDAGNGLRPMGSIRAY
RDVNWAIRKMKSRKDFPLSN*VGQKYAFVRMWCYSSCESGSADMLKEVTKTNLAFNTSLS
YSGIGLLLRKKKKKRKRTLSTAEISSCD*VVK**ILHIYKLCDYMQH*DILSSSIMPPLQ
NSIRNSFP*IAIASQTQAHLIELYRKQICHLTTLNKINKLKKQPPRRYRSLVRLWLVG*Q
HV*LLQLLIRSN*LKSECSFKVKCQHQLQKFIKIQSKVWR*FSKTKV*KVCKKG*MLLIS
IKLG*MVPD*GFMSQSDHH*ISFSSQIKSHIRYRASELTSFLVPHLV*LVQSLALHYSW*
KQDFNHIPSL*KLVNKRTTPVFGTG**PFLKPKVLRVYSEVLMRQF*GQVLVPLFNYLST
TQQRTFWSKMI**KMAQHYI*LLVLSLG*VLPSL*THGMSF*QESIIKKVTCTRDL*IVW
SKLLESKV*PLCIRVLQLKCSESHLIQSCV*PSWNRQ*N*FIR*SREF*AIINSHNKLRG
LKFHSLARTVLLY*WFHYNLFLHIM*H*G**SIFYFTFIHDSFINVIINIQNIIHNCPVP
RIICSRISEFLFIK*SVTV*SCLELSFSQPLFFLLLLLLRVFSDSCYTQPHLLLRPIFQR
TSTTKDEHGPESLLKIRSSTKWPQQPI*HLQER*KQW*LVP*SVY*FVKA*VHRLLEVKR
QTCFS*PYFDIQVLVPDISKTLIFS*NPLNSVNL*RPWA*IRTPKVSKVL**SIGDHCLF
YTLSHKKEVTA*VLRVASGTNQCPHQFLRLISRYS*TFAEIQLFYHSV*FRTLEFFYVMP
IVNYPILPFLHFFQRFHVRFALFSLPRFSF*IFTRPSCLL*VS*IHKIFVKLSIS*TI*L
FGFNHS*RL*YEIHRIS*KFPSRV*ETSKWNRSFYMIILL*LLFFYTLPFITLSRYQSLH
FSFH*DR*LFPNLYVIILHRCDNILGRRILANR*YKDFISTETKKAWKNEWRQRGS*RKF
ICDLIYSEEFRKSVVIELFYCLKELVIVI*VEIH*Q*IGRVA*SVARSLSMGEVSGSIPD
SSNLFILINNFFPAVTCF*NNCLL*IQSIIFDIQRG*L**SILNLWLLVHIYLQKLPTNC
STFNATRLPSVFEGAERSGKN*HGKKHKKTKWVAMY*LVRET*WTQFITTTSSQDHRFII
VMSDKVINPQVAWAQRSSTTDPERNYVLITVSIADCDAPELTIKPSYIELKAQSKPHVGD
ENVHHYQLHIDLYKEIIPEKTMHKVANGQHYFLKLYKKDLESEYWPRLTKEKVKYPYIKT
DFDKWVDEDEQDEVEAEGNDAAQGMDFSQMMGGAGGAGGAGGMDFSQMMGGAGGAGSPDM
AQLQQLLAQSGGNLDMGDFKENDEEDEEEEIEPEVKA*KEEQINLEC*NE*LRIKDEYMH
FTQLFTCLLLAASM*LNIMELIKIFLFVTILDIYCTLSKRQ**ADRSYIGCKIEKKAEIL
CCKCQVMELYVIFKEQFLYAG*LSGVSNKKENESNSHPWEISRKT*SISDRFNEGGFVNF
INRPTLVLPR*RIFHNLFSHISFIIA*PVPSPIKPGNTM*RSSATLSC*SVWRRVKW*SV
LKQAV*YDT*GPRVA*MAIVGNSHQDFW*DIIL*STSCCTHLIVLNFFAETKIC*LNEIL
LAVNG*VPKTVDIIKTIFQ*YIL*F*VPMNNTVFVQIFYCQYYFRKNPLNQPRF*SSVTG
HDGS**VSCRTIRHNHITRRQSSWSFYNQIA*RFFASNKNWIVYPK*FNYTWVI**F*HL
QFPSQRIFQTG*SFLIS*RCIDLFNI**FLGIFESFNGHLFQFRIALVHEFI*KYGTKIS
*TNGPDLFP**RAIPVI*KKSLKYIIVTLFGRTTTFGKIRFFRVVITINRIIY*SLFSHC
W*GNNPLGG*ISWCNKFRNNSLVWLCNRKHIIQ*SCMTSSFGYIQRGLIYR*H*QIAWG*
RSVGHRCR*CLDIFKRRNRYSQRCTARITSGPFSGCHFFIFLTIFINQCLFVLIANGVGK
SFLFQPRSLWL*IYTTIFIHCRYNLTAAVGMDEFEA*M*LLSQNILV*LCKKEKKDKEHT
PR*RLQVKNFLCLGITFHKRMVCSAFLVHLLECI*LYPFRLLIHQYVKNENLKKKKAALF
CNATRNIYKPSK*FL*NGQQHLG*RRVAFSYVR*DNLQKLITYLKFFSLLIILS*SSSSL
SFVTRYHYRLALQWLSSSWCPQLASFV*PQTCLTVPYAI*HLISAAYHFFLYTPCLLTIR
SHSLIPTTP*V*FHYHSLHHFRMEFPRQ*GYPAGIQSARSF*THLYPNNLDPSVHANLYL
LLKEPWNHLSEQHLDI*TLLHH*TLSKNC*TFQWC*YRSLLQMYGMYLCKRRFLIYLQSF
Q*PPSNLPENFLLNFQYQPYFLIQF*QISFP*LLCSNMRLVVLTATDGLLSK*NLDVSYT
GLSLIAHTCSDRP*MTHNSFLPFPYPD*PN**SIGHAVRRPSMGYNCKLHSFS*IYLFPP
VYTAEKPTFLEILKTWQTNYSQC*MH*LHY*KFHRHLTCAHQICISRQQI*QS*VSKALR
WFRYAKSLLMLRFVFLIRSLSSYIYNDFQHVKK*RKRNQVRMKNSTFKFPEKLAKKEKY*
MKKVRVYKYLCYIYAKVKDQKKKVEKEPPHLLPFVTLFLFLFNFLFSCALFAAAASCSFV
LGTTWKNPSNLP*MPDFKPFFNLDIPDLTLSSLNFLSSHKYSISSFSFGGDHFKFISLPS
ITSGSRNSILACL*GQSSGIFHLVLFDSPDSINSTIFSMDPCVFINFKAVTGPTPLMLSQ
*SQPSIMQRSTNCSIVKSSPLKTNSVSIS*IGSFLASEKVKCLNKKGVL*QSVSISSLAA
AYTFPFFANSAH*ASASVGAIIYGIPISPSNFWASSLCSFETFTNLLSCFIFSNSVVASA
SFFSVSTLLEDRFVNS*DFKSGGLPSKT*QGLIPLSIILSVL*NIPIKCDVVSPASLVNC
PPSCCLTAIKN*YRDIEASMATFLPKKLLISLFLIAEGTCSDIIAFKPLIPIFFLPVSVS
YFFPMYAVNAFHRCI*GRIPHYNTSKPSFARCYASRFL*KIHKLVNKSFKRVRGICN*SK
*MK*MK*MKNWLH*L*R**N*LIIKILP*LSQ*YSVGFLS*LTSRVPNRVSVTESHC*RG
VIQPGTSLAFFFACFFREKRKVASKLISLSTSFPVLFVYWQWPLPHPH*RKSPKCVI*YY
G**QHFV*ISTREDYQLLSPLHVICDPAALGNVSNHHICNFTRMDKLVVNYYEYKHPIIN
KDLAIGAHGGKKFPTLGAWYDVINEYEFQTRCPIILKNSHRNKHFTFACHLKNCPFKVLL
SYAGNAASSETSSPSANNNTNPPGTPDHIHHHSNNMNNEDNDNNNGSNNKVSNDSKLDFV
TDDLEYHLANTHPDDTNDKVESRSNEVNGNNDDDADANNIFKQQGVTIKNDTEDDSINKA
SIDRGLDDESGPTHGNDSGNHRHNEEDDVHTQMTKNYSDVVNDEDINVAIANAVANVDSQ
SNNKHDGKDDDATNNNDGQDNNTNNDHNNNSNINNNNVGSHGISSHSPSSIRDTSMNLDV
FNSATDDIPGPFVVTKIEPYHSHPLEDNLSLGKFILTKIPKILQNDLKFDQILESSYNNS
NHTVSKFKVSHYVEESGLLDILMQRYGLTAEDFEKRLLSQIARRITTYKARFVLKKKKMG
EYNDLQPSSSSNNNNNNDGELSGTNLRSNSIDYAKHQEISSAGTSSNTTKNVNNNKNDSN
DDNNGNNNNDASNLMESVLDKTSSHRYQPKKMPSVNKWSKPDQITHSDVSMVGLDESNDG
GNENVHPTLAEVDAQEARETAQLAIDKINSYKRSIDDKNGDGHNNSSRNVVDENLINDMD
SEDAHKSKRQHLSDITLEERNEDDKLPHEVAEQLRLLSSHLKEVENLHQNNDDDVDDVMV
DVDVESQYNKNTTHHNNHHSQPHHDEEDVAGLIGKADDEEDLSDENIQPELRGQ*IPS*E
DELFFSCFFCLFTFLYFFFSIEIYIISYVCFFVL*TSKFRLAIYLLILITCISQFKFLLR
*SAKSGPILS*SISLSLLKLMNCLFNLCNCANVTTLPMGKSTKKQPSSLISVIPSETMTL
VPLLTPPIEVRLLMWFIMVFIILLVSMSRTWMKLD*DAGFSTVAEFGFCKPLLNGSLCPL
FLADLEV*KTTLQISSM*SVMLS*GVRIAKSGESHRLLELGSSYR*IN*FNNSGSQGFGF
EVLFHSNIVSGGHSV*ITQNVVDKFFTSQ*S*YRKPLI*FNESTMTILFLDRSLFTAEMI
SDLNFLSSWEVI*SECFMPKDSSE**VMEYLLNDGVASILDCSSCTKCLASVVLPLHGYP
VKSTSGIFLLNCLFSFFKSFTRSLYPHSDTLLFKFHLFIKYSSFLFPSR*R*QNGKKSKK
KKKKDFFSIICRENMSKPSAVCMYAVFSISGVRKE*HNDLQLIFPYINMLLDMSLMKQVQ
*LLVLPLLFSWL*LVYIINCLFSQIVSFFLSGWYEIFLFKNQKKTTKG*YYVMQYLESGK
TCLSYQERQHWRALI*YNS*DSGGYMSCTA*DSLSPVLFVYVGLACESKGFNKQKTEFLD
KV*TTETEQQ*RRE*VSIV*FCIP*CTVRCAQLLPKKSSYQAG*ICYNASFTLYSIKG**
QWHILIDTTFRRAVGEKQRKLQ*YPEIDAFYVRNKTHAEKNSNN**GNE*NANLIT*KRE
QS*MI*CVGPDLRNTAEGEKRIRI*SR*KQR*GRYLKIYFFCTGR*LRSSDVL*DHYFAG
NCRQKPFMSFFHLTG*PLLRISKTRHG*LPEFETRAPEVDRTANT*EPSPQYGLSSIFLA
KKRVGPELQIGNNGGIERQVDSVVQPGKKRLSCGLYSLQCR*EEHAFRGLWTTTPAFRET
PRGRGPKSKSLIRK*RRGGSPPRTDGQHNGAGPRRQTRLSPLNLKKKTKIFFHQGLKFSY
VTDLARGKQWP*PFHSCFQVSCIDFADCSKSKWIAIFFPRLL*KNLLSMRSFLDKLYIL*
SY*LISYINFFLLNPVWLFRSISFFLLIFLPLLIPSPL*TPVLYRICYLQVHFTLNNIKI
LL*RNQKNKKGSLFI*ADHYQTHRKRKNTVLFFFHTYLLVS*YIKEHFNGLLICFTYIF*
YKKKTKKES*PQRLFYYRPPLVALVVTILKMSIIIFHWRLYRSPQIPTIITIVRWNSKTM
AVKRRRSLAWWLELQNIGFCPQDQDLVEDHLLTTLYLPTTPIIF*MLALTAGTVVIIIII
ITSFRIGNKLPKKRGKYQDISRQSMKS**TTRITSHF*SSMTWKMKSFILLPPPFHLHLI
HLHLFQVIEIEKNQNSWTMKAAPMWKPLLLTTVC*QKTII*ILLQMFTHHPRKNQS*TTL
IYCPYLPHLHRPLRSHS*QKI*T*T*IFIRSLIRLHSLILQQISLQQIQSR*LETTPCLL
ICKLRTKLRI*TRLNSLTISRNLSFSISMPKSTRITTLTKIMISGILTYSLWTIQQVRTV
AITNKWTMTIICLY*ICQFWRKPYLQGKMIRLSQMKKTFGIIYQVQVHNKKIHHVL*KKI
LILRRRTSKQRTMKPICFFRIRMKALIRITMTS*VQKSLWLTISFLICPQL*KS*WKSRT
VTMADLLKISCFPTIPVLTVVPVLMTTTPKF*NPKKFLRRSRTLTFMT*TITTMMQLPPM
NLIKAVSSTTLTKMSIF*RYKYFEIGMLQ*NENN*KSRKQNDIIQ*KILIMGNDSILRLL
RRPFPSTTKIPKKKSKKTKL*LFFNDVNDFFFLSLS*KKS*NEKQIWVWKAIIFFLFIYR
FWYLVIYSHTYTIFKLPKSIFTYPFTFIFFFFASFLHIFRISHHVYAYGETRQEKNDKIK
F*FTSGSTGQGNLSSEAITVVRCTHLNWTN*KLS*KHGSMISLIKIKGNPQGMTSRACGL
FGRCINNIPH*RRNNLCNDKKLTLKSRLNSRHIKKTTTKS*R*ALLPKFTVRRLVSLT*I
CRL*SLYT*HSQIILMLTMITPRQFLMNLLHEKLFS*NRRLQIVR*WRNQYPV*NAN*TF
KC*TLLLHVLRLHHHARIAMGSW*KSRNVVQLLILH*NLANHRGIMDLIPR*NWMKKTFT
*TSHLIQALNAGFK*HIHLYRRLPQRIKRIFQLHLVRLHSLEDH*RNP**NWPGNILKL*
KNLVSYRKKILKRKRKEKKARMVTMRKTTKTTLG*KMN*LDQKL*RTYFKRMMIMMIAKQ
GKIPS*ERDPKEERLSEDYETMIQKPRPQVLREMSIRSW*NSKEGKWQNFWDPPHKSLIL
NLNMIRRQAAAL*AQSKSLRLSERVERSII**AITSED*NCQRKTDSLMDDGEEGERDGV
NNTNICNL*KPIKYSVRFLQLHDV*FIWTSYVFLSI*RLACFYTFYFCCSIRGLVHICIY
IT*SAIIN*GRNNRQRYKYKI*NNSSE*KGEPTNRILPRIKEKLIIVYWRI*QDVLEKGS
HRQLGKKKYQ*H*F*SF*CGHNWWHRWTWTCNK*RAGPKKCQGYCCRANF*GRGPKR*N*
LCQG*FKFSVRMQAYIS***NSLRGVNTSDFHYGYFCITPETSYK*GFGKRHGSELFE*I
HYLP*CGEAIRN**DKKRRFAKSFHSRVSRKWSGGRPR*LEF**KEV*CLRYTYEHCGSQ
*KSGHRR*RQIHEYRYFRFEPWADQNEHS**SSWQ*HLPQPHYRMDNQLDLSKRRDVCEN
NMHPDCEPRYRITQWYNVQQQRRCYFTFAWFDQRCC*EVYGKFGTSS*KGLA*SKSFHFQ
*RMTCCN*LVYI*IFHFLKGVCMRPSSMIHIVRMRKMASMSFARRLM*LLES*LAYLPIV
RCNIDGNGILEYGSTILLCSNI*DAAFFIFFFTFFAYVYKLLASIRSLCLGYLIANRRN*
KEKKNTE*TIAD*TIAYY*VRFPFSFENYYPFFTAERLDVEDEAY*LQSMEALLHVIA**
STKSTSR*SLGVI*TLQKGKKC*QN*PDRRNI*RWLGQSDDVSLRCKSSKID*ISFRVE*
ESFIFTNNRFQRISGKRYEIFVQGIMSAVWAILFSP**NQLCSDFEWYRRPSCSS*ILGI
IYFKRYLDT*PIMGKS*EHFSEQWF*KYLPVFLL*GRSDRHRRMD*AIENLCI*QPARKQ
*EPTLHNLACVLSQPYRSRPN*RAMGKDYRYYI*AKNGTHC*YGLSGFRVW*LTKGRIFI
EAMSQCK*ISKLE*RYLSLSIFCQEHGPLW*TSWFLKRYHAGNCEQWKVQPSTTEKLIAA
KY*LPIKKDCQRYVFFSTRIRFSCGKCSIIRFQIETAMVQGC*FHGSEIASRQTGDV*PS
RVAGSCKFRTTARYVLLYKV*SKASRNIEKQLLRLFNR*W*IVA*RSQ*FER*LLM*IS*
SSLENGQTRIIFSPYSSPLSLFFYYFSLLILPHNNL*NIIIFCNN**TFFLSTLYTLFR*
LDWINS*SN*LLNFK*KES*R*PTILITVAVHHILTFHFRFPMFSSFKSFPAKNFFQFPT
EFTVTVTVMRLIFYSCIIVMKLVYLSIFINDSHRNA*W*GCRQVRI**LQSGCSTRYVPI
*QLAFISE**KPVAFCTSFAYVISVHG*CSVRGRIIVVAALFIC*YWHIVFVGLIFEVRH
GINYLCFVRGMSRMTCSPFQRRGQTKSP*FS*DMTSFFLLFFHIQVLCCCGCSILCDKWL
SQRHASKS*VILRRSFLLKTRLPGGGFFGVECTIIFINV*RDMIRQSSRCCARLRSFWKT
LGRLV*SQVAR*WRI*WLLAMIWRG*R*VRSWIYYIMRKSSLI*TTT*SS*ARTIGDFSF
IVETLGRHHGYLMRTRLIVFLF*NTRRRAMAVRFRIGSSFPCRGINIWRRFYRINGRGST
*WNG*LFQIRSKLWL**AFQKVRCNSCGIRGGLGVHVFGI*AESV*TCVSEVRISTT*IL
GHVCSGLTNFCIFRILFLLFIIFCLGRIF*RVF**RHVRYILFYLNRISHYHVIRIMIFI
IIVIIIVIIIVNIFIIVNIFILVIIVNIIVLVIIIVIIIVFVIIIVLVIVGSIIFVHNTT
SLILQFNVLDPRSAREFFRTFRFIIGKRLFLIFFLD*KAICIDEA*LFSLCTFFLFFTII
ILRNF*SNLISAYFRLHTCLCSSAKISCRAFYIIIIG*FAASETV*ICNAPHFVI*IHVE
VRIV*RAEKNRIY*ISFGINRIDILCIFNILSLIGES*WLFLHVFRRYIGRLRF**SRLT
NRDRFDLGCYFLSFVKVLFSFAFN*F*FLGFKVGILLNYI*LSFQ*LHSPFFI*LNFSQF
QN*ALFPFFFVQFCYFDI*YFFLQAMNLFKQCFNFFLFLTSTETTFIFFGYATIENAGFN
KRVFVIGYNHGFKF*RIMKILLQFLFRFLVHSCWY*WNIVMPLL**CSMHFR*YFAMIIV
F*FTAAFTFFLL*SCFLSSFIPMH*TSFVVSSRQRICSTTSLV*AVAQTVSRRLYFHGYF
HSH*PPRAWYVFFYRPYCAA*VPK*CGP*FTILTSRT*NV*NLR*LLASKFSKRGFCILV
SPVLPSPRRIIRGILMSLVWQTRRALRVLANVTIH*EHP*VSPRIREHCIPINPCD*RSS
RGKTLIVLRYFTLVNGPPIITERISNCCCCC*GIWTTFLDHPAISNAPTIC*YLPLSELS
ALC*LLGLINAISSRNNCVI*TKNMKKMEWRFSL*ILKIASLQ*RIS*PFFFFVDCLLLV
HFPFIFSRISPKVDVDNQSSGLFLRVKRRAQLRIGFNIILEDLQEGSYMV*KL*QS*NTF
I*QV*FRAATIFLVIHIKYNFLFI*RIQVESSLTPACSAHCRIMEVQKLKAKEK***KDG
WEAGGRRESKRVNLFDGNRFSQVSWKININPFINSQPI*H*L*WNNIN*TL*TINSLWNF
*GLQVD*FRFLRPHFIIFVTNNNWMALSCSNLLNRGNYFRE*RVSGTKSNDWQVFVHQGQ
DTVLQLTCQNTFRMHIRNFFDLQSTFQSSSKLVTSTQ*Q*RFLIL*FSRTELFYSWFQL*
YLLNLARD*LQALNDFNSSVYFRYTVI*QR*SKHH*GNILGSISFCRGNTNFRTSVNMNT
TVGDTRDRRTNTVNNSDS*GSSF*TII*SQHGIRSFTTL*NKHAYIVSEDRAFSVQKVRR
*FHTNWDI**FFEDSTSSQT*MIRSTACDHDQSPCSSDNW*PCL*TTQYHFIIFIVDSTS
HSIESRFWLLIDFLLHKMVVRALHDLS*LHL*SLNGPCH*CAYFSSRSMNM*LTIVNMSQ
IVIF*K*HLLGMFNNRCRIRRNKKFHRCWRSIF**ESPGLRMSQVKFIGGNW**IGILGT
SFKFTSFLWAQAK*FVVRFQWNFRLTSVFFGKFHIHEVDF*FFFRFDTNQ*RGPFSSGDN
LIRIVTRFT**PV*TF*F*KN*LG*FVEI*VMPIL*ICIV*MQI*FSNTLGIGITFEFIT
FVN*KSLQFSKICDDTIMNDHKLVFWVRSLRVTVNLFWSTVSSPSSMRNTTMRDKSNVSV
RILLSNLLFQSTHFTDLLIDESRISFVTIDSNTGGIIASIF*SL*TIH*GVDNFSSGSFH
*IIAVTKDTTHFFIKVAVDLLENLLLIWP**LYKKRNTVIPCLCWLFVHFFSTI*L*CWK
GHRFCNFAVKISVMDD*ECFLVSEKKYVFQK*SRKAKRVECKTLNKYFKKRKSRLRNAKM
HPISQRGSLMFSICEKKIKIEENVGSRALPGLIFE*STASQKKECLANQEKYVVCFI*YG
CQGPHWCSNAFFIVRGYC*YSFLVECLGFRYF*CFIYK*IFIS*RLWCFIFFFLYIFLFF
LIRNKSIFRKRIKKQKSKEIKRVWQNHNSPNSS*TDLQCLKNPLKNLTPNPTSLDPVAAL
MLCMDNCAIPRSMVRAPV*EANDGPIVPPDLELFLIWKYCTLSPLRRANSSTRAVPTTSV
AI*PLGSSDKVIPTLGTGK*FFK*TSGKFGL*RWLTSADKMMELAQTVCKSTGFLVNAEE
LRSTTDSNKPPFAPCLVNDPISSLSYKVTVENKSDSSVLTSLA*QIKAIIAAKLHNLSSR
RGAKRKCLPIPPMVPFCTSNKSKSI*INSDTSTPANLATYLNRWMQCLPNKGDFFSSSVG
GSLPSSSGVGKPMTGIVWSSLSNGPSAGLPKWGAKEGIRQTGRGVESTKALLISLVPFFL
*RRRPPIPRSLSSHNSFSVPP*GATAILP*PSAVSLKETGFNLTVKAST*DPMTPTPFSA
LQFLPRIKADRLVPFLIV*NFPPSSPMESCQLDFSLKYLKLCLSNSSAKNDTTW*VVGFL
*MKSMNSCAISS*LCSRMHHEFSFSFFSFSSLAIWLFLDGSTVSICRVFFNCSSISRCSS
ILFFLILLVVQVSTIALRLLIRLYTVYVLFCEVNCL*MNFYYLMERLRGVSTISLNPILS
YCRLLA*PILQ**RCKTASPLVVFPEKPIPDYFFFELDKKSSEDLLCF*LNLEKNGSLQP
IP*SRS*LIHIPHEMVRPLFIHEKRKEWVLV*CFFI*YQQAQEIRDYNVIMPQKVIG*HF
LANVDIKNIKYLTAFGAYKPATI*AAAQENTE*TTGCSCR*NLSE*STHLCVLQ*QGRWN
VLPSSLFFAL*NIFTNFSFRVVIFALGCLG*IVKTNLHHVPYRLVPAGSSIIVATLIGVL
NISKLPFARNLFLLKTPFGS*VR*LSDCKDVNWTARGH*NRELNSNRSSNRLDIHHTTCY
*SRKEINNKITRKTR*KERHRFAGQKILINKSTTNYIHSFIICY*YFLFLPHDMTGHVSK
TSHVPKGRPSSLAKKAAKRAMAKVNSNPKRASGHLERVVQSVNDATKRLSQPDSTVSVAT
KSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTV
PNSYSSSMVTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKS
ELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLL
DKKNRRIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFA
LLTGHLPFNDDNIKKLLLKVQSGKYQMPSNLSSEARDLISKILVIDPEKRITTQEILKHP
LIKKYDDLPVNKVLRKMRKDNMARGKSNSDLHLLNNVSPSIVTLHSKGEIDESILRSLQI
LWHGVSRELITAKLLQKPMSEEKLFYSLLLQYKQRHSISLSSSSENKKSATESSVNEPRI
EYASKTANNTGLRSENNDVKTLHSLEIHSEDTSTVNQNNAITGVNTEINAPVLAQKSQFS
INTLSQPESDKAEAEAVTLPPAIPIFNASSSRIFRNSYTSISSRSRRSLRLSNSRLSLSA
STSRETVHDNEMPLPQLPKSPSRYSLSRRAIHASPSTKSIHKSLSRKNIAATVAARRTLQ
NSASKRSLYSLQSISKRSLNLNDLLVFDDPLPSKKPASENVNKSEPHSLESDSDFEILCD
QILFGNALDRILEEEEDNEKERDTQRQRQNDTKSSADTFTISGVSTNKENEGPEYPTKIE
KNQFNMSYKPSENMSGLSSFPIFEKENTLSSSYLEEQKPKRAALSDITNSFNKMNKQEGM
RIEKKIQREQLQKKNDRPSPLKPIQHQELRVNSLPNDQGKPSLSLDPRRNISQPVNSKVE
SLLQGLKFKKEPASHWTHERGSLFMSEHVEDEKPVKASDVSIESSYVPLTTVATSSRDPS
VLAESSTIQKPMLSLPSSFLNTSMTFKNLSQILADDGDDKHLSVPQNQSRSVAMSHPLRK
QSAKISLTPRSNLNANLSVKRNQGSPGSYLSNDLDGISDMTFAMEIPTNTFTAQAIQLMN
NDTDNNKINTSPKASSFTKEKVIKSAAYISKEKEPDNSDTNYIPDYTIPNTYDEKAINIF
EDAPSDEGSLNTSSSESDSRASVHRKAVSIDTMATTNVLTPATNVRVSLYWNNNSSGIPR
ETTEEILSKLRLSPENPSNTHMQKRFSSTRGSRDSNALGISQSLQSMFKDLEEDQDGHTS
QADILESSMSYSKRRPSEESVNPKQRVTMLFDEEEEESKKVGGGKIKEEHTKLDNKISEE
SSQLVLPVVEKKENANNTENNYSKIPKPSTIKVTKDTAMESNTQTHTKKPILKSVQNVEV
EEAPSSDKKNWFVKLFQNFSSHNNATKASKNHVTNISFDDAHMLTLNEFNKNSIDYQLKN
LDHKFGRKVVEYDCKFVKGNFKFKIKITSTPNASTVITVKKRSKHSNTSSNKAFEKFNDD
VERVIRNAGRS*ILYRCYIIIQQ*FEKFNVREPNGQA*ENIV*KNINKWRDMRHEGKKEG
FTNIVLD*KINTTLEG*KELSFLLELKKIRHPRDLLQKALPQSCH*DLPLARILHHRQNF
RLHHHQARHTCRHHYSILIG*RSNKL*SSPFFLSLFLNFYPLQSYHTENSKTA*NPCSSK
LPK*Y*STRKEQCIIKPVEQY*KWTRRPWQIPKKQRN*P*Q**NIFQRMTSSKSGIQCHH
DQGATSRCHICSTSQ*TYQARQYHPDQVLKN*SCFELY*T*LVSLVLREYQG**LL*PLH
RYQRQSKCRKKIEQLGLGPLILNSSILIEQWTK*PYSY*QHWILTNHWVINRNIR*KRWT
ERTKQLMRYSNTCC*SASSI*YPSVQLILFCKNASSNDLFQSHPMFSCEQLSWSIHLCNS
NW*QTRLSCSGLRYHQLLLHDTLVKQPGDSKKLNVIGF*KVS*ESRSRQMCQLGYLAVLY
*NSKFSPHILASLGVVS*SQNRERVKYSH*LRAV*SHVFHPSYRKTSCFSSFSFYLRHSR
GR*HDSRGPHQNL*DQTMSVLS*EVEL*ME*KK*T*MSQ*RPKHLR*ELKWRS*ILKNGF
PPSV*SCEQRDMISYQRQWLICYCGFQL*H*SVQKLVLIPCSTHFG*RLMNCS*RHEMTT
LKGGQQMNSNTCPSCMSLFPIIDL*YCSKREHFTNLVLNTPIRRGVLFFPVPQNPFFFDG
AKDT*EK*ILFINVIL*NMKRRITERLPDSLIYTI*MVKI*RFRCFFHLNEIFPEESTIF
FLEPFFNNSL*ASILCWTCFN*VSLCKCCLTCLNFFNFFLSNDSFGIIDEAFLLFEISWA
NWSLVNLFSDLFTISEVVLKNFSGVNSFIFSRESTNIV*FPLLLNINCFAPFSSFFSSIC
LSVLT*LLSCVLSNLT*SMESDSSSSSP*RELISSPFASVFLECIAW*YSSGFLSFAFSL
RTFKVDCFLWKS*ARFT*SLCFSKNPYLERLVS*ERSLCCFF*TSCTSLAISFVCCWL*R
TRKPH*YYSMICNLLLL*FLSIVFFTLFLQIAMSSSSHKKISSFTCITTNL*ALEDLVMC
SFITTITSIEQQHLQNRSCKIIDWMWQK*EWAIIICRIFRHV*SFLLQLKRAFYVCIETA
SQRKN*PLRCQVLVIYN*RGQSMTLIRAEE*RSRF*TQQLQAWTR*QLHMLRNLRLLSFQ
T*ILFYSQTKRN**KL*EIAQWRLRRHSQHVYL*EWFIGIIPCSLQAPLRMGMKQVNQLP
KLASSCPRLSVWALGSNTNSGLHVHPHIWILKVQLSLALIQEPIIALVWLRKRSRSQRAR
GRSY*MKRQI*TMYLWGPL*DGIFSISWSICERID*RITPKPAGYIQIHWTTWCYCLD*L
VYIAARCLCHLHMSKRRPGGTSPCTWNWFSVPPWIVPYCTVATPTWWTKC*RNLRRLSVR
RLMSLRIPFSWNLS**KTY*VKSCRPCKFIMYFEHASGTYVYIRTNGI*KFLFLASIALY
RFVNQLLFLFIMP*PEK*AKSVKVNS*IFGLKSKREMKMARLNYFAIVYIDITN*VQQRK
IPLALGQSFTDHNTK**RCY*KMTMRLQFTIDN*AQGQSVCIPFLIDKVL*VNC*PPLFI
LCGHRKGQSFS*KTV*EA*RTPSPRHINNATDTMLLVFF*RPFYCNVQLMANNHIVSQYY
IASTDADVRAPSLS*SMFLS*SCMQNTAFCATDMLGSSNLCRRLLFPRLFYVSRALETMQ
RSPPQHAKEKRKWAWAASVSAEVNNTN*TALAPKGNSTGTPRGPAKAQKAWNMRVLGP*H
PVPRPERAI**VFHSQEW*T*IGTSHYPRNCGNFALIIRKSGTVLFPLSCISLSVLLPFF
NCIWGTVDQKPNREM*RSKKKTTKKLKNKIQ*SYINQASCSSFSILFLPSLFLSLFFSSH
NQE*ITSSHSLHTNKKKNAILYCRFRCFRRFG*LCCR*IRCRHFSNH*RSNPSYYHCYHR
SYHHCCPIFHR*NCFSIQHRNYLSTN*KWCC*GRCRYGCRCSSCCCYVVIRNL*FFIISI
WLFSKFSVLLGKCLILFFSLIYFYT*F*IIFVILNR*IP*K*NTFYFNDVPVISLRMSQK
FELEMNVLETGFLRVC*DLGYAQCFLRP*GEKNMHACFNRPVCIKNFALSCD*RVKA*KT
*AKVLTVLPFIFLPSSLSVTCSKESGKDIGVLRWDLFFLPFSILYFHL*NILQIQGRRVT
K**SRTQ*TFVLTTIAPRMDLNLQEISRWRALKSLANAL*NFHDLAHFSTVPLIPLLWAL
MRL*NCTFLRTC*IFLMRFIYDALELALFSFLCFKSK**RTPLDKY*GMLQPRLILHPYI
TLESH*FLQRYGEQVSK*ECMCTES*LEVIMKKKIGHLESYEYRSRYPS*RQTLCARPSI
PLKYHNKQTPPAKTKKES*KKYFFAL*MVPHRTS*LKIALATAP*TKRALRPDWNTGPLT
SVRAGCPTTVTYSRRAISKVPQKKTKKTTNNKLCGSRSM*CFFTF*F**FVVQKKKKQTN
KISII*RTILTFLSFAIFLEFFFCLK*NIP*QTNKYYESLKKQ**NSPLLCLSLYSPWLR
WSLPIPKNSAW*VSVPARIYNT*VFTVITAL*NLAAVVAHLRQLLPMTVN*NLTTISMLL
SMRMAHSKKVLRAMLPLVFLLKMAI*TTRALLVSTLSRTGRLTFSLLSNPTTLPVLRLDQ
LVRADLLQQIFLQATLVPLHLLLLRLLPHHLLQSIVRV*NLSRPLLLWKLPLLAPQLLQL
SLKLLMDKSKLQTQFTNKQKMQVPRLPSAWVLVL*RSQLLTCCKYENKTCMFYFLQYSFL
HNDHLHIA*CNMKWPIIFSYIVLLPTFLFLHAALTFPDSLEKFKLVEK*VNVPPAVSLLH
VERWIYRKGDKSSYLKFVPLTANTHRVVIYCTYSKKSKKSLR*PQ*NELISQTKLTVSRL
IGEYKNV*KKSY*QVLSTGLQPTGS*KAIQENG*KTENHE*EPRID*INDPI*YEVFGM*
RIYSQKQKIQW*ERATEGEVPGLH*DI*TNHFMSTLCQFHCI*NRPR*FRLCNGSGGRKK
LCPSETK**PER*NSCRKHRRDTATLSEREGNGAEREDGYKGASR*QNGFAGKKTSQNST
RARG**GT*KFKEKKP*NEPES*NDKPQQTRTTRKSSND**SGQPRRSGI*QSQAAYQ*T
WQ*QR*EENSVV*SYIH*GKNTEEKLCAYESVRDSYKTRKVSQMT*KSKERTIGIMISCD
AVLLWLLPHYSVHRYLRGATAPSDFEVSGRFFIEFSYK*IHIGKAIVD*SKPKPHKPRTN
RKAWLRIHTKCRRQYLNFNTKTLMVLSSGTCSGLFKMAPMRSEVEFY*FMGLASTQRFNS
GLWTTYHSMVTSHLRLIKGVLVLHRRADRKV*LMSTMCLTILSILWRRT*VNVRPKAYPC
SCGGIQWAVVSA*TMPAKVSTKTK*ADISGQAH**FYIRIQCITSRPKLLLHYWRNFYQG
*GSTLV*ILKESHLIKPIVLSSEAILCLFHYMGRLGKYTTLCNVVPSSTRMKTIIFRRTS
LKTNPLLLCMDKTTQSTILRALKSSFRTVLLLTKN*SCIRAQDIRFSH*RQIKSSTRCSM
I*SNGWTNTPRPKLNHNLYRT*SLRQYTNTHIHLYFIENAISKYYLQKSISILVKQ*IKR
*TKSQSTDCLVEVKEKNLRAAPLSPEWEITLSVRRFLSENHCDCQTFGSHLGELLTIFSN
DENVLLVRMALNTEVFFSPFHP*KFLVQFSF*LLRLLSINVF*TRVKEQVCVLSKKNYYI
YPT*GWKKQQTNHFLQEI*TMNILGVQSTI*TV*TFSKGLFRTHVVRPVTQKMQMKN*EQ
SLVASIFSLIHLRVMLNVNRH*IHCVK*MKHSQRSQN*LHRETAQYLRQILIQIP*LLLS
MTLSTPNMEACLA*ERPKQRRTLLHLHRTIPQ*GTR*KNVIPI*MAF**TEGAQAPPDSL
YQSSLAVRVLKRKTTYY*KVKHPIQNSLVTHFNIATQGRFLYPGQDQGLLPLPYQHICMA
WKSTFHLGWIL*LLTQKKVLKGFQIIGPVKYHRVVRTIQGTPPHHYHIRTLPHH*ISL*V
QIQINSTNQGSQYNSNSLRNQTLVLGGKNLSLRCH*QVPLQANILATLE*PYDVQLCYLF
PHSGSPSVRFY*I*YIPICISCLVSKFPYTYRCLSSPLEAFFYILYYEKSF*KIMNYFFL
LIVQPAIYCYK**IKK*KKKNFQRKEYEVNIFFYD*DPPVSFFFLNHLVSLREFCSLGTS
ALGGFLIILDNFVGENLFPKLPLPCEFGSVK*SSLAPFSDDVPCTDVLLLLLGFSSLTSI
VKNLQ*LSPTVLLDLLETPFVKNFCNLAEEFSFVGLFSSLRTISFPSFISS*KILCESEM
EYFLSSNKVLEAHS*PDNRFLI*LILL*SKHDSCSNSFIACFSSSAFGIIELNLMPELAP
LSKSLLLEPTSSLFSRFIKSSPKISVLFSVIFSNSNSPISGLTSIGESKSFLSTDKFRLL
PLNRPSSSINSPFPPLSM*LYFSILVISS*LKLTIKLTNSVSLKFLSSR*GI*GKSSNIV
CSMANLGLEIVELRFNIFELKSSFFCVILSM*SNKSLCLLSIKLFIFISQGSLFANCVKV
DRLSKTLLIRVRFLLAVSFKF*ETYLNSLGFNMTGQKNLKNNNPDIPFKIICKVSSIQII
SSFCLKIFKTFLISIGRSLLVAYSLFQIFVTQEYNRL*LSAIIFLFFTSSFSFTLAGSNS
HDLFDSMISFSIALSALLKYSLPTLKKYCSIDFVKIELPRNKLLKTCFESKFFWFILETV
PSILANSLSIRTWNHSSILDKDWNISRKIMDVCVNLLSFSIDEEDL*IRLETMDKFAFIK
SFSNLTKLVDGKMKFKFEEILIQIVPI*KFLLSTSMMGSLVSLLYLVSFIISCVIFILPI
NRNRFLLLRSWNNCLISR*ELVSLKSSLN*NSSLQNGLEEFETMDVLAHVWPQAVMSVNI
DHGVLFLSFKLID*KLASSMEILKLFDIFISFDLSEPVIDKYSDLANDCNAIKQSSRSIL
KGNSTIIS*EISLELVAALAIFSMRNFSRPNWLLSNGNSPKNKLFSLCKTDESRILISDL
KSWLIFNE*IREPSLCKRRSSMPFDLSTPIAENQPTLLSSLLIISGLSKIFVAGGRTMFL
TMGPKTFNL*TSKLSGFAIFLLLNSRGRDT*NLLNIPFVFIELHQIRHVSNFLKSLQLLT
RR*TLLSLPEVFTWIIKLQFALISLKEECLSLIISILHCCRCLIIG*ILVESAVNSSIEW
VSAPVLVICR*CVFQSFKDRLLHH*ISPLKVFL*CLTLDKNSFNLKYDVRLWAGSLLELI
I*YNQR*TPRRMHG*SFQSDRVVIPTILLFLPPFS*MAFVWIPFFFIEQNAFKNESH*LL
LDTEIYIL*SMHAIFTESYDEGLYHS*LVTVNLPKMLGISPSGPMYLGSLQGPISE**NL
SLGLCKTDVPPYLTGKFSIGICFNNSFL*EEPRIKIFDTVTGSKKGLTILNIVEKPNGLC
II*NLPILSG**F*LISATSLI*EST**ALESEIPFKSSTVHEVSIR*PALLEHAGTRYV
ANNSYSLTKFLSICFSVVILYIFFKLIPPSSSKYNGLPSLST*W*Y*GYILANLILSLSS
ASLLFS*SSIIVLAPYSSLHRSVSTNISTLALISNFLARRNRNSVESSSLSL*FFSNKID
LNCKSASSCSLVKLPGVPGKALGEHI*G*VSSMLVVILPFQF*QCANVLLFRFISPLYKF
KEMFE*RESRSK**SEEFKKE*IGAYKRGNFRSACYVKKI**HIMDCIPVNFHMYYADLF
SCKRLANSYLMITRK*YVNFKLRFKVYKGLRL**KNQVGKSKWKYGSQ*QV*FLKVTRDI
SAAAPESAVIITEENGQCFTYN*GT*IPSGVF*SRLLGEILRCHQIGQ**EKGPSGG*SP
VVLLSGPQGP*KNTFNKIWMH*KGCFQTVCSL*FTHMPFFVFILAFLA*LGTYKSCTHGY
FFIIL*SD*YSKFETFP*IMDRGQPKKNCCARS*MEKTDTIRRLILDIVEQTYVTLTSLD
THRQASGETFETVEEYV*NINQQTYVLNYVSGYIAFTVWKLPLSPRYSLLKKKMRKNSNF
NSDIRLQYINIKQL*HLIYRAYKIMQ*VWITMMTMNLNCQS*WTCFQLFPNPNYKYIYLK
TIMIWI*R*ACC*KKTTISLQLIMNYINCTTCFLSLIAAL*KISL**MRSP*NRLFLIF*
IMKPCKNLKTIKQILLIA*KGTKRKIIGNQQTIT*RV**SLPTLPKILRRNT*PKMVLIQ
*RRSSKSFWIITTKGILKKMWILSK*NGVLIRL*EVVEFNHRRGLPTF*KRVKNPQMLLK
RVSKGQGVISTPWIVRRWLS*MN*LQIIAISKP*TMNFCKNACNFMMEML*RC*TYRPY*
SKMTRILRKLGTLTKVLP*HPEIIVSNIYPNFQHRRFPAEMR*EILINCPFMTKKPPREL
CRL*ITCFKHTDWISMVFFPVKRFQH*NLH*ISGGPKR*QNES*TPTT*THMAQKYSL*A
R*SW*LVEVSTASAGSQRFDCRLKVFLKKITTYFGKNLPTSELRVRRRNKTYLIFL*RL*
TLGFFKLHWVFSQFREK*YNALEMVM*INEC*KNTYVKQIS*TLAQDSTSLMDYMKLGLK
SRKTGIDVKQDIPKDEYSMENIDDFFKDDETSLISMRRKSRRKSSLFLPSTLNGDTKNVL
PPFLQSYKSQDDEVVQSPSGKGDGSRRSSLLSHQSNFLSPANDFEPIEEEPEQEENDIRG
NDFATPITQKLSKPTYKRKYSTRYSLDTSESPSVRLTPDRITNKNVYSDVPDLVADEDDD
DRVNTSLNTSDNALLEDELEDDGFIPESEEDGDYIESDSSLDSGSDSASDSDGDNTYQEV
EEEAEVNTNDNEDDYIRRQASDVVRTDSIIDRNGLRKSTRVKVAPLQYWRNEKIVYKRKS
NKPVLDIDKIVTYDESEDEEEILAAQRRKKQKKKPTPTRPYNYVPTGRPRGRPKKDPNAK
ENLIPEDPNEDIIERIESGGIENGEWLKHGILEANVKISDTKEETKDEIIAFAPNLSQTE
QVKDTKDENFALEIMFDKHKEYFASGILKLPAISGQKKLSNSFRTYITFHVIQGIVEVTV
CKNKFLSVKGSTFQIPAFNEYAIANRGNDEAKMFFVQVTVSEDANDDNDKELDSTFDTFG
*L*CEYSHYACYVLKKYN*VHTLILLNM*TFL*ENESRKISHRTFVDERTKSRKRERTVK
*HLVSIFK*KSKGPAKSY*V**RMKK*TQIRI*TVSRELT*FHPCLQHKCRFQF*PTRRE
EKVFTMNQISKDLIVMKINQNPTLIGGIFTKTIIAQI*GISLLPI*SKIVKGTKMAMKYR
STPVCQLIQMASKKGFHLHYLLLFHLRCPRWKGCRIIDIRYPINLESSSSSRNNCSKINN
KKSSKRHNCRSKINEQNSKKR*SKFRSKCKKSKLKDSN**TKRRG*RMQYLRRTLLMMVL
ISGNIRYRVVRAIAKMK*IHLRWKKILSFICQVILSTSIPSQTLLNLSLQRRRHYRLITP
HIKTRKLSLHPQGLVYPSQSSFRRKTTRNSTFSLVRRAQLPQ*KYL*LLINFSRYMGLRK
SLFS*LSQNPLSIF*KGSKCQHTLKFGGRKTLGYSTL*IRMILA*V*T*YCTMN*ENGLI
FS*LRLCQLTHLLNWPMVYVTIC*LL**EIGHH*PQC*LRLQ*IHSCISIL*QRNT*RV*
CKTIRSSKF*NRWKRY*YAEILVWVV*ENGQIL*RSLGGESMKYGKLGTRKLVIKSKNKK
NKRVLTMRTTMMRMTKRMRRTRRRKKL*MKQHPMRAMTRKTKRMRKT*KPKFKCIRKEYF
VLCFMFYFFFFCLFLKRRLLLFHSLVSKLSA*IRLNKYVCGN*GGYVFIYRNSCSNSKA*
RFPEP*SKALKTV*FWSNIEINKWLLLRVCIVQIGGIEIDYVVDGFTASIYLPIMSIKRF
GQVQDTGPEPGPWCQFFGITFKIC*FDTATRFTTLLVFPAFNVVPNPLIDGVM*RHNHLH
VI*VRIPIFFHHCLVKLFLRRVYPVSVRIRPWYGGNLSGLREIHRGVIFRRFIVILWVCR
AL*LIAWGSSTRMRFVAMFS*P*LFGFLIYGAFPLLV*RHHNM*NRDE*KARELTNYLLL
PKCDA*AFGLCNTSDCFFPD**ATSFILHLSVLEGLQTSKSWNFDFEKNMPLPVAGPFFL
EGRPRSRHYF*SLQ*PCWVRMRCNTCQEVLYINHNIYHQ*AIYTFLTEKKNYKTK*KKNN
MSLQSNSVKPTEIPLSEIRRPLAPVLDPQKIDAMVATMKGIPTASKTCSLEQAEAAASAG
ELPPVDVLGVRVKGQTLYYAFGGCHRLQAYDRRARETQNAAFPVRCRVLPATPRQIRMYL
GSSLDIE**LR**HYIRNIDKL*FTNTKSLNLINQFLIQQLE*ALAVCATLGAGEVQGTW
RLGLPASFSPPSRHSLSVHWLNHAPSGFPEKYKKKLP*YNGGYYNIYSLRFKKKC*HALG
VCTVFLHLR*RIHI*IYNILYVDIYGKEEKKQKEKEGYHIQCCQE*LNVRFPLQLPTLIK
*LFWVQAVVLDNHCLCF*SLTIKSRT*DCTT*RAQKVLPPICLIFQQTPWSRGLLQKSQT
D*TTL*RTQTWF*FLLVCPESLV*HVMTCSPSTQASFAIWQQQPPNPLPMLPFWSFPTQS
ILPFQLSPKS*KTRVFTTQRNCSV*LPWTLLEPPDSSQKSRTPIQLRKGLTSSVDILVLP
SSH*FRKQTIS*CLMTRDTN*FTEYSLVVTKSSKQRMVLALLRCQWPMLVLNSLTLFCPV
SKAKETSSSLPSWTLPCSNPKASNSLHLRSLWAQMVLKRSIQ*VSYLQKKKKCYKNVKKP
*RRISKRVSTLLLVNRLFKIRNRVKNREKKKKILLIRTEDYSPS*DYDIFFI*FFVIFSQ
LKGRKLPKIN*RKIHAIRCSYTFFSSVDEEKQK*LNRRARCDGDDNDDDDDNDE*TFRFT
SFFKYTYMI*KKKYVPLTICKYR*SKLPFMVRQWMTNLDVSTGIFQRM*LPSGLNVVIST
MRALNATKS*VLTR*KNMISLTMQINT*LFAEFAVMK*RLQSITTTIQTLFVPIADPPLI
QAVNCTTICISRTLPPLCVECCSINACHLKLCCALLVKEKMRWYIYRYIYIYMYLYIYVH
TYIYIYYCCYYYRDYYLGPPFFLPVFNLPSNPALFFGTALPTYFLFIFSCLFLFLPLLSF
LILRFSSLLFCLSDIVSSTTLLRSLHSIADFLFCASFLFIALRSSFSSSLILIPSACNIA
FCHFSFSFCLICSSSSFASILFFLASNNFKCDFTSFLAGPFVLPAFLNLCKSEVALAPSS
NMIF*NITPSALISESFLPFLNLFFELFSKSLSMSSISESDAISS*SCSCSLSRRFLFFN
SSLRFL*ARIASLEPGAFLLLFISEIFACNLERSASKFFFLCSFSSSVIDFFSTDLSGSV
VSFLDSNGISFPSSSKITLISSSSSSSSSGAIIIGSFTSTFRSESPSTFDVASFCFCIFM
CLNFSPGRTTGFASFSFFFITSNVLDVSSSRCSGSNFFSLSFLLCSLVFFLAFHCS*LFS
S**YFAGIKANKPSKALELARRRSSSELLISVSYIFQFPDFLYHLQQRLSPHLLFISWSS
HLFYCTFLFSLPEMRIKRIHFKKFSIWCLGETF*SCNPN*TTLLYFNWYTNSLHTFASIA
CVNRVERGSPKQGKLTSVGKPSHLAIAALI*FNSACGRQGNALCC*QN*KKNFFHQQFAI
LSFSYLIHPFRR*FCSKLVSILNTNSIL*FWPSIDSRCPKVLYTLIDLQETTLLKL*FLT
LN*MSRSLI*NNLASLLLCSH*SKPLHFWVQRA*S*LKLWLSNFIVCSIFYFNTSTYIVL
RVSRSFIWHVIFLRNIMMKKNFIKQLSLSEWVIIGNLSYVDICISDMFLKEK*KSK*QKG
STKRVLIQEKI*RIVLLTFLQLMVV*PSR*CIFSG*SSCR*KRKSSLIRFRRYRKVSNP*
MGISS*FRCHEQHCSSIPFFQRFDSIQQERR*CLFC*NRQPSCCLRC*IERLHLCCYRKH
FSR*PSCRWFLGFWFGHYFGP*MES*ASSFDEMVQHCCCFSNREDSIC*SQIG*KGSNLH
STKEAKG*KAKGRKVKG*KEEGRS*ASR*CCSS*KAKAPIGSFRKVHICLG*LEEKVLQR
RHQTSCFAMVLGTLQP*RILHLEGWLQIQRRTYLDFHVQQLGRWFFQQIVRFY*VHVRLF
SCLW*KQQ*WYCWCRYGQRPRFRSSL*CRSRLGILRIHQVGPNQGRRQRICQQHVGLG*A
CCCQWRR*GNC*R*GFEIISITLLPYFLPNIHKSQTKRIFKRKKKKTLKSTS*LPHTYAW
FNSM*RLTSM*SLYIYIL**SL*LSITICCGYSNNILHKLDSSLLISCFSGAFSIVLLQQ
*RKKQFSVKRSVSHKRCMLPELE*ILS*DWKTI*DRTEDSATRLVISCAFKQDLSQCFRN
TNKGGI*KLQLLEFVFLPNSRSILFSEKKKWLLRYILQTISY*SRCLKMLNLLPPLAPKL
IHGSMRP*SGVGHLFLISKFPNSKLAL*TH**LNRKNCLK*ITKLGLLLAKSLKFFKAST
RPAPMLTGLYLSIICQFLNTWKIFNGKPESSS*ISLSKI**H*FLMNLLN*TPTSELLMQ
ITTALKLTWLLLRERRRVTFLSDPCMILSSPKTSFLILNI*LLF**QFPKV*NPISKNRT
KLYPRTLYQHLPA*LQRMLSMFCSMFICSRKTFKNSQQLLERRNSFLVNLTTRRN*LTS*
KKSMTLLPV*NNLCASSW*DWPRQLMSMFL*IGSTSRP*EFTWNLFCVTGCHLTLTSRL*
LSHQRISLNASLN*LMLLDFLVAMPS*RIKKGKLTSKILLFTNMLLLSTQSMNHL*CI*S
IYNRFIILT*INIYFCFFFRIFNFFIHRDNTL*L*MFE**WNIIR*NMLLMND*TFFNFV
VEFQSFLIYG*QGKRWKLKKWKLKKKKNQKKKNKNRKIGTEIYRI*H**GVY*ALQVDFK
PEKIIIQGRCKLVKMHWNIISKEQSSSSVSLPTLDSSEPCHIEVILRAIPEKGLQNNEST
FKIDPYENTVLFRTNNPLHETTKETHSTFQFDKVFDANATQEDVQKFLVHPIINDVLNGY
NGTVITYGPSFSGKSYSLIGSKESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEIY
MEKTYDLLVPLPERKPLKLHRSSSKMDLEIKDICPAHVGSYEDLRSYIQAVQNVGNRMAC
GDKTERSRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDALKKLN
QSIEALKNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLS
NVPTTLSTLEFGDSIRQINNKVTDNTTGLNLKKKMDLFIQDMKIKDDNYVAQINILKAEI
DSLKSLHNKSLPEDDEKKMLENTKKENIKLKLQLDSITQLLSSSTNEDPNNRIDEEVSEI
LTKRCEQIAQLELSFDRQMNSNSKLQQELEYKKSKEEALESMNVRLLEQIQLQEREIQEL
LTTNAILKGELETHTKLTETRSERIKSLESSVKELSLNKSAIPSPRRGSMSSSSGNTMLH
IEEGSEISNSPWSANTSSKPLVWGARKVSSSSIATTGSQESFVARPFKKGLNLHSIKVTS
STPKSPSSGS*L*LSSIIVRYNCVVSL*L*S***R**FVRIMLTERCTFLLPFFFGGYSF
TMIWKNEKN*K*KILLDEMR*GYDIYVRIPQEEVARVCRHYHGSK*Q**SCIKPYF*KTK
G*EEYTSIHE*HSD*KS**NRKV**FRRGRPCFRPTFEQGKCPYL*IFEKSGKRFTQNER
NTSRLPTQARNNVIY*KQSRYRPYW*NRFW*INTNSAIRIRKII*YEEAWVDCCNSTPSC
CGHQFGYTCCSRTWLQTG*TSRLFCQI*QYDYYKNKT*VSD*RYVT*RTYDE**P*RIQR
HRYR*SA*KNCAYRFDIGVLKILDTRAKT*FENNCYVCNIASRKI**VLQ*CPNLICRRK
KI*CQTILLEGANR*YSRRCHQVLYTNKPR*RTGRYLMFFTGPRRD*QSSDYNGENCKVC
FR*GPSTINSSLSFICSSSRGPTVLGLRSDKGFQEKSRL*YQYCRNICYHIRC*ICR*FW
SSKSQSLETSAGISHSTYRTHFSGKCDAEKWSCW*RK*RKEFQALL*V*LCEIT*TK*T*
NSQK*RHISCVNVEEIWC**PAKLDLV*EPWKGSYSNGASGTL*IGCS*HSWKDN*TGST
NGSVTATTAFK*CLN*SQ*SRMFESGH*YRLLP*CGKFTVESVTRRKR*GERASFVLMQR
W*KVW*PYHAERAF*YLFLRTREKSRCKL*KK*LV*RIVYFDTWV*KCNSCQRPVKSLL*
AFVFFNQ*RG*RIQKDW*RWRANFENFKVFLNWVYQEYSYRDARQVL*NCFHWRADKHSS
IIYAIYE*KLPRYNVHGVCLYYEGICQKC**D*TFMVTRSCH*CSRCSKAKSF*FKISHL
LLAHFYCI*RHLM*FIEHYKS*QLLQYEFHGFISQYLMNIHRYICIFMLNAFRIVRWLFL
*NYLGKRAKLYYFAVDILKRNKRS*KK*ERQFDAFLSASYSLLLKNKIF*QKG*DNIVGS
SSAGSEGIAE**DFTIVYLSSFLWHRFINMFMVQDKSFVQRRK*LLQKKLNLGYVRFMEV
KKN*SLLRSLPVSLFLKNQKKHQIH*NLGYL*SMMVGQKPLNQKSTKVEPRREDLITQLT
SKR*VPTHILMKN*RLTIWALMKFL*KKSILMKMTPTSP*ILLSDVLLIFTSIKV*QRIS
AVSHFVPLMRILDGRLTRLTSLLGIQDFLQMRIPVKLLIRFVFICPMLKKTP*RRAIIKE
ISLQLFSLPNGLIMTTV*CRLRSEMNGCRTNLIVGSLYQFSQYTYQMKISIHYNTVFYYT
SLRVQKCLSLLRSNWL*TMQV*QMISGIMLHYLSLLSWWYFSSSCTFSYMSTGKTEISQM
LLEKL*TRNAVFWVSSRR*RNSKT*KITSTPNCHLIRKPVNKIRFPSKYAFTLPREGCFY
LPSH**KTTLSSFFCYLTYLNSILYKY*SPYTSFFLLWIVNTVN*N*CKLNNINIYKSSV
RQFDTK*IENASASSRVQKKTLDLASFPLISPYIHFCLAATSHIFSSVMTLGSGLK*RST
TLSSPSTFLLSKLSSSPSLLSTLSSSSSSSPPTSSM**KKGSNTNIIFQKLFVPQLANKT
STRAGRYSNSMYSSAQQTNSSNS*SCSSADNVEYISDNNVNSLLIVFGISSRACHNSFCA
LSSLSWLTASSLLSFSPLSPWTFSESCREGKNPFFSLLTISSLYSL*REIIFIIGLYNC*
QTFISE*GTMTFSK**LISPSMKFAQIDENT*SSS*VDSVKSWLMLCCMICSVRVGKRFL
WLLTISSLKAVDPALSAPLVEFSKLLSVEDASEFFSPSVLSSQYSGPPFSDNVTNKRKSF
TLTHGFSEFT*ASVILLTSIFIFLWMHLINFSM*CDFFNPYFSFRYPTEVITS*FVFSMF
VCFKKLNVNFRLFP*CLSLFSSPFFFLLIFFSFEAPNLRHLLQVQSFNDGSLAACLGNKS
LAIFFGALY*A*FIMLVIPKM*RKLIKASSNDDY*PMQQKKFEFS*FSRSQVSSQSANFR
YISKK*LYKKSHQKRGLFSLR*RLDLHNEYSILYLISLYKIDHLGKLGCFHHVKVVLIYI
STQNSAIVELRTRQFFHCVFCCLQGLELDINITGSGSQVFKIKSVIDAGLAYFNRICSRD
TIL*CFFNFCDKGFIFQIQWIKTI*EQQNSRFNTNRLGNQIWQALKRNP*SNL*YLSIIW
LEPFVWF*FIKNILSDDFKR**NTFSEFGFFASVVCIGRTFVKKWLSGTVCYIQ*RKKLF
HSIIFTLAYIFQIFQCNYRTPAKIDQMIKLLNIIIRSSPF*VESTKLRIKE*STGQNHSA
TDLRTKLNNNMVRPSFTNIKVGNFKVLRITLSFLET*NKIFQQIFQSCYNAGVAALRQAR
NYKP*ICLG*GHVVVSRRIE**TRVHYILGIIVHVIFISLQLPFITVAIEFRTFVLPLVI
ETIVVSVSISSPSIEPFISSSSFIPLPIIGIVVPLGPSIVTTIPILPVI*SSRCIPITLT
MRTCPCLFISRSIRAHSNY*RWSSVIRM*NVSTFWRFRKLTVTFLPLKMCIYNCIIRVES
FVLNRHNILF*FSYRLHYFGSQILQSLFISHLRVLVFCVN*LSFSTSFILACTV*FLISN
FFSTC*LGARLKYIISNTLL*K*SILQRNINSIAPAVFWHY*CK*VRILPCETF*GFYF*
QLLLL*GL*QPF*VLITVSKISRPLWFLRKPH*NLCSHQRQNGRRYLVFR*KDYQVMERM
IRMGLKESTVPLLAV*QQGFPKTHCCI*NRYLGNH*KMKPL*LCIQNNTPV*KWYQQIEV
P*PF*LIMWNIHWKS*WQ*MSKRLPIEPIHC*RIEMQELRTL*TR*VLQFLTFLTNIKGK
HF*MPVQ*PQESKRHIWLVKGCLLQLTLY*SSANFHQVNSSIISYMTWGAVLLRPQCSLY
CSRRTLLSPLQ*NLKDMGIIHI*VVQSLQWILAV**RISFWKHTQP*ELMNCTLIPRP*Q
KSTKQQRRQS*F*APILRQVLT*NH*STILISVLL*LDRNSKNLLQTRYWTLSNP*MTLL
QNNSVAMEQIYLR*MGSFWREALPEFPLCRIN*SNSYPKKKC*EMSMLMNQL*MVLL*EG
SSYLIRLRPSR*MLLTVL*ILIHSNYQTNLNCMMCSRAEVLIQTKHLF*QTRLIRFLIIL
PLTYLRMVNCSKLSQLIQEL*RIHIPLISARQELRITLLSTCPVIDYSLFKRLTAFVRAK
MT*VTPSKLRTKAAVWLLLLRMLRSKGFLLQNVRVCMSISSCSINRIRKDFNSKKI*TFL
KVTCMMLETC*WMMKLCKMDQNPK*KSYRRWLKYIWIGSKMHPLILTLRI*LAELEKLEY
*KRK*NFTWILQRNL*TLNNLKECLKKAISYFRL*KPIRIPLKNF*VNLKPSLRIP*IML
EKNLKRLSNQRMCRRRYLHGRKP*PLLKIPLAK*RSSWQKTYLAKTFVNIYLKSNYNLIC
IVRN*RKNCV**KAVMKVA*MK*RSYI*ETSAYKRERRKS*KESLNRKKAETTMKQNRQ*
STRLTIKLLLSMTRPPSRIQVLRKTFCMMNYRRIFIIYSTRFIFRYQIQLLI*S*PLVTS
FFAAITVTIIVSSVYAERLYDLRCKI*CPI*SPGHLLFDGGAISRDDLFKHKTDNNA*KV
DIRNAH*YYSGTEAKFRKI*KHINIKEKKEEFRDCYEK*K**QACKSS*YP**IGHRNYR
KAQRVIIRTILKNNIFAGGKNATGSHSSERKPPVSFG*LHFSRLQGIVQHRV*FIF*YKL
QRSRY*WI*NLHCRTMGCPEKNINSNHFIYGQLTRHHICSRGCSSRRS*GMAMLFEEIP*
RIVEVF*SKKDCQRNFICYKPFFFQIYAKLIAC*VW*SKENLEKLQNQLRPKEITLWWSF
SSAVKKDT*CLNSEVCTVI*ISEFSFFS*NNVGFPTTFSSE*QQLNK*HRKYSC*SLPCG
RTNYPRANIT*LFCAV*IQEGERWSLMQWNETIP*KMVGNIWETIPRH**AEE*NDPWSD
YGGITT*SCIDLLLQINGRRLHVSKRSV**RRVLFWSLCISKEIRPIQKQ*TDLLRRTNN
**II*SIFQDFKQRYFQV*KGCEVNCSRHDWQRKLYASIQ*DPNN*FRYPGKEYTRWIPW
*ALEREKCFEKGNMHGLGKKNLSKFQV*TWRSILTIGK**AVLWYECAK*TVNDFQ*GGQ
*YATHKEK*YI*YCQWLQIIAIYLIHVL*L**NPLQKYQQP**SL*GGVF*AQFDPIL*R
WYTRY*KNIC*S**DRWIVSLQFIF*GTKRNRAVELAIRFISHQISKRLT*DTKSNVSST
SAR*NT*RISGKKFTKIIPE*SDV*TKLEQIAGNV*EM*ERF*RISLGIW*HAKQTANFG
E*EKRYEITFFETEI*RSYPR*TCKRC*SQRRSF*SQVRGC*KKASGAK***RHIYGLRK
SL**I*I*QFYGLYSAVPTD*I*RAVF*NFRQEKSSKVKKGILEMEHLDIRYLLIQK*AQ
*GERYTMKASSFRYCCCRSIKSDNA*DTLISWRAIYL*IL*KFVILRILPFEGCIFNFLG
ELYIYG*SLGTVSYFLLSHYRCHIDFLPFYGISPLKFLRKLQLIMLSFFCSEFREILRII
EKMKINYHLSISTYKVKREGNSIM*NIGVLYSRGKLLVDSIVDEGYNIRYTEYTRSASSR
I*EYSKSIFLHKNITYYSSFRFIGFIITLSILAFQLPLTSMTASHNLCHHLNTVYDNILI
V*LLVDRQ*WIFIPTVSYLFKCLG*YIGNDMLSYSEMQHICYILNSFIQY*IKRLVNFEV
FVGRSKLHHALLFLCI*SCILSS*NTVISALFRYSRHCLR*SILF*NVNIPR*SGGSMVE
LSTPIKSWKFHGIRLQSKGCRFNSCPFHFLFLPYI*RSTL*IKYFFFS*K*CT*VDEIAS
VTGISLPLSCY**YILIIISCFNLDFDLRGISLPPFAYYKWLI*VYSNFHIL*IGNCLHI
ESHRIKNRLPAANLEFSRYVTISIFRIFAKPLAIKTSWTGPSIIAIILETSTNAIIMRIY
FGQKNYLKLRIT*FILTL*S*TCANPKIVNYLYCENTNYNI*LTLHNIVLHF*LI*SLGV
NCSSLLNSAVIYKANITMLHDMLFLAR*KHCSGFSKISIPSISKCHNIKF*FALSLVLFN
HYNSINQVNKTCCEETTQT*RSSSNSPSFDAAIHSLS*VMAKSKNVPYHFLFNPVFNKQV
PHFN*STHHCALKRT*FIR*ETEIVCKVIQAPFFTK*KDLIVPMKQ*FELLPFPGFFGQL
V*KCTLPLYWALIECLPKN*LFKK*KQVRQ*KILQFYE*LFLFL*PGKKKYKHLSFLKQL
YFASLNS*DKKSLIRKVLYLTTLENICPDQVHLEFIFFRSSKFVGLITMEEKKKILRNIG
FSG*IRDTIFLLG*SSLVLLISSDLL*FPIFYLMCA*YIYELLILLVLL*LA*LAII*SY
MFPINILCTNCRTYNFSVDYIFD*RPRVS*KANQLRNSLEIPQ*KVICNEISNEISNEIS
NEISNEISNVISNA*RYKW*Y**VR*YTSYNK*AAMLQN*FLTFLRIKPLPVA*ISRILS
KQSRYEYFIKNNLLYHRW*PWNWF*FGQNFKRFYGQYSYNLYSWITFITQEQTSGRFSKN
QEEYPYCPT*PYKGRKYWQYCGRDQENAILLGY*YFYRMFCSI*FLLQGPGNSQISLAQP
L*HKRSGSDTSPSKSLSTASFEKDEEDILYL*CCRIYQCVCTTFCFRLWSIESCLELCGK
DAQF*IETGGFYCRCFSPRYGIY*YGPIWP*SF*REEYRHQRRKYYHTRRKCLCAN*CLP
KNFTRR*WKVLQL*RQRRRLLDKCKFGYLYTTQIRNIPLCNTLFYW*VLYDVTLLLPHAP
LRRYFVASLCMLIF*RLTRFETISIMSSDFN*DGI*LVLEPKILHIRRKPSLNIIDINCQ
SEKNPRIYFIMYIPKHFESMELSRYKLSKKPPLGTLFSSKASRQGFFGWRTSSNKDDPDF
GMCASHIPFVFVEFDNGEHKLIAHLARKNKHVEMLERVQKCLVVFQSVDSYISPAWFPMK
KKTHKFVPTWDFAAVHVYGTPRIIRDDKDWLINMLSTLTDQEEEKRPEGENVRSKVERF*
CPRLLYQCYASKHCRA*NQYYPYSIKVQIRPK*ITD*C*RHMLKIQRIWWRKRPRNGSPC
KR*LSR*LISFVFSLRIKYQ*LFIRFHSFLILSFNIDLTEGKAHRDAERTQTQRFTYSLQ
LENHVWRK*RKIFTVEFTTKYYPF*RTLISSVSSCLYDDDFPKCKQTKAFADKTNP*IRK
KNKKKQTDMGSSTGFHHADHVNYSSNLNKEEILEQLLLSYEGLSDGQVNWVCNLSNASSL
IWHAYKSLAVDINWAGFYVTQASEENTLILGPFQGKVACQMIQFGKGVCGTAASTKETQI
VPDVNKYPGHIACDGETKSEIVVPIISNDGKTLGVIDIDCLDYEGFDHVDKEFLEKLAKL
INKSCVFK*EF*ERTSIYAHNQYSHVALLSNILSDGHE*R*TSRKIEGLQEIIGEENIPC
SPN*QLSIFICNPYCKFMACLPSNKGYSAFIKNIFAW*EKNVNENDGDI*RKKKLISPRI
ELGTFCVLSRCHNRLDHETT*LLNNGHLKSYL*CSKFFFSSPQSR*RHAYFAVKKKGTFK
MCLMRNCDDFLSFTCMISVKILARFINA*KQ*VMPQI*AFLCGEVFEKLSGLYSFHMTIG
NVEKRA*K*ALSNNIKLIIFWMR*SYLIKIIGDIVLPGLSSSPLKVSGSLLNTKSKERCA
TGRGSIPLFLFKERSIFNHICIQ*SSVWLHRTTLQVPCM*ESHANKKLRKIMGFFVHAGR
SCGSSVTFLPSAKGKKEKKTQREN*KCGISTSIAIRAAISRNNAKLLFRL*GPRTVRF*C
RQWKKQSYITTEPNVTCLHLSAPANFQVRLNGSHLVTHKSTTLYIINYNAGKPFRQLPLR
IKYFKEVKWALFSNTKARKFSKSFKSNSGRNRR*RPDGRPQHRIFNSR*VKILDSNECYD
GKIW*TVRPILAVISFSCFIFTFLIVNAGGC*SLASCSEQSLYTGETFCYRYWRYSFFRK
VFL*IFQFFLCRCMF*LLMHSTNF*FIKL*RFFFFSPLYHKFNSYCVE*LLMENICSILV
FFYLFIASKGSIILIGVEVNRTSE*DFSKNVLKVKHLALGNFFGRLLDKD*IVLCSDA*L
ERKVLPILQSP*HLKYLP*AKKKSMKKKSIFMLKSSTNDHRFWT*RGEENNIS*NSLC*P
KYFSFDSGLLVH*IFSGTNNVWQQ*TNVWREQPFLWIKYVILRWATIATTKLSFWK*Q*Q
QQFHQ*QCPIRIWWIHFCRWQ***QFIWK*QYSK*WGIWPVNGCHPKLTIWVVKLLKCQ*
WEHFWRIQFNGFFWW*YQ*CI***Q*QYQFPVWFQ*TEYRRDLVWFAE***CRYF*FIWR
PKYKYHWHIRKHRK*FRNRLKWQRL*HIWGREQLTKQYYRQLVWQPTIFSVWDK*STRKS
IWTAISKHQ*CVW*SKSAGGQFLRIKTSWFRVAVWPEQQHFR*YNQ**KWIVWSNEFQ*P
RQF*QWIVWTKLDEQQHSRGIWTKQ*SNAN*WQ*QQQFIWKGKHLFKFRIRRFIWPK*ST
ARVRAVWSKFSDKR**WTFWAE*SETAQYFYPI*YRNRSLWTEQQPATTIYRFVWSQTSR
YHRISFRW*FINPA*LSFRYYQCTYL*YTVTTRK*SFWCHEADQHALWRKSHCKPVREWK
QSIRN*TCLHYRLIIWKQHSFYDSTFHEWIVW*QR*QFN*HYEYGTFRCKA*FSVQTCIR
GRVIRQFKLEFFHNRPKQTSFWRHNPKYRTLWRHRHELFSSWFNW*TFWPE**YA*CWYT
KCTTCEQYHPKRPFGYNGSSFPTTSPSN**TAFFQNINP*LYYKSS*SNNFKSERRYEKK
**PHVCL*TCPKAVICSLFEWRC*ISKVGQDTGKK**RKQYQQFYYGPRIKLSKFKRLVV
*SR*KIFETSGD*K**ELKCH*P****SKQS*ISDVYNRISFKR*PSLIKHCCFKIN*KS
TFSSD*PKR*S**KHS*SSIEISKWFHLYTND*E*KD*QQSSRPIEQRRYLFQE*LLHFT
FHRNAWQ*VIN*TS*NKQPSHWSQKLW*SRVSGAR*FVEYSFGYFMRGSCHLWTKIMFNI
*KLFHKARKGRRH*CTL*SDFIFLFSY*QRNKETYKEYNTSSTEKKYSQTKRKPSVQV*K
L*PRNRHL*LHHRSPSFNLNRNNFCRESLYRLSSLDVQLIDFRCIVYIIIVGKQKYLIVI
V*PKMPDQQPWHI*MGF*GDKNEEVL*PL*KNIDLFSMKVGGIARCRKVVS*NKNGQTMK
AKGKK*NAIS*NRTRVSSATTMCTNHYTKMANNCEVFGYICTSG*INIMYSLLFYVKPTS
GDCKEALQRRTDKGEKYVSC*IIVGIPLLLKAIILVYRIY*KFSSRI*ESTKGNR*FYIM
LLFYLPSFYMLSFIILLHYQSLHFSFH*IG*LFLNLYVIFSHRM**YNIK*MILEFNSNK
RGVVT*AFRNGEFIAVSFSMKGRERIKYTRMLVPLHFPIYHI*SYE*KSDRYRMSDERAN
ERNIKKAY*N*QVKAKKVDE*AL*CVQSDFFVGIKINYHLLTSIYVASILSYTVLEAGAN
DEK*SSKLVEAETQGLIM**DQ*MLTYKTMIIIFIELCRITDSLLWIPKSLRRTSSISTY
LIL*P*SQWNPNNYIRIH*VFIFSYFLN*FLFVSIGLASKSIK*KGA*FASFRVFENEDQ
FSSLKVL*FGEPII*SERLSTSLAHIVFLF*NRLSIEYFIKLSGSFRKNIS*IIPGKMSS
QTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFP
KMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSAPGTIRGDFGIDLGRNVCHGSDS
VDSAEREINLWFKKEELVDWESNQAKWIYE*ITYGMGGYI*APFFSRFGQLISCSLTS**
YNEFFRRSTII*KKYHLCCYPYIRIYNT**RFNDA*CQMLLAPSEIATLPSSFRTL*YHR
KIQVGKGLLQSRNVRCSYGFSE*SCNIRKHAYRHYYR*FIALGLCRGTSK*AT*NGSPY*
MKHLRVPNP*VDRATTVLLGLTVSPINLAICRDPKLKFLAECIY*TCS*VLSRTLF*GLW
T*L*QQKLK*KKAYIFK**DLIF*NYYNGQVGDMYPQRILSL**GLILRNKHLD*WSVLW
VL*FQFYFICFIRTIANIVKLKRYTKMRKKFKKLLYKGFRI*HRMVNRVTKLNLFFLCLS
LTFFRLYSKKIKLVTYNAYIHLI*SLAFYFSSIFVLRRDQRSMSTRGNTYIHLYINISI*
FPFLEASAAATFPG*FFSSKYFSRFLTCFCRPSREICFFLSSS*SLVESASFESFLLFEE
GLFNFCFSCSLIKPWYFTSLLTIDMTVGIQIEKYNMNPEIYIFL*LYALDASACIGVTAD
DPIEPLLSLWYNETRI*DLFHESINNRPTRQPVIKIIVFICCFAVNWL*VLKIPLRIRNG
KGKTKMKSITISTVSNKNNVVKYKLIAILFILLGFQYLPLCERIAERSVAMNE*L*TRNY
TRSHLAYISIFALRQRV**RPLYVNVSCDIACSCGLHVNCSGHKQYVSRR*KTLQVGR*Y
NIDKPNSLRTP*K*WCSAFMFSPFFSI*VFMAHLKYSAASTGGDLRRNFWHKVKLRKST*
AITSF*YVKPSPGCR**YLAL*IYFCTIVYLYNYSSFSGLVVRIFSFDD*VVRIATLSLS
PYFDSKLRE*K*EV*RRKRLKMSTDNSQKDEGVPLLSPYSSSPQLRKKKRNQKRRKDKFV
GHLKSDSRRPTQLLHDNLQHNHGQITDFDQIDSWGMLHESDSTSNDIIKSEDPSLKGAFI
DHRPSMSQPREGPQSVSSTVQPQPIMKFSTPSYKKPAGLRPSDQNRSLVSDLSPSELESW
LKRRKSVHKSFVDENSPTDRRQSNANNDVVIDVDALMNHVNNNASTGVNDNSKRRKKKRG
SDDSSNKNSKSTSSDSNDEEDEYNSRPSSSLSSNNSSLDDVCLVLDDEGSEVPKAWPDCT
VLEEFSKEETERLRSQAIQDAEAFHFQYDEDEEDGTSNEDGILFSKPIVTNIDVPELGNR
RVNETENLKNGRLRPKRIAPWHLIQRPMVLGSNSTKDSKSRIQSGLQDNLLVGRNIQYPP
HIISNNPEHFRFTYFRVDLDSTVHSPTISGLLQPGQKFQDLFVASIYSQDNSAGHIKTHP
NSPTPGIKAETVSQLQGLTAKNPSTLSSMSVANIEDVPPFWLDVSNPTEEEMKILSKAFG
IHPLTTEDIFLGEVREKVELFRDYYLICFRSFDIVAEKHVRRRRKEKQESATLDHESISR
RKSQAYGATMSNESNANNNNSTSNASRSKWLPSILRARRRSSANRTTNTSSSSYKRRVKS
EKKKMEENEKFKRKSGDRHKPREGELEPLNVYIIVFRTGVLTFHFAPTPHPINVRRRARL
LKDYLNVTSDWIAYALIDDITDAFAPMIELIEDEVYEIEDAILKMHQSDDSSDSDSSDSD
SDSGASDEDAFPFDVYSKKTSYSSAKSSVSSRSMSTSEASFNANLIGWKRKGDMLRRIGE
CRKRVMSILRLLGSKADVIKGFAKRYNEQWEASPQSEIAMYLGDIQDHIVTMVSSLNHYE
KLLSRSHSNYLAQINIDMTKVNNDMNDVLGKITILGTIVLPMNVITGLWGMNVIVPGQYR
DSLTWFIGIVLFMCMLACSAYMYTKRRFGF*FKCFFAH*RLLFLRF*LSA*IIVVFPEG*
NCKLSAPYRILVVINIFNLFMFFFFFFFVSGFYMFVNVLHIFMYVHSMLVCTYTIQRIRE
VRLINKVNVKHLLFSSPNCWKF*IG*LSRISLLAKFSLARSCFSFWSCCFCSFLSLFICF
CFSESICGFKSFSKFFTSCCFATSLLNFSLGTLACCGCLLLVASAAPPAAILV*SLALAE
TSEEWLSSLISVSLFRSE*ATFITK*TPHNSIMYTIIFFIGVVR*PPLLLELYLLPVL*R
GKRSFFLLISPCIFSIIMNHFSLIYICSEYPSFIYIVLLLWRGGTYVGRQ*HSGKVLTLN
VNDEITFFAFLKDWKTVTEKFAILFFFFVFFFVRILHSLLSRCTACYPAAQHEIAHVVPN
YI*VLTLFIFFAFIAEFLRVALMFLAFI*TNG*R*TEKRGKQGRWRYCA*KQEISTV*HT
FH*KLKAAKDEGFSKFSSLAV*GCSESIYRQLIKTSTLPSVPSCCQLLSLARKELCFR*K
MQHKCYDVRHPGPLKAKKL*NLKNNRSKRNNCQA*RFF*FSEIRGGEKKRGRGLLTGIVS
SKQSFCQH*EIIK*KKKTYIESAAPGHFERGKKSPKIRSSKERQPHTKKKGKRWGWL*ST
SAGTDP*QFLCGASSRLLVGTVVRSGW*R*QWPGLLGMVP*KPSANVRLQEPAFSHEVSL
LAAYWSFLEPENPS*N*DS*AIRFAHCYSPDKPNPPF*ERLTKVSYLSKVLWLFLGFRLR
AFLPS*CYTCFP*MHEHTCRYLNFIFMHLISV*ICI*QATAVL*CVFRNWSTGLRIFPSL
SVLFPEN*HL*RKELKREISFLNI*RLYQFGFFFFSSY*KQYNASLRT***FRSSRKQET
RRFVYNERAKRIDGPGIEHNQRFCYFF**QFCEQ*HIFAGIYLWSILNGFSA*NGRH*YS
NFNSDN*YDC***FNEFKGYRQFSYQLEVEKFQ*RTVRE*R*ETKQ*C*W*EKWW**DI*
FSSHPSSFK*RIEKLGATRKGIFSNESYQ*QSF**KYRIIATPTCNFSQDKPS*GRTFNI
FQFVSRC*VTKQRQQYNRIERQ*L*SRRYQ***Y**HAINLRGFCIFRRSIEVHAGRWSR
RKKIQRGGYLFLSFYDGF*KFDLSFDRVLESQSQK**QQ*THSTNYP*RYCHY*EAWINH
FTYYHYKQL*SKLQIIRS*RFSSSERL*YGFF*GLWYNKAKKHFLFFKSHLP*Q*HHKAT
ACLFALNS*Y*IFCK*FGDGKSSV*FRIISFRRK*RRCFWCAKLQ*LRCNHNVGIRQ*RR
PLQHSQVISGSGSTVYQTLYDVVG*CLCCR*IGDFWC**YHTYTSFPKKKL*YLDELFVQ
NTSY*SSSPCSSTSSTTTY*TGNGKPKHKKKKVVKCYFKSNYFS*QQQW*GSCPTSEKEI
YYYH*PQQLR*K*TFQV*RL*EGIQTQ*ALEKAYKIRSFNGTPFCLYVL*EKIQ*K*QFI
TTSKNSQKAR*FLKKIRSKANKSKTSYGMTSFRRNNILSSSVYKTSRLVISFGYILRNEM
NIGVCF*YNLKIF*IVSFLFCLSNYYFNFFSVYFRFFHLAD*KNCARSGFNV*TSNIFLH
TWYFLFTFFIHIWFFYTISKINNN*FNNKNMLL**LLIYNWEAFKDWYDVCFLIIKRLAF
NLFCRLIILLLPSYLLALSSVLKGVGKKAK*SDTSITQRFIRIHQVY*IVMGEQNKLYYD
VEKLVNSLQESFDLDCAQSVSLFTSKSRSNEAWLEELENKFKLKDDVELDDVENLRAEID
MKLNMLEDKVSYYERLYKELEEFQNEIKIKTVVNNRRQSRTPK*AIKNDRSIRMTLK*LR
SGLAVNFKRE*NSA*QKMS*AFVKISYVVKF*KSLFPSYHFVIDLQKKRADQ*YK*INKN
NIPLFLNRFNTH*KTISINLN*LIKC*WYGKFPKTW*S*HPWSFHLL*PRLLGRRTSCLA
FLDLLGYRLGTLCSPSCSRRSL*YQSSKRIDSQCPS*P*QHRCQYQCGILGQ*NRNHRGR
PRTMAFLPCNQLVLWCTFGVQPRFLVSKRCHQRTNRDSYRKQQQWRSLERLGAKPCRRCK
LVLAWCTSLPCQRFRC*HHLLHHR*YRFPFLTIGP*RPFS*ST*HK*RCFLHRFLQTNPT
CGRRIMVHRVP*SKLHQLPTYHRTMATTSWHSGQSVRQLGYRKLEQWI*CSGQRQ*HP*W
KHFDLR*RYPYQRSKQHHR*RFAK*LGTCCL*QLLKQRRQ*KKR*R**LE*RTCVP*RK*
ISCGHLHQR*HRSFSLRFVQHPF*ICITWLWLYMTKEKEEQKNNARKNNN*N**RSIMSL
SFYNKSSAEIR*TT*GIKFNVGEEEGKKFL*GRN*SDLLIVDFFFLRSQSQKRTDKWY*P
SNTFLEQR*AHAFPLVTCSVVRYGKRGCSRQRDSN*ARKRGCHVFPTAARMEKGKIEESH
SYHYLRNDPHIFEIFNYYVLR*SCCHYHYYLYRRMQRM*SQVGNYLVLSVLLFIS*GLRQ
LDEDL***PLEA*RALETWGKEVYRKVTVLVALAYRRYLQKLEGWYCCSSQRCQLDPSTS
FS*FLAGCHL*SFRVVPLVSSKTFRPPFPCPGRVLKNREGYRGFRNWGIQSRSLPVHFPA
PLLRNLCYSTCLSLPAASKDHLSRDILNRQEDL*NGLFSKWFHHHQFDGSLFSFGSLPMI
VCLQLVPRTCLRP*S*SFAEPSLPVSLSRDLFQWILKTSLEYLWFF*FFFLQNLDRC*LD
NF*SSGLYPHNDSTYNLVAVGLRFLVQNSYSSVT*KKQVWLQTFLLAFVPIDFLVWQTY*
QFFLLPLYH*H*QWL*QCVVSFATLLAYQ*HTLLRSQELLLPHSL*VDCVRRMI*LLEIF
LL*H**I*V*QRHHRRIPLLYLGCKFLIGNLCRHLVCSLE*FPFSNQILSGRYHQIKFLM
CFVET*SGKISCYSCYTIPVSADMMRATEISVPS*LFLLILCWP*TWLLTICLIFIIIVL
TFSKVTRLNYNVVT*YNGIRKVIAPAMD*GSYIYRLYTT***IYQVDHPFLCFKILYIHN
CVFTLSKKRVVMNL*LFIFPNIYDLKT*KNIKKKC*PKKLKKDR*ISSKSSMNFQVAWQI
MSSARQMSNMN*IVNTT*C*LHYCCIAG*ANFTNNNIFLTP*NTL*NIRPNKE*VEDALR
G*EGDTGYRR*Q*G*MAVPGYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFD
KVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVEDSHRDASQNGSGDSQSV
ISVDKLRIVACNSKKSE*YLCYMPGCFVDQ*LH*NFSIISSLLPLLIQALGTVS*NNVLY
SFILGNL*FFCFCFLFFLSVHSCNNNLDLKFNLFT*KTNEDHGANIRI*VDQFFK*SINL
QFIYSL*TS*LIS*IS*SNHFTSV*NPLIVCTIKAR*NVDDH*VTFSLSNNIKISLH*YV
LVQYFCSSPLAFVQHSKTIKFLKTLPITTP*IL*QNTIHYFNIYCTKI*LAIV*MCVTQA
QKCAEKIS*IYVFL***LEKICSYCVGKTLVTQSQNIQDFFKHSEVD*KI*IMNMLFFFE
VLQFFNLNFF**IFC*LRYTFQSKFLAVISIK*ER*LIIECRMPIWNCKGAQKIFPYTIT
VIVFTLKVF*ECRQFIIDSLRIIV*LKNFIGLIEITTTK*RHGKHKFLHLVVA*VEGAFN
VLEKEPYILMRCVFNDI*AEKRHKERIFSDGSIVNIRV*GIDIGNELAVVKKFDTEREFR
RILEKNFRQQTLILSIKV*Q*KLLIMQIQ*CRYMLSENFGIKIEQNEC*QYL*SNTIMYG
K*LVKRF*GNYTCETIEFDCRDEILFPKYTRLHLVID*II*NNGYIKRV*FVEKNL*ICD
FKLIF*AIFENVRKFFYGSHRIRQLSCYYIKKLLRNGSKNII*QSRSKTIQCP*ILEQFR
TISFRVHIIKPILHSSIQLVKGMIIRLETIDENNFIAIKCYRRSLVECGFYVSQYCF*IS
QIFFIFVMSHNNLIFTQYLLCTFKNLGTIS*FQITETPLNISSLCNDIQIMFGLQIY*GF
VN*FYPFIVFETFIIYV*YL*LASSATFP*NDQI*ITSLDIQLQWSR*N*IYN*PNSRS*
KISGDVILKSISQNTA*INQQGAHLKKPIFQRQQCN*SIVIQGKVFPYSFHFSKMAWV*I
*L*NHIIILY*SK*S*IPNFQVAILSQHN*VSFME*FTTNHTIVIRFRTPRKKSR*AFQV
*IIIE**RLVMYAVNFF*TQQTAIFQKNN*ELG*YIEKEMRNSNCKVVGILEMKPLSIES
VGR*K*ET*G*L*R*KRTIF*DNINQ*LLFHFLYR*SVSLIHRSIW*VYINCLPMVCVTQ
RIKCQQC*S*GKMVTDILRVTQ*QTIGIFTSVRLRNWCRDGLISFFQPVIITVITDV*IN
RIIGFRFFIILEQICINS*EACHNRSVVYE*NCDLLKNAYERWISSISTCFSASHAISIQ
FFFHVIGEKDRKTKNMKVL*GNGKENIDELYISTAIDKRVLIKS*NN*KRPNAC*EVIRK
FRYL*NQRIEAKKLMQRKKRERLHIH*K*ERGVLLSNSNTKYENFSNFARLRSFLPQYRA
SRWQQMEWYHLHGSST*QPWHLGPWIHQ*RTPSP*KNQ*PS*RKFEHPFRI*ELLLG*FL
AT*L*QPSCNP*CRSRRTSCQKRFVVDGKSGQRC*PFQHLLQHHRHHLQQMG*HRYRCCH
LRH*P*HSRLRR*RHQLT*RRKHQTTIRR*RRYPCK*SYLSIVCSVLIC*PQLRPQKENC
*KAKMKVVNH*MKTLTKIKFFFKSQLKYFSL*IS*KEEKKVKKKKKTNKKIKKYQFYEKC
VRNR*VLFCL*KILENFS*RKKEKKET*CENVFTELIDIHIEQTQIYYLFRFSFTSPKQF
YCIETRLLPLFQRVRLYRLPQWFSPAFL*PPLANFGSYRSL*LNLEIS*NT*CFLVPFLQ
LKLL*IWTVRL*RRSKQMYLEPSFFRSVEWRKYLRWWVEQIDH*VPAISFATSSYT*YRC
LSSSQGS*S*HSLCPEFEMQWFLHLMILESSLRS*SISLRSSGVHYLTICYMGRTMWNIS
VSRAVYL*NIRYRHMTHSQASEAIS*NQLL*HIAADMIIPIVIGLYLSRCALYFL**TQV
*CNLNPFEITFDILPCLYP*WHLLLSQQANNAFPDFSSPTSIPMYSCVFHSSHQLQTVTA
EILTL*YIKQKKWHFQNPAK*RHS*LDR*HNIYIPFIIYVRIYIYAKFK*YMTSSKGYGI
LAQTLKKVKHNSGNKMCI*IHCILFPISFFMWEVLLLPY**KPLEFLEL*S*PL*PYGTP
CWAAAAAAAAACCCCCWN**YCWNCICCCGLTGWPFCI*TSGWG*P*GCCCCCCCDCFC*
ESSECWATP*FGLCCS*PF*VW**L*LFFGNWYGY*PATPY*G*PYGNDCW*KWA*YGMN
EPPYGCCC*GWA*AVAGEAAAAAAALVKLAAAVFAPA*P*PCWKLYWLALPLV*ALF*AS
C*YC*P*AYPCESNIPG*EYPGNWF*YM*YCWAATLFPCF*LCGLCCD*GCCD*GCGCCC
CC*AYCCCWDKYCCCN*CCC*AYCCCCC*V**F*DNCSSWA*A*ACTGCCCCCCCCCSCC
CGCCGCCGCCCCCGCCGCCGCCGCCGCCGCWDCCCG*GTVLA*SSGGSEITALISTFSST
TVTSSSGAATLSCSCSSSSAVCSSSFTCSFFSASSWTSSPSTSGTLSSFSSEGSAVSSSC
SCADVSCSLTFSSLASDFWSSFLISLISFFNSATFSRGDSVFLTAFGFGVAIAAHDIFFG
CEADVLEVVFFEDKEGCSICLCSSLLLCPSCCCCSSCSFS*FFSCACCPCASNSSLLLSF
ES*GTSCLVSTETAAAHDVVFETGLDGTCFPLSRLTCFPVV*ARGVCTFFLFLA*V*LLL
LLCFVEVKELLLLELLYVISSSGFGKCC*GTYECCCSFFSYFSFLAGFFTSSHLVTAPEV
ILSIIVSKSSYS*TISIKSSLVQSGNNSVSVSILDFSAGFSFLLL*LL*LDFLNCVDIIY
I**CRLY*ENDQTKINM*VLYDGDFFGVIGKSFSCSFKRSNIKYECF*NYCKRLRKRNET
FIWERTKIFPFPATTFCHHFPLFIWASAHLRRNHG*RIS*KGKELKQIY*YTDHYTLL*V
DIAVLVFTC*IMHILC*NIYFICQLLLVCRHFQTAPPP*LRLEQA*YLV*RELR*HM*YK
RTIVLSTRSQRIFPSGIFRYTIH*NNYRISSSGQCIQAQN*LTLYSPYKTGIIVIVIQVK
TQTDVF**PLPAYIWRT*NKFLHANTLNILNVALPISKKKYSGPITLRSDIHH**KLYVL
IYSIYS*KNE*WSQALVLLSYSLLHRALRCYHPLVPSGGGAPASEASSLYYCCSHRRYRR
RY*YVLHEPVASAFYWAQSETVPCWN*TRTAAAKVAKSFFCGFVSVLYFHLAHHQLHHDP
RL*GLFAPLKAPPLNQYLRR*SPEVSISVPWMLYSLCGNHLYCRY*T*NGHPG*HVQLNL
PR*AHCLSGTAYSPLQRM*EIYQHYCSQGF*LERFPLVQLHLPANSPAQSLET*SPAIRC
YP*SAHIFLNM*PRVG*CPG*SYESRNSS*SLSSAGSL*FLDQVFPMFPLCLQNPFFVST
IPYVALSIR*STWLYSHPKL*ISILLMPQLTKTNQKNGKKKRKRTETNGKERKRKQEKLA
VLLPARHYRI*SE*LLIKQGPPFLYDAPDISHFHYNSASRTG*GPRLSMKTNTTVLPAIS
NSKHLPRLFKNEDLLPLCGLRALFN*RIRGSKVNG*KKKTGKIATFFSLEDLSSKRRRMK
PEFSLLLRGIQFINIVIP*S*DLLI*HLDN*KPK**DTIFCGIFFPLDTFNIHSKKFCYI
VKTHRRYKQ*HDSI*KSR*LAVHSTLDCLHSMVWYADSHAYLLGQSRPSHILVHALGAIP
CVHFRYRCH*FKATVYIVRRLAGSRLCNHCCP*VFSKIRLSAFPTEKKRPFYL*FHILC*
EIAQR*ILNASILHKG*TEPDFRSFCSRQHW*TSPFIQFHLLNRPVPSRSHCYGLCFRRL
HVPIHLLLDCRVFPHGKALCLSPPPSQPSFQSSII*KKL*PRL*HCG*AALV*MERPCME
*IYHQCNSKSYMVNSRSCMGHLFWCYQ**I*ECLFRMVASILVWYHIYDSFRRLLFRWKI
QTIPLFQPRGIIFGLLQV*QGARPLPQ*RRFAFGR*RRRDCHRNSIFKYLQ*FLFQRIYS
SSRMTSYMLDLTRKYPLTCKIYSSFSFQSTI**NLQEHRHHFPLLFLLSPLLM*LIPNSM
LLNLYSSFPFAEEFLLAAFFFDIFRIVHNGHCVKS*KLKREYCSAYVV*VGKFVLLLMYL
E*ININQKNKKKIKVMKKNITKPTLRYILQRVAAPVIIKRLIES*ITSLKKLSLGEVLES
LESRTLISDPS*SS*SSVTSLL*SFSIEP*EKPLKDRRPLSLQWVKSCPFFESI*STTGS
LFIVTDSVLDSPCLSAFLLNKNCSIVMEPPLFAAGLEDLSLLFAMESSPVPSTAWCTLYD
FTSSSINSFSLLEVGVLGPSSNTPLTPVIDLALAELSISFPVL*VERKRLLTTSFGDALF
PIGVTFSLLSGVLMITSREKLELFFDSSVPLLDLLAVSFSSSSFFSHSRSIMFLIIIISS
TCNSFNIHSSVAISASSFAISAEITKGSFTVASRRSFLVGIFCFCTAGIAPPASAVSPKP
WIAVLCSAMEATSLSISTCILLRSSKSSSYPLSEFPKLSKCDLTA**CSMLEFLRSLSHA
SFQSFNSSFSPDRFLDNLSCSSFLRFSRFSLAFSSSFSFCCNLIFIFCTN*SYRCPSSAF
LASFSCCCFEAIANNNCPSFCSFARSIEFPSSYS*SRTLDLLSISLSTSRCLLARSSISF
TTGDINFLATALTSSGVIHKPPPKYIFFFSSCLTE*CCRAMLTASLL*AWLPNKSM*VSR
ESISCNFLFASF*ASFSTTGDATCFMYSFFCASLAAKSGSSNVFGSRSLTASAAPFAHIY
C*SLSLCLSLPA*DSKNCSAECSSFSKVPFLKTSLLAFDTPL*SLLCNPFLKFTFWGYNL
SLTLLIALLSAPSNTLDKSRDLKPAGCCGLTKFASNSLPIGAPENLFFLTLELSEVPFME
LSKEGLKANAFCAANLVKKSRLPFRPKLTVIGTSSGGVNGILEKVTLKASPLAFCSIAVS
TQSSGETFVLLLAKRAARSTDSLLESPKPSVL*LAGVFKMPYFCFARNIASLLNGCPLCW
*VEYIVFSL*TLFEIERGVSGAARCISEECSDSCKVDTLTAFLSVICSGDVWTDSTSVVC
NADISDIIVLYLFLKFYCQSHSKTTDLNSCDHFCLDIVENMVLSMKIFMC*IPSLSASFS
IMYILQKYPLISLKKK*PLPLTFDLELHREI*GTAKNVLQSQQVNMKKKLSTAESTCRTE
RYANMTL**PYLKHLKYLKSI*TPKKGKIGSSPEAQISLNKLSPDSSC*LHVFLHYSNSF
CMQRQEVCMFQ*SYQIRFACFL*RHNRH*LPT*ILIFSCKLVCNFFH*PCKWNFGD**IR
GTLVFSNFVQS*FTRSIFLFDAL*ALLSLFFPPFLSNISV*GI*MSSHWCRYFSFHFSFF
FIFCLDF*ITCLVFVVCFDI*VTF*AFITSSFLSSWKQVLCRSCSLQ*R*RTIVNRLLVS
CKPVDVTE*SSTRITLNSRTNPLLFT*HDYVILVFFLYSVLLLFFIK*ILKIIYYCF*EM
FSQYLSMKFCFSFVFNLLPRFRDTVGSR*IISFDILAIEDH*TLN**MLMSISIINDGIL
*ILSLVLLIQMQMWVICRFYIYIYVFTITK*IN**SYFTSAIRLSANPIRQISSCSFIYI
*PLSAKFRYVFTSSTVSRMSLSSEFMYALKLRILLE*ASFLAPELLTVRFPTVLSISGEL
GLSCEQLIWVLFPFSLGELFSLIMALIGVGIFNDE*EDDSLLSVFMSEFCLSLFTVKLGK
LSFDLQKVSKKSVT*MASSPNDEQ*SLESGEDLRTVVEKHSLSGSSSICIEGVTLLVADT
NTLSFPFPEVFFFPFLVSSLPKNLLTGPSFLTGFTLDDEI*L*FLESMGWSRDKTFTKS*
ILMRKVTSFSNNLLMTKSFKVLPFILELNDTSMILW*VSNSFSPKNGSSLYSKQYSVTPN
DQISNLKPSVTKSLLELPK*HSSGAINAGVPTILFNSL*KQSSKLASLKGNDWGVKIQLP
KSESFATFSSSSNKILDGLISR*IQP*ECKYSNPFVISSRIFLANVETLQFEITIFFHCG
KISSSSSRFHCSSPRLHQLVTIQIDSLKGESKHSISRTI*TLFRSLEAAKISHLHFSIFI
SLIASLPLIFVVIFPLLFQSWICLIT*FTEYCWAFQGFFGIILTATTLPKVELYAFRT*P
NCPLPAETPSVYWFIVFLSWSLTVIFFTYGRISSRIVCIFSPIIVL*VGFC*EKEEPNED
VWLVGVIGGLSNSSSLMHDCWDNGAHSGINVGISCRGDISC*VIIVNLAFKK*YLCE*VC
NT*RSIIGGFSRPN*FIGLETVALFICCYLIIHKLYV*SDVKSCYILIWHNLC*AASFND
LLLF**LLHFEQLNSYFKKDQVSSSKHYEFRR*RTNYKAKCI*YYSTFKLKW*KTGNCLH
LLK*I*HEKGKYHNMV*KY*WCGN*LKQY*I*IVTSRYSRTN*RCCQFCSS*RIRCLSNC
QDDNL*LRHRLFQTKFVRYY*E*QSY**E*SSNVFSWCNYRCPKCLIR**KALL*GNIPC
VCCQQILKLSRKFTRSMDKAA*S**V*YF*KVF*RE*PRAHG*KFSRSL*TFTQRKTAFG
*IFAILDKEVRASHISTLESKSPSVKDIDTSSSRRIVRIVQFFGLLCLLNINASKKLDRK
PCKR*IY*AYFHGINIRYSFSRVVQKGERLCGYDQRGNFVV*A*NLRHSSQTYFELNYRR
ITRKRSGNSYRIW*TKQSNSS*LRGV*KTYTGGVTRGCLYKCDMSTS*GDRTHIMATVFN
*WVFSFNYCRLSGSAISPCK*FQDSEARFWPRTQQFRNTDR*KFSSLFSPQNIKSVQRSE
GCHTKK*KY*FRTTDYYRSFIFNQVKFGLL*QTRSSIRQGYRP*MVPKKH*Y*QPTRMFG
KSLLTTRNELDHVREIVYVFVTVFYIYMYMVNFT*IPW*ITYTTLLLVHSLKIRESR*NT
YEQRSPFFFFFHFFHFFHFSFMEMLSFHKFCIKRLTTEHMRQLKYQ*QR**YLHLPLNP*
*YLMVPNLWVALEYLLPHHQQMNHHSLPCMVRVYLRPSC*PLLLRRTFVHLDHTYHPKSH
*TNSIHRYDHQYLQNMISRPQWQMYSTKT*FGS*FLALVVQ*HLRNGQNRL*RNVDLYYK
NLDLDKQLHTQYHHGKTLGKRSKTLWFLCARGLIP*SCKGRQSQPTANLDYMSIDMRSLW
CNYHQC*HHRKHTYRYH*KLSSHRPSTRKLFRPSQHMFDYLYILLILQLCETRHR*KRCS
CNRNQSSKRKFATSNHHHRNRHPNAKPWY*KQPVLNIAIEAHSRED**SFSPRQS*QQYP
KRLGHHYLQW*IDLAEYSHYHHQLDVSLLL*FHHYRCRYP*KTSNLAYSPRHHRLPTNST
DLKTYRPSYHTDYQCNNPLNRRQLVK*HFAKIRSCLDPIRRHL*ILLRRVHPVTLSLYLL
AFLCVRF*NRLKRKKAQKKSGVYFVVSTIICPGKVSLAF*PFRIL*FKPLFTKNPPVRTP
IKLLIKYEYQHSNSEYIIDEPIIQRVPMIIMKSELYFHLPVFFLDVRN*IAPRTGAKPGD
GTPLRI*YDTLIHIWKHL*RIFIVRYIL*IND*IFLNQQL*AEIQCVHETEHLTSSRAQK
HGVGLFPLLQTDMETLFLSGQR*YDRSLLVSILPYISAAHSICFFLLIYS*LDLKLRVAG
NRVKLDIKSCDFAKVNFLLSTSLQFAQL*QD**LPRWSNQ*QQVKHNKEKKCSGSQKEEL
PQGRILVHTMILSKANWT*ATQMQLTRSS*VQVHLKKRKNFTLGCMSLNYHFTIYHHREK
*RWNNLRSGQSIVSKFC*RSNLAFQETNRSKKLKPLSSRSSKNYCLSTQRV*KTEKRITT
LISF*DCAFVVQKNCGKNSSGLKRFCSKLDLTC*PPPIKQNLFNHWTYPYYSLSQMKKRP
NYLISCIKQFLRLYSSN*I*TRNIKENSISNRKNS*NYLSKM**NW*ETV*CF*RTGTHI
YHNSSN*IYFLMSLLAN*TRS**KRTSTYQD*MRMTGCYQF*IIFRRGTLSRISTSKRQT
NSVRT*MMRLMRKVSGLKRLAQTIRYVSKT*WRVLKRTII*GIMGDNN*VCF*KVSA*AL
MKR*NFGLRHLQEMGT*QWRSSIKNTVTASGIITVLKVTESTTNHGTVTLSFPSPDLGAE
IIMDALSVIGVTRDYLQNCAL*S*PKRRSSVFWIPARKVNTQLLALKCLK*HTTLHQRIW
KLASKRISRILTYTSKDQGNCKRNSRSWKRKNYSIMVIISAEREKEKSEEITKKD**YT*
FSLL*VWSKIFFSEKKKKKEKR*TLYNTSDCTAPKTSEICILSEFFHTLIAGQRNLIILW
LQAIALFLCDRQHRTTNRLSFMPVHFIKIYRFLPLQAGTLSV*TCNMLQGLSTPIYCGRS
YCSGRTTFSSIASATKKCRCCVFWIRGWPLKRMGGTVSHRFGNAVMQPRGSGFQERK*KT
GKI*YFLMQVFCD*KV*KTILHRSLIRLRAILLMDIVFIFPWT*NGTPSSRINAVGSFED
*KSSHNNVTCKISPLEVRYCVDGFARCDDKY*GQCVPTHKLL*SLQIVKTNSNRTPTPHG
NKLECCGMNDNFILGKREECNAAVYGLFSARPIFFFCFFISIFSFHANGYYS*QAIM*EC
GNIILAHTTFS*LFLFQVTETPVAQVA*AKSSSEWVT*L*RFRVRGCQKGEPELYIYGCI
SLHIKLISLSYSSLLFFPSFVCKRRRPYSLKTPPHFSFFFCFHIGRTLQLEQYIKSIKQS
LSFYCVFLTTLHISPQFPAYNFVVLFFSTSSS*HYTLIRPLLLFLCWNS*FIKQKICTMF
LK*GYITPW*TLNLTPQ*HPPEVTTIPFLRLTSYHTRVQSIFHSSNAKLQTHMLMLPN*L
RRQLRLNQGIIVAIMLCLFPHIHNNHNLHINKLYFLMPPFPTAISNHLLSL*WQ*CLQRF
NLMDHS*TPYILTQSCLQSFKTLMILASHVQITLNQ*QQRHQQ*QQQQEHLASVQRQFSN
HAL*LRCGKMRILSATK*RRTVYQSCVGLTTT*LTAPSC*MSRR*QGGEGMEY*DPRRLG
KS*RLAPCTSRVFGFLSKGLISWLNVNRF*IICTRSSSKI*NPLLMPESPATRHL*PPNL
ALPPSSKNHLIINTKLLLKLSRRVLMLYRMEHLLRVLANCPT*KSTISILRPKQVEQKMN
YHKHIT*SVNSLLYEQEPKF*KG**DSYNHFYGRTSVVTRYININNGHKKKNCNIINHKI
IIISISNF*LLRNSLESFHHVDWTNLYLSTSNILYIIPVFLCCYCGGTVIFSREKTI*CL
FETCYYLIF*WLLLRVVVGEPGTK*IKKHLLKNIK*SKEGNTKRERWLVLHKSGFEHNQK
KTTRTFLQRQKKEKKNQENESFIIAFFFFRKHERISHS*AIFIQIFKALRRLL*HPVSIF
QSDSNE*RL**RGVTYQCR*TGTRGIQTEYRIYQQSCPTK*RT*LQTERKAERNIRTQED
CRNSALKARKIC*HYQKA*RPKPQPTDKNKRPRKETF*R*FYFQRNEIPQGQGPHGR*RP
CLRKL*SDKCTKTQSTGCYR*SSYN*QSLQYFRPR*QTKSH*KNPLGPHKLCYEVRRR**
RQDVTLTFSFKYDIANK*SSEFSRAKEI*SNR*GKSV**RYHDV*KCRAEACRRRNRGAK
EKNTC*EKT*LKKIVFK*PTPRAAKHDGR**QYKT*QCFEA*SCYASSFFPIQSRLLTLF
GCLLGVF**FIREK*SQA*K*YVRNIRNSHSQ*SMMI*KAVKEYGAFLKRSV*LRQKIPS
QNRKSLFYFPLLFSNRSRKRKGLLY*VFSHYRIYNKNL*LLLFFQFSLTTLNLRKYIPIL
RIDV*VRINAIGKQLK*L*MVDG*CHNILMNIAFDDIVLAICGSNGMA*THNNEVGIKIC
YTNNFHLSSLYLTYICIYTEQ*IYRCISLSTFSSLGGSFLGNTKFTFDGLYKKSHMGARP
*GATEENQIGPEEKWSKYREIVAGTHSFAK*NPAAYQEICKEERC*DSSTICKRTVPNQ*
TI**NVHFQSAVGFCSNEDR*SNQNEHFVKSNG*QCGLNEGGKFIG*TTSIEKYDD*IRK
GTYEIWDYK*NGG*YHGECWGRRGRDGRSC**RS**DS*TIHKREIQEC*PSANRRISSQ
*RRARNSG*KS**GSR*DGK*NA*KAESFAKLECYCDCTKKINK*VNK*WYE*HSKKGTR
F*CMEKVECFTLFP**PLKHVRTIK***G*RQYIHTSFYFRLILYFHLKDGIFTFHGLYF
YSIPTFFQAYQIPLMLFLAQDP*SESLLSLHPHSASTWTQYRTSKSLH*KSMRYMHLVIL
NKRFQSLDPTHGNRYHRRPPRWLVLFLYLSALQSIR*PLHLLR*VQIWAYLFCSHLLLLL
LGQHGILWI*HLHRKQVAWLTNL*FQA*YYSNGPFCLY***ENHHLSLKTPLLDTAKKFA
VLTWNG**GFHQCS**LYSWSHASVASRHLWREILKHFHLELLKS*YELISENLSKKSET
SPI*PLI*TLLVNFLLFCLDYAENALCILISPLNTLLFIMINKQYCK*ITEIRKT*IIYH
LIR*KAISTITRTPLSGPIDLMKCLL*RS**YKLTLSMLLYSMYIVLSSRDRRRFNFVFK
RTMDSIYVVPIFFYGVLCALNIVISVMLNIIWELLPNLQPSCIPLFG*SVVL*LLLSCFA
RFRYCTRARHT*AWSFK*CVKKRT*RKR*SKIYIGVGIGRVEKKT*PQTNSQEDQLFCSG
FAG*KLK*NIFSVISRNSW*KGSKFTETKSVRAQ*EYISFADLSNYSPASYATF*CS*KL
TRKR*VKRIIKYAQVCIPKKIGRAK*TRLYHSILKK*VD*VMSLIQA*SLQSMISKTLST
*VCNCRMKKCIIFVMIMQLISGFVKRRIVMSLLFKMLYMIHILPQIDLWPIQS*RFLKMR
SAFMILDTQ*KKPDFIVLLRSDHRRLPSSTLW*ISGMLMVSLRAPRSTNCHYMVFWRSHT
LWRWRYIPSPSGSTSMNCYHYKSICWPFLYF*PQKPYLYGLTMI*KMKKVILRE*KFIWC
SCRY*RLVKLHFHFSYY*LSLWATVSCTLS*IKR**GVAKCMVR*LMQFALDF*SKVI*P
TWRHHLH*S*SP*FLWRLH*SYFTT*LLDP*QKQLSI*KSKGRS*N*TCTRSYYTSFMRP
F*VY*LVV*FRHLFTLA*TLLI*LRRTGGQGSSLLISGLR*CISLFSLPSRSYGDQQILH
TC*PHPNNYPQTQKMSRTLTWAICNRLTIKMTQVSSLVSVA*TRMTSI*ILLMMKKDTIM
*ITIAKATGQCLPLQQNNATSSRFD*VMRQIVSSRAVTKCLQAKRKKL*TICTSVQCDVN
MNMNINMNINK*INKCVARFFSFICACFYLFITVVTKAMLYSRPNFFVLYLFSRSLEFFF
FR**DDLYQTETSEKFLFIDYKMEEKIGP*TFHVYLFMRRDAGRPEVRNSLCSRMNNEAR
*RKVARCISANLISFLWLFRSFLCNITCIFYLFMMRPRP**QCYKPSSSIRF**KGEDFF
VKRSE**NIHATTFVVTCLTLPRERIIRVEYHFTGSLYSV*LLVKPHDHFMGTLPQVGSF
IRSFTTIGKSCSMCANIVYRFL*RGL*APETNNQQYIKQKLRHLTNNPSFLKWQVLDS*N
MSLLCAFSFSFFLFFHVAN*ARRLWEGTF*GKTGKKNSSN**KFKK*KKSK*EHIS*EPC
LEF*DWSIVHPTYSALSP*TSLEIASPLYYIVQNRSRNFHWCNNNTLLRFSHLSRSCTLL
SNSNIFQIMNELNTVSTNSSDSTKNGGTSNSPDDMDSAAAASHAIKKRTKASRACDQCRK
KKIKCDYKDEKGVCSNCQRNGDRCSFDRVPLKRGPSKGYTRSTSHPRTNEIQDHNNSRSY
NTFDNSNNTLNNNTGNSGDNGINSNTVPSTPSRSNSVLLPPLTQYIPQAGGIPPSFQNPA
IQSTMPAGNIGQQQFWKVPYHEFQHQRKGSIDSLQSDISVRTLNPNEQLSYNTVQQSPIT
NKHTNDSGNANGSVTGSGSASGSGGYWSFIRTSGLLAPTDDHNGEQTRRSSSIPSLLRNT
SNSLLLGGQPQLPPPQQQSQPQAHQQKLQQGQNLYSYSQFSQQQPYNPSISSFGQFAANG
FHSRQGSVASEAMSPSAPAMFTSTSTNPVNVAQQTQRPQGQQVPQFSSELDGNKRRQSAP
VSVTLSTDRLNGNENNNGEINNNNGSNNSGSSKDTSQHSQESVTTPAALEASSPGSTPQR
STKKRRKSYVSKKTKPKRDSSISITSKDSAHPMTTSSTIAYGQISDVDLIDTYYEFIHVG
FPIIPLNKTTLTSDLLLVNTQPISNIHEVNSYVILWFRNSLELLVRVALKQKPGGKFFDN
IVGVALSPSNDNNKAGFTTATARDDAEKTRRDSHNEVQDTLEVQSVFIAALNECFQKIVD
IHPKFRENNDQISPKIKVIYLSTFILLNYILAFVGYDNSFVLGMSVTIFNEFKLYKLLLF
PEPDINDVKPPVDEEVSTGNGNTKTSEFEIGSESAGHMNPSNSPNSMDENISHYSVLFKR
LYVLLSVFDSLQSCAFGGPKLLNISIQGSTERFFSNDLGSKWCLEQSQLRLKSVLQSLKL
GELMSELTRNRISMNGNRKPGFDITNSSSLLSEYVETQPLSVAQLFCKLLIGKHNFINCL
LSLYDSEAGVYSDLTLDLSSKIADSLCSLISIILQVLTLILRLNPTNSIDFNYRPPNPPA
NNPTVQEGPSAMGSSPVAGNLSAAPPSEGNPDFYKKLLGLKQDTGTILSDLCRGIISPFA
IAILHEVYNITELVKQMPTSLISIMMTATTTQNTQDTKKSQDLVMKLSNSMNEVVQITSV
LTMIKPFKIFEHELNKPIMSLTGGLSSTTRNDVMWPKSGQGLRESSVMKTLLDERRTSGT
QPTTAPVAAEEPRLENVALENFVSIGWKLLDDSELGWY*QVTMLPSPVGQVLPSPQAEIR
VKNYHAMNDQFK*NT*IILTYTYTH*LF*PVTILPCQSAHGLLLWCSTIFHGIRESPSSG
AHADNGRGAPSSFTAKGVFLSPTFGILFQGQKSLLRTLLPPACCYTWCHHYCHCHCYRFN
SGACKVQSSGVGLFSHRSLYSVL*PDPLPPPLLEQPDALPLLFGLGPFLHFLSLFWIEYI
NLNKQQSSSSRYHEIEVTVLGVGDSISGSFHISNVKRPSPLPII*YNFHSKCTIT**CPL
RSTPKHIPLMHSRATQTALLPHK*ETP*TSWRTLVNLTMLLALSLRTNWIRFSRFSGDIW
*RSLLEPPWNGTRSSLPTRMKWLSMKLFLSSPRMSQTFPNWLF*S*TVGWVPPWAALALN
LLLK*ERETPFWICLFVKLNT*TDSTIATCHCY**ILSTLTRIRNT*LRSIPLTESESDL
SINPGSQESTRILYCLSPPNTILHWMLGIHQVTVICLNLYTYLVNWMP*LPKEEKYYLFL
TVTTWVLPST*KF*TT*SRLVPNI*WN*LIRPEPMLKVVL*FLTMVKSVYWKSPKFQKNT
LTNSKISESLPTSTRITYGSI*KQ*RG*SNRAIWRWKSFQTKKL*QETVMKLMSYN*KPL
VVLLSGILMVLTVLSFQDQDSCLSRPVPICCWLNQIYSVWNTVL*S*THPVLVQTH*SSW
ARISKRFLVLTQESLTSQKSSS*II*PSLVTSF*VKMSL*GVLSSSFAPTVIKSIFQTAP
YWKMLSLLVICKSWNIEGAACNPFFTFNSPLGYLFYYTQFFFFNGLYISNIYTFICLDLY
RSKKKCKRSLVFIILHSRHVIYLLSVASVYIEIFLWRGKGL*TLGK*NKRKLKVTSSDRH
LSIITPKDIVKKQVQSRLLHLSRISTNSGKKGKSYSKRGKSTVWKSMATLWCS***SFSY
FSPHRVVMVCLLNMSSINSRDSSSSSEQSTIRSSI*HIQIVFEILPGLNSATKTC*IILS
KMPLTHYQEKIMIDGFPIKTTWFCPTMS*RP*ILKSGILRMMTLPTFSLPILQAPC*VKS
TLYQITSTKR*GCLYPDSMSRQLIFQRIFLLKVRRTGLSGLRMANFIM*VFSMAK*LFKF
LI*AIFRTIIIT*GEIS*IRKMTVGSC*IFRLISQIRLKRKSIPYTRRLYMTFNVVEFFL
FLRVLNFIHCSPFLITCPSRMIIMRKYLMMSRNSLMNFGISRITQMS*P*KTYRMLIIMP
TLNVSI*FFFSWNHGISTQEIRSS**MMN*IGPWGVRQICLVYRP*MLSLDYCILQTVAY
D*GFIT*RVHGTN*K*CRSENIYCSVLHYLQPRYTYCLLRCIIQIPPPWSTKSHSIVSQ*
*T*SMVPWPLCTLSQLVSFPNCTYP*L*VLFRALSWHLFLKYAT*FQFTLHRLTNRMLGL
STSCVVTLAHMMRIGQDPHSFPMKGLSVARYMVGFSLC*SFSRF*Y*VQLHGPVS*GWYL
SIS*SSY*THIGSLKFSVTPLKVFLQEEKEQDLALEEIEVKTKCHYCGVL*LVQQ*LEAC
PLCMFSLTPLMCSGTIKMFISSYFYHCGYCFKLVYCILKMYWDRAGSCLSTQYLMDIRIS
SPFQTSIYRSMVVELLNIPLIARYVCLMFQFT*RKFQKLIRWISTLTW*RLVITYFILRV
*KTG*IISYNVLCVGHHYLRCR*HLLILRTIYCICIQDPRYRDISYLSTIAIRNFT*IVH
*LFITTKVVLLKYTIGKLDLG*FTRVFSVTLFPYDTFFEELIIGKILPIKIH*GESKSLQ
LQVGES*DRHCLPITLLLFL*Q*ERKSKFLFFNKL*HIL*Q*RHVYLTWMVFSSTQRIFI
LKL*MKLSQNLVRDL*LGM*RLNCKGFRDRKQEKG*SNTTNYQ*L*MSTTKEMLHCNLLN
GVLANFFPVH*IC*NT*S*RTFLLHYVRLRTRLNFAAKQVI*RKVLIFSIPLSLVMIQEL
QKVGVSLSRTFGSWV*RN*MRSFIPILSPMSV*CSKMVFQA*NQPRHLVHTLFGSPIQKH
MLFWGTQKLC*PVKVNYCLLWKNWKCPNMDCEFPVFT*TIYLYIALSIKRDDLYLIYHTT
LCGELSYFCIIYYSTCLGFYRFISISLQ*NIIVNMHIERKDCNSWCSKALCK*IQTRMHL
RT*EFHVLNFLGSLFYPPNHLIQIH*RYWHV*KKLKRSYQHTKTIHFRQNLQIMFLFLSR
VY*NSQLSASLKQNTSY*LYFISYGHVGHLMVNSPSNWDNNCSP*SHF*SVLIKIIKN*L
LDQTSSSTLVV*SCISFSNQ*DRKGTIKSSFRTQNLIYFPL*DILLPFC*KFWSNRPKIM
SFNSKLWHP*KYYFRT*YLMVKCFPLFFRGTFLFSLRYLLNQAVKYIIRCVFAR*RFWQN
YWFWFTMILVWISK*IS*QIFES*AIQS*NTR*INHLCLMDLLFCYAQMGRRIEIQVG*R
QLLGKSILLWRPLYPNY*NVIMNQLMRH*RHLYQSF*LDVKIL*IIVRKCWYPL*YIWSV
IRCPNYHRIW*N*RKLSMKTCTS*VTLFGLKMQIGYHLYHLQSLF*RKITKEIQ*SMR*L
DVYLNRLMNLLSHQV*SIIKRE*LNKVVN*QLQ*ISKTWKVRML*LLYQDYQKTCHSN*K
NLHTIWVLCC*KDIFSTMW*QS*FQNKLIHQERRR*LRCG*APIL*RLWKSNRRRKKSIY
NLNLMPTIPLPWLKKCV*LYWNFAMNFLKTLAWRLKVKA*KKVMSLPYVQFYSLLKRFVR
**EKNFNQN*LTIYTQ*LTPWHHRPKPLGM*ANPVH*G*QIPYIMGLSQT*S*AT*IIL*
NLFPQD*ILG*LNE*AKY*W*FANWLAMKPLKILKMLLKRYLNYWIIIMDIVISVFNFSN
YLKSSFWR*RKNISMMMR*F*K*LINTFHKVLFRPGV*PIFSKYSIY*IKRHRLKMT*QT
RTTSIF*RMIMSPVIFKNISTPN*ESQIATTMKKKEKKRWKEVLKSILTSGPHLYHQIHT
KYYCKFWVMGKDY*PIHQND*ECKFLLL*GLYFPCYQHSIIC**GRLLVHGTPSYSASYA
LIIRSFSPHVHAWSR**NILVILSPRDSLNFGRNCVRILLY*KN*GLIQRCTTMRKNRLV
SMSNSHQ*LKMR*YRWYIWC*KGSKLQSI*FLKRYLNK*YIVVFRLFQWRKYHLCH**WG
ISCGK*EI*IKLMWLNICICIW*YSGLLLLTLFTPVTIVITISN*TINVMSDPE*GMICD
FRISRAAKLKIF*FNFSLRFISMKDMNCHFG*PMISVTAIYTYLILY*EDQLLFSVGSTT
CLLIINNIF**SIMYIYIYILPARPGIGKQKKHFS*LKWINTLINRDYVAGEILAINKKG
NTHITNEAIEQTVSK****PIYASISIFLKKSKIIYTEWRSSSYFRFGVPLHLEK*VCYP
ENIRYTKGSSNSGHLDNPNILRVVTSTHLCWSEIVISSID*YLCY*YTLSHAASKDDMKT
EKQS*DSMEAQNLGTKLVVQVFTRLTGLSRQGIV*CNKFCLLCNECF*HVSNIFYV*VDK
SPLCIVQLCHFKMINFTD**VSWSSRLWHLLNTQNVPSSILGEIN*FFWLHHARQLSSHS
IRGKLEFGLSILQKQEGGKTTHMRICIQANTYRLKLEKGKEKLLLNKVKFVVIGNRVVQY
KTNVEKGIPYSRCLRGIMLQWKTKVVYLLFIFYDRTICSGVSQ*HVLLLLLLLLLLLERL
LL**NRRRNGRIWVGTVTVASGN*VDGICGYVLDTVLVLHDFSVHIQIHVHGLM*VTGWV
TVWIIFVGITTFPFL*SFLVSFSVFRLFGRV*LAPSFTDYLGNFD*TFIRIFLDDGRSNL
LGELNKGTRGSLWGQSLFVSISHNSVLLPVGSEFFVEWFFLIIR*LFPPCRSQFRQFGDL
CFRELLKQLISYGHRKQEISGRRSLWALLFQLFSSLNSALSGR*FLHHWMLLLLLLLL*M
MMLLLKLLLLLQLVLLL*LLLLLQLLLLL*LQLLLHLLLVVSQLRLQIGW*QTRMSSGVG
ISCSISCRGRVQKTRQSVHVVRVVSLHLWELRQVRSRASSIVCGGRSSRGRV*LGGCQLG
RITASAVIAATNIVVVTVVVTRRACTRDRRVCLFLS*MT*KGVVKLGKLLLIDRRIVLAR
SGLLHVTEILR*RVNINIVV*I*VRISILLLLLLLLLLLRLRSRLRQRLWR*WIINILLL
LLRRLLEVTLIRRLLLLLLLLLLLLLLLLRLGLKLVQVLVRCLVRSISVLGVVVFETLIL
QRMVLAYVE*VGVRGVVLFGRDTGVHCSCGYC*RRTYITEWIEEGDIVVVLP*LALPCLV
CV**SSLWDIRANKLQRHSLGSSSC*AVT*Q*RKQNTMQYDYGTEDNEVNHIYSENERQK
ERENECAGPCLYLAPPADVCIFFLFPFVLSPRGGGKEKKKKKVRKVRCASPLLLLHPDIT
PNTKPRAAVVSNRSTHSSTVCRSLSTMCMFYGYVPIFSAFGIIFCFDNYRSCYC*LLGLM
FLCYCCCCYCFYYCIIVLLLYYYYYYYYYYYYGMSSIIFFLKIKKKIVQIYIFIYYSIWF
FFFKCRRWLCFVYNWLVCTDGSCWTLIIGLYTGSHIWALTHCKHSSKSRGTLTVSPGAPP
GTCSCSIRAVPSSSACKITAVARRAEVLVMVSRPGSNPGLESPSLSGDNSASWSTAAEII
LSVMVVARDSTAPKPIPGKE*QLLFSEIR*PSTGGKGDPVATRALLLVHFIKSAGTASCS
LVGLDNGKMIGLGLCLCISSTTS*VNAPACVEQPTKHVGLTFSTTSCKERVLIPAHSASL
LAYTCWAGVELAS*DCRINPRLSIKKIFLRASSLSTPCVTI*FTI*SAIPRPADPAP*IS
TLVSFKSLLVCFKAAINEAITTAPVP*MSSLNDGNSYLYFSSNLLAFLTPKSSKCRTALG
YTFLTALMNFSKKSSYCLPLILENLLPMYNSSRASFLLLVPTSKHTGSTRPG*IPPHSVI
NANLEIAIRTPPIPWSPIPRIPSESDTTM*STSLSPPYVANLHSMESGSVMSKNTPSGFL
NLWE*AAIASPSVGV*MIGTNSLICLLINAKYRTLFCTLKDVMKSFLAKGVFK*HNCL*L
LSSCSSKVFTCGGSNASKLNASLSSCVNAEPLLNKGEFKS*KLSKGHSMAPSTVKRVACG
*GASKIFLAREPTGVLVTSSSLYGFWKVFSLVVVALCDLVLEEYKRDC*IGHLLNGAVLD
AVKDLVSCDLAATETDSLVLSITVFLPFVLVFMCTKLVKSCRFQKHKYPKLDTIYE*V*R
YAYIYIYNMSIMPVTGTTSKLYSAKAVDQRKSNGAYAVQ**EIAKIFHHRKAMMSRSQGD
SVTQSADAMRC*RKQ*RVR**NFKCANSFFFFFFFLISFHISDLNRLGKSKNPNCSVYTW
LYGCFFFDAFRIRRYAVNIFQSP*TVDKTQEFEKPCNARCNIQFAHIETNWYRK*TRNI*
EIFLTFLPSLRVILAL**IAIIVVMIDTG*RAKDVQMIKKQKNLEV*IVPWANFRLLL*S
GELIRNNTWFFFLVFY*ALPCVVII*AVLARLGKKLIKCKLGSMIARPNRAKDRKLLEAA
AAVSRVWIDL*MIL*KIF*SSSLGGFMVAPLYWYSMLYYFTRS*LKMT*NNC*A*IRRNW
GR*LLD*DQTG*YPYTNKENTLQTQKVWKEFTTM*NILMLLTQSNGRSIKSYKD*RMTWT
KIQNLMVTCVRFV*PSTHNWKLYNY*ILIGQNFYVPYVMNRWWKMILVKKTKRSKIN*IG
*WTKFSQSLIL*KRLMIQELRRILSKLHWLA*YHLKINHMQHTRTIQRKAAPCSDREILL
HCQILWVLLLVTTVVDVPVLTLKPHYTSTLPRQVMKWLKGNCKRDRLKRKENKTLSLNGI
NRVPSVKLLLVDWIMKRSSIL*LLHLPWIL*ILIMNLHRKHPIKITEL*PSKKWKKERMK
RR*MITTLLWLKSKQSSIKKKRRRKKKKRMRKKKRKKRWKMLWMITMKLLEKMHWKMNLK
T*RIQLAPQRQNQTPPTT*NKNRLMIRLKTL*MLLPLLQVRVQTLNQMMVMMMMMMMMMR
WTLSLRTFDMVRFF*ILPTSSYNVEPTFPFFIFFSIVSSFS*NLKKMREKKKNTSGKNHM
KKFQKKKAELLDIWHLYSNNKNITSENIEV*KIFFRAYLVYIYLIKNLNL*KAQKDCFII
QPKYKNNMVEKDTWKLITATALFTVAVTTITDYAWTSWQAQKQVIAQQKNKNKGGQTKSD
TDKYHQYDEQFIRQSLKNNVEFLGEDTIEKLSNQYVVVVGAGGVGSWVVNSLVRSGCRKI
RVVDFDQVSLSSLNRHSCAILNDVGTPKVECLRRHMREIAPWCEIDPINELWTLQNGERL
TLGNGTPDFIVDCIDNIDTKVDLLEFAYNHGIKVISSMGASAKSDPTKLNVGDLATTEED
PLARVVRRKLKKRGILSGIPVVFSAEKPDPKKAKLLPLPDEEYERGKVDELSALKDFRVR
ILPVLGTMPSLFGLTITTWILSNISDKPLEPVEGKNRIKVYDGIYQSLAGQMSRVGIPSQ
RIPLALKDVSYLVEEVFKGKSPISGISTRLTLTKWDPSKPISLQNVVVLTKNEQKVHEDR
VLKGKESLQDVYDAKVLKLVSQRFREEAYYSQFR*SCSFPTYKAFSSIELRTIPGGFSDS
YHIENYFYASSFTSTCLCLFVKLHYLIS*K*KT*ISEINKN*RKINDEACDGNQY*NFSK
LNH*KGSLGQFSFP*STKND*NLHILLRKNTYAKQDRRATVDTIARVTETIQLYVFYFHS
YHHFSVFNFVDRKLNLFFWWLIQ*FFDYWTKL*WPSHA*KPFNHLPISVYHKLFKIPFYH
FYSRLPAY*IL*ELVDGILLLPVATDLM*NREGYTIFILTELINLFILLELLISELTTGK
GHNH*TM*FVFFVQVL*FLVLRCERTMRCYIDYQNHFVTQGVEGEWISVFIYW*KRIKFL
HRYL*ILCFSAYIPYTGSQSENLAVHNITYMTKIYLYITVLYNHLILFTISNLCSRGEPR
L*VLLDVANKG*IAYPIELGNRRGKQIRKIFHMKTVVGYVKGILMYN*YICVYLHYLVLF
YWVMDRKVDSIKSFNSL*DIIIQFNSSGVTNINFS*IPASNLFKHLRT*VKSIIGFPFES
T*WNT*S*NSIMGNLVPDSDQFMSILDSILPKMQFSLLTSLNNLPFSSSLDKTDSMYSV*
VCDDSRTMNILS*K*LVRS*MLFLESPLSDIRYLSTSLNLSSICLMSSID*GVISSNRYS
LGAVLLLEFSILMDRLNNSSPKYL*SSCCCPSMVLPPEDTTVSVSSLNKRSIKLQCDNLI
LPGSPVIKTFLQFNVLPILKFCEWIEFITLVS*TKYIHK*LFVIGNLGKLTKW*SYKDSE
FG**SKTKQIDRSPNLVV*KMSLNFIKFVQLIFDHI*YILDILFGFIDLSMLGSLFKT*A
LPS*LEKTLKSVVLFKKSLLLKFNGTKLK*SCTILGITLPEEGKTCKIDKFFLVKSSLIL
FGMKS*SADLSLGFNNDFNDDGCSGAYR*YCRRL*GGG*IRGYLRLLLSMGGGCIGGGTL
LAILILLLLSSVAFIFMPPEFAMEGNGKECAFALV*IEEVEDGVKMGALKGS*LELEAVV
GIDMLILLLLLLLFTNELLTIGLIIGLTVEAVAEVAAMAILPVAFVAAEVVFVTVVKESL
PTVIGVKLADTLALNLGTDVMVGVVASPTSIGGGTSFMVVAVVLSLCLKGQPSFSFLQ*P
*IVIFLHGISFAQSGLILSMA*DTSD*SFRLTYHRNSAPAIVIIALLIHKPNNLAVYFKV
TL*RSDM*GRAYNHFNIYVYILTYIYNIAVTYSVNYIKYVLVYKLSRIASWTSLYTSSTD
LSQRTRTTFDLVSKYSMTGILVSLKVLNLFLMDSMLSSLLPLVLPRSNSLSNMISSGQSK
NRMNLLSTMSLSKEMA*SIFLGNPSIKNLCLFALTLSEIALRKSAKVIS*GTIWPSLMQF
LINSPYWEPALPCSARRRSPADKWTNE*SLTSFSH*VPLPAPGPPRTKITETWSGEKAGC
DVVAAVICLIQEIQLVRSFDSLPK*LMSRVLKFLRVPTICLCVYPCFDFC*RVVRLRWSS
KVLYCGKLVFSKNKISV*TCSVDS*YN*ANIKTGEGVCD*RQRQECIALKDHHNYLKVSL
TW*KRKEKEK*KK*T*G*KYNQLGVMILIHLFL*V*EY*LRVYEGC*VGMMTH*LRVHYM
RILYTMQE*RPNPGQV*RASMNKEELLGFLLDDSIDSQKRCVTDQQAYSNWLKNDNDERT
AHEESSSQSTIAALNKKKQTEAAQEDIEELLNGLEGIIGGADPRNLKSKSKRKTKKGGSK
PREENVNTEKHIVMLEVEDFSDMSTHEDVNGASPSPNLDRSKKNEKRRKNAKELSYDELK
DKLEVTTRKSRLECKDLKKKVHGLERRNLELEQRLEELKIENQTLIEINNKLLKNTNEDE
INKSQRNKEKDRKRRERRTARRKDERKQEKKQEKKQDNKTSQSFPSSTDMNGQPIEF*MH
SNDITI*RRELETHTFTCGCL*ELNFFSFYSYFL**IYTLYLY*VVSLFLARLRTLFQFH
ICVKIIVGIITSSFAVMTSLS*SFVILIKDLLLCSQPFSHVDRVISQ*RSFFIERSLVLT
CLTH*IRLVNKWVAGIQ**RHV*L*GIFQKRCCR*IIRL*VQ*FVQMINGLL*FLRLQI*
VT*GTMNFRVFIIFLQNASKTFNGNFVLI*LSVSVS*I*LN*YCRS*TWIKIFHHFQRLL
QVFLGFDKFVLLKIHYTHFIEY*WIVWTNVICQNKIRFC*I**IHRHKLHPEKQFW*VHS
RKESGGCRVCC*CLVLFTF*GIRVCKSQPCGSKAWIQY*GFGIVFLCFTNSVQAHIIGRN
AKPCYRRLRESFR*SMRQKEKLIFI**FI*TSNVCWQDIRIKFVVFQNGLAQL*AFVEFA
LRIADIHLTSYDIYIVS*FIIFR*NLIGLRYIFRVDVFR*VDLIKILHNLFIFPKFFEIQ
RVKQVPFLLWS*QVLGQEHFESFKIFYIYQNRFTKCIPCLVKIILCKIYFPSQKT***LH
FYTAVSNWL*RIAVIAIIAHGVCCRRRWVLAEWIVFAYNI*SVIKSL*FNKGESQQISTQ
DINAIQVVPGNKFYSPYVLIIIVIYLAEPEGIIRIIGYVIHFISNIFCGPIHMLHQCVEP
PKSQSFYS*QFRNI*LSCCSCCR*CCCRQWPIMP*FTLPIIISIRSCIAIVMNILIIIFI
TNHTIN*ILIFTL*AHLP*CGRYGRTEHTILRHRS*QIIVVHNIARNGIGIRIRISRWLV
RSHNIRLQLLY*RAIC*RLVGTRSRIGSVPGLLQTIILSIGW*TLLCSCCRYVRNKWRGG
QCRIML*MLLRRRHGVSHKYPV*RFQV*CGF**LVIMCSLSTNNDITMTAIKTKLHIIFN
D*DKLFYIIHIN*L*YATILSCTHV*GVYSSSTDTLLFFNCFRFFLLSFFFSPNIIFFNS
SVSLSTSLWSPISAVSASLFFIVLYFSMLSSHSVKQFSLSPQS*TATCSFVDISHTTILP
SEPMVTR*VPNSFV*NLKSLIRFV*PNKEKAGLISSLSSSSSCFSFSSTFSNNSSQG*K*
TLPSLIPTERYSLLSNGKICVSICIRVFL*KTISLKTLADPVS*ISTLSLKPTAK*SPLA
PNHLTQVPFVLYFLSFSTAAFLRVIKFQRRIEWSSLTLMAILLVG*ISTSLTLAVCPFKV
PTVSQSFTLQTIILWSSDADNNHLLFLLPFETAASSLEEAGCENCRAVIEP**LNKVPSS
FLFCKS*ILMCSSLDPETRYLLETAKHLILNEWA*K*NIGIKCGVFAASFSF*FGISKDK
HKMLCSYEPTMIRNWFLSPIALIFLHEFLTWPLGSFRDEVP*VFNFSCSKKFSALILNFI
ILSKKKMKTV*VVFSNIKKIKFKNAK**KMNLYSVRIM*LEKCL*LTRMSFRMLLF*NFD
NCILKEVFILSLPSSTLAKPILKYS*TILDKL*NISSSFPKFDNVKHNKSTKVKGIQKNR
SILSF*KFCFLEKIVLNPTCKASNSSSSEEV*ESSTVIWAELSGPISTDLLPSSQFLGFF
GNKSSYFGSSSFKRVSILFHKDPSGSMLVLVVFGISFGFEEKSLILWVLKNSKAISSEDD
SQSLMS*PESESRIENDVLSLQLDCSGARAAESANKYFLSWT*S*SASSSSNKLELKLDW
DTFLSNG*VSLDPVVFFVNLVRMSSNRLVS*LEYLVLLTV*FIRKNCLAIKPFLVFFIIL
TLHSNNSLIILKSPLIHAICSGVKPNKSWSFKCDPYLISNETRLYQLLNAARCNRVLPLT
SHMERLTVERLLFLLNDLITSVINCSSFIFRIIFVYEFKELFCECNPALLLDGDESLPTI
LLAIFLASSSLPFIFSPTICRANSISCLSVSST*VKIAFSPVYLFKCRMSLVLLLVETLL
LLLFLIDVSLGSTMVTKTGPGLDEGGK*VTIVDSFQHWLDNAIFSPNLMIKPCLNFEPSR
VTSIPPLMEPCAGMTR*IEGLLFSATGTLLWFDISLEESMNFWGRRENVLGVDIKGSFTE
RCLLPVCLAEAALKSLVNVVRAGLDELLKPVDDQESSERCKLLSLLLEK*ISEKEWLLSS
LEEFGDGKCLLLFIIAVLVLMLFLLSLSLLLLLQLLSSIQFVEMTKFLLLEGRGNSDGKF
KSLCGDEKDLVSFVIGETWALLVLVGVVVLLAFFLSMIIMGSVIVFAKISPLWSLRRNKT
TNPLVALWCLQ*QTILVGKSKLIQLELPLKPLLLMMKSCLLLNMIALLFSLFCQMELSFN
PDFLLDALLFSLLIHLLQT*VCLKLLLLLLDAHKRKASKKRVLSLMSLLGIVKLVGSSEL
VKNLSFAIQSEGR*IKKFFLACAFLIRKLSFI*VSTLETFGNPIISRDNGRDCGLMLIKS
SGFAYGVLRGSFLPN*TCRSSNPCKDAMSSLSSPSSSLPGVVVPAVIIFSWFRLNKPGSC
REDPELSRAISSNSDSSKSKSGEPSLCCMLAL*LWSIEETFPVPLIIFSGVLLL*LVV*R
ISRV*LF*MSFVDIFSSCDHLTFMVAPCR*N*NEKSGNTTMSPYTSREKGSNSDNNR*CQ
AFQSPMLTYIHHDAIHMQLETCWEALSHF*RLQQCSRRFSIGPRDKTHQQSFAFDILLNW
SLTVGADLLQDC*LWYIIYQVLIQRTPSKMEEYDYSDVKPLPIETDLQDELCRIMYTEDY
KRLMGLARALISLNELSPRALQLTAEIIDVAPAFYTIWNYRFNIVRHMMSESEDTVLYLN
KELDWLDEVTLNNPKNYQIWSYRQSLLKLHPSPSFKRELPILKLMIDDDSKNYHVWSYRK
WCCLFFSDFQHELAYASDLIETDIYNNSAWTHRMFYWVNAKDVISKVELADELQFIMDKI
QLVPQNISPWTYLRGFQELFHDRLQWDSKVVDFATTFIGDVLSLPIGSPEDLPEIESSYA
LEFLAYHWGADPCTRDNAVKAYSLLAIKYDPIRKNLWHHKINNLN*IYVSTLFVRIYLRV
YVHARKFNLVLQTYCCIEIDLFPFVLDRYH*CVQTRPRSTAF*KI*NV*PSSASLCSTSL
PMTDIYVSSRPTDTGCKRISFPSPFLLPIGA*LPTSPLLPTLSFPTSCNMLRSDLHSLLL
LLFAV*LLPTLIYSIPFFTHFFFMQFSTSTLKKKEKK*KQD*NIEQSTSKYTVCPFSIAN
NDHRVHQ*AQPAEIQAC*KLSTSRKRLRTRNLIEFRR*WPVSTDLFFQRYNAIVQCHELQ
ILGHYSL*EIWLSLRYLYARTKRMYLFLYNEKF*H*IP*SGNKPISKIFFRSWRPSE*FE
DEPRERYVSIVVIR*IR*ALGFEDL*TASYYTKSRTKLYRI*SKWPCIRIGEPREFRNRA
I*SEKNSGGSFLDN*N**CDFQSME*IRIF*QWKVFISWLLDRKAFNF*RIHRSTIIRTN
RNKGLPDERISRFWICLFHTRW*IRPWNRL*R*DCHLESF*FNK*QSIKAARVHSLCFS*
DLPQVNCIQP*IFDVCYRRRNSRFLRVR*MTAATALIY*RI*YITNIFYLLYNDVYSIHL
VYSLQIIVNVGVPYVSVLFTPF*PTF*VLVTAPLQNFYIANNN*LPSGSCHGDVQSSFFL
KETNFKFFIATN*TQYDNIFFTALEPIYS*YFNIS*F*FIMDQFFQMRNLCIVWRNNTYR
VLRDVE*P*ILNVFFYNGNFALIILRSKDSSFICSLLKFITLRIIPN*RNFCIVIILRWR
SIDGR*VYQKSVRDRCIGQ*FPIIH*VRWKFHNFLIHPVLNVKKFYHIPFREYFDYSVK*
CGFQIVNDIFVVFCFDCGWQLFIVTSKD*FVELILMCN*WDPALWFHGL*DFIDDQGIEK
LEIWIISIKGA*FSR**TV*SGDDYSRLYY*VLNGFELSFL*IFAQQFNFVPVFFTLLIV
F*FFILLN*FVNLLGNVLHNSILFTKYIKRVSFIRV**PSRMTDS***IIRHKRR*PLQN
RIHRNIGRPTN*DSLLRIFN*QLLDQFN*CECFTRTRRTMYNGQVIVNGKINGSFLGVIQ
IRV*KRFNVLKAVCIGDEGAFVYQVLYNFVLYG*TNFRQFSHCGFHSIIRDDIGSL*NVK
FAIRIKCGSNNILRFF*SYGDLSITHFVDNA*AFRLLAIGVFRHLFDFGLSLGIYFGFCR
AYQNNITNLNITPLNFVVNRQVRSQFHI*FANETGSYVF*MYVVYCQAILHQLLDR*RC*
*PRSCLNVLFTFMLDA**KLRSQFFVHFPLLFFLYFSRDNFTSAFIFLKYM*RTRFS*RK
DMQAHICVYMTVRMFNYNICQLYKPVKKIIEYGA*YIEVKGTTSHSNCRICPCNQVRPIY
PS*PSLLP*HQFQV*SLSGRQQLIHRKVLQIEYYLRCFANPLTPWKLRILSPWRWSLRAF
QKTQSLVIVWRHRF*PAYIA*RMILSCQ*LKCFSTQIYND*NLLRWVDFAALVIVYVPHR
FSF*NSIIEWQSTLLYVEKR*LLPSQVC*QRIWPKT*SNKNIIR*FCN*VHEKFLLNPKI
VLLRYVSI*IYKLI*KSIVLVEICFTPTLSSKW*LVYLLLFWGHQDKYPIKSKRK*FL*P
AH*SRGHHVSIIYHVIYTHTSFMGLSHRICHYKRYFSAAMRWRILE*K*KHPPGA**YT*
LRRQFKAF*AAISK*PLQ*R*IRHWSN*LIDRIIAVILTSLMVTDQGSRHSIQSKQPAYV
NKQPQKRQQRSSVACLSCRKRHIKCPGGNPCQKCVTSNAICEYLEPSKKIVVSTKYLQQL
QKDLNDKTEENNRLKALLLERPVSVRGKDNSDDDERHINNAPSSDTLEVSSAPAAPIFDL
MSNSNTASDNDNDDDNSNRITNNRSYDHSLEKYYKKAISIFKQPANANGENGNGANGHED
DDEDDEEISTNFAQRSGRLIESHNGFHYFVGSSSMTLFGLEIQSLVTKYISVKNFRPLPI
NTKNKILNSNLNPAISSFINSNNYLFSSYNFLNPISTIVNLNSINDNLSPLMFKIILKSD
TDGSSGQEEVIQFQLPSYNYTKLLIDCFINYNDGCFYFFNEGLVKCGINKLYLENKWLYY
DNTKKALDNENDPILQAVWFCKILLILAVGEMYLGSINNEMLKNYSNQPKLPGSKFFQMG
SKIFNCLFSSERLENVTKKGGIEVLLLYAFFLQVADYTLASYFYFGQALRTCLILGLHVD
SQSDTLSRYEIEHHRRLWWTVYMFERMLSSKAGLPLSFTDYTISTALPADIDDETIEEKN
SHYVFRKAELISNCVTIVKINAQILSKLYQRQPETNIIITLKVVIKQLLEWRNNLSDSLQ
VDFTQKDEDFKISRLSTNMFTEYFQGINLAVRPLLFHFASIQLKRFKTSNTFVNLQNYSA
TISSLLTCSLHASVNTIRSLWSLLQNSMLAMFSYMDREYLFTSSCTLLLFNTAFGIHEQT
LYHLDHSLEIFTQMRNLGNIPAGLRRAQLLTLMANLDFHGIMNDLITKYNDILKFDSMNC
ENDNIVEDSNEPKRETEKCKPHKDGDRIDPSIIDCDKSNTNTNMIKNESISNIVSILPEG
AKPTLTDYSNGNNDVNDINVNNSEPSTFFDIITASLENSYQTTLTEKGSQVMEKNMDQLD
SVHNLNDDDLQQLLEDLGNIDHSDEKLWKEITDQAMWLGNTMDPTAAAGSEIDFTDYLGP
*HHYKDKEENTDFFVFLCIYYTFRTLYRKVDI*FFKSYLKYLSQDSSFT*PLDNIVAITF
CP*Y*PFL*FDKLVVA***FFNSVLFLG*PQSSI*CTSVFVP*STNVVQYIVLW*SRFDV
IVQNLEKRHNTVSAN*IQTTIICYPLDFVKNKID*FA*SFFQVWHIDQV*QPFKYTFLL*
HLVIFIRFNSLTNGC*NPTQFSIVYFHINFFLIVILLSLIVGHHHIRYHRDVPTTYGRI*
*YPAVCLLM*GRSWTSQ*INNSRDRKPN*RIDRILILLSLV*NPFNQHLVNAIIFD*IAI
RFFSFIILASYLLFKIHLGSFLLQRRS*I**MFVTYIGNGMTIA**ANNKLKYFAIKEIF
KFISVCYIALVIFDHFYQLFVMDY**Q*K*WIVHINTRSFGIIVVLFD*VTPCSSIIIVC
IRIGI*FRDLRPFQYVSVNGLFDHVFL*C*YQPLPFFGNQPRVSNGFQDFFLFVFDKFPR
KNHVCP*SSGVRFDSF*NFQYQLVVTGNSTGVKSQ*FLLNYWRRIYDRVDAE*RE*YHCA
*ELSIR*IFIIVFNHY**VTVIA**KLNHSLRLN*LFAHTKN*YNNVFKNLNLFDPLTA*
NSL*LRINDFDIQLIWYLFKF*ELSHRS**LKKRIGDNFSF*KVLCKVKKSFM*PCFYPW
ISKIIVCSYVSYCSSMIFMVAL**NTFQNFISFRFVIEINISGNHI*YFVKNLTFRGSVS
TFRNFITILGNGFMRKCAKIFILHVLEQSSRCYNT**R*ILDPPDTWYERWERKMFPSVK
SFQY*IIQITRHKTIYQRSSF*KG*LTHRIR*SINTNFVFFKKFSQRDVYFLN*SRIFIC
SFVQYILYKGYFYSFSFVE*FLENVSCGL*FGATHE*RS*S*ST*ILTNTC*ESIYIFFL
IQLIIVGILFDIFTTKHDFLNYFSEFH*LMACFKAYCTD*IAHEP*FFHE*SISFFNGQF
W*SEIYIPFQNFDNWEFCVCYHVASNLAS*LTGSCFEPIVIYNRIVFYQ*LNSKKDSCRI
*FVHW*SRNIH*IFRWKRRNILEKR*ALH*RN*RIRAISFLYVFFK*VKFQVYINIMIRD
LRKDIFNKFIYAYMVFTNENHVSKKKYKPFN*KLWVSTLVNVFPLL*KAHYEGRNVVILF
CHIDVLVWCFYDTRYSFVKPLPDLFHVVNFRNLKGKPLKTIH*SHHW*N*RYVEDNVCSR
QLIEQVGYSCSYHVRSIFGGC*L***GE*RISTRTWIPPPGLSRVKFLKL*VVVQNSKFY
ARNLGFLHDICVNI**W*VN*EEVGEHFTIVVEYDGYGQR*NSIILIGSQRIAQSRYEDW
*IRNSSMKLVE*NSFFISPAFLIIKCGNFF*FF*R*NY*LTG*LSYDGCFKL*GFNQRGF
GEQRWQNVFYN**SGRWNIAINFLHKLRYLKINNLVNQ*RYTKPIRSHLRVIVTIRR*KD
AVRSNKFGNVLQYFDQRT*LQRIFPRFEKA*SVEQKFIMNLKFHLVDGYRSSMRSSISN*
IFEPNAIIRKCYAKVTGSSKS*EKLICLLNQILV**IIKVMNL*SR*FI*NFGFSSSLEG
FLL*NVVYEYR*YVLR*LVRISLIHEFK*VAHNLKVFCQKFFSHEWGSI*DQCQPKLDKC
KS**VMFG*ISR*IPIG*LRLAWYQQSW*NR**KIEI*N*FLYMLPIVEIDYLFE*TKNW
IS*LRTHIVQPSIENFCVIGQYQSN*TAPNSHCTSIR*QNS*GFSQ**GSFREFPMVIYL
SII*PSLYQLSTKSSLEEHY*RLVIFGESFIFDCTDYTF*CF*CTVFELFPLGVLLPSLV
ARSIGFAMITHYVSAPLVLLDEVVPHRLEK*YPIKNITELFFAMSFIAEIFHISSTVI*Y
*NPHASRA*VKAVYYMLVHYYHIILVWSYTSAAVIINALESSIFICLRKMKTFCVRIDRL
KFNFRCREKHFNPFL*I*FKY*KNHHNYTK*LQFKSTFIINSHTHVIVSN*IVSK*FN*V
RKLTQSVQIVKFSVNRALTEKDSLSYIRNLIDKFIKICFRNKSCSGIQKQFNFTDFLIHV
LHEFNNKINQFPSFH*FSMLISY*KRNTVARYWYTSQNVECFSTLFQKSSKLVN*NLLNF
ICLFHH*THTHRVYTGLNQYLFIFITRYMHRLEQQFGASVRDFNFRSVVPLHFLRREIAQ
SQRSFQGITNSR*IRT**L*HFLLSVASSFIFCQSDTELFRKPLFAWLYRLFLFYNCILL
YKRGDVVNDMKLSTIIMYLEIWQLMTSQ*RAYLSG*QGLKPDRPLDKHCRRWET*NYVYL
EGS*RCKWKDILLQYFDKEIYVGEAQGTNFSGGATSSRKWLEGGQDGRRQSILL*SNNKR
NQLDYSGLREESRTHRRTKT*YSIPCTG*WK*NSPYGWRKTRAGTNYKRGGKPIC**L*T
A*CQEKD*RRSREGIYYHAEGKSSRLYLVIQ*NYFRTGDQRSKVLDGR**PLMEERNV*E
ISFQ*ISRSTS*GTQ*NKQIQRSLSENVAKQFSYKILHPLAYRKETNCRRTNIQTLRGQ*
KDKETDLSRLYRYPHRHSERIKKKIENTGPKRTKRVFKRYYNNIIL*NFHNLAAAFKSLC
F**E*EIYGEPALQSLNPRRCFKRVSENSKYD*KRSSKQTK*APTAQLYQRPYC*R*L*K
LIKRSANQNQSKY*MVRYLSSYKV*SALFTYAWKEWLVLP*FIFRFC**TKDVHLCTKIN
SPTDVDRSKF*ME*CR*RRDHQAKHRKSSGK*PEI*QGG*RRHQFDC*WFDKAKKRKDTT
ETPK*A*DIGAKEALFLVTFAKDIYKNR*AQA*YVGFSFQRAWRIS*IQGTRR*R*HKKT
NFRGF*A*KLCTDCRKRYCKLNVDRVKKEAFNSGCGIGLLILTCRPLSC*SLYKLYIEIT
CYFKFAITAQFLSHCCKCSAKISAFVPYFHKIQTPVRTVF*PVFLNSRVQ*YFHNFLTTP
SKTNNGGMNLPNRHLFSPPNYLGSLVYHIA*NFFFW*GHFLSYYSKLL*TRPVL*N*LNY
LLVLRLKVFFSLALFENLCYVC*ILTFLNWSVSLLLECTNMKSSDVDRTNIPYTSTWTYS
VFYSYTSFYFPS*RKESVREYSLLKLGLKYASKT*FWYVAFQL*TYLVSA*IQINTP*G*
IQAQKFQQDSSLTF*GFEKISPLDLSFASLVL*GADHY*AIAS*RKQS*KHQHP*TIC*F
FPLLSFVVVTSPKIHTVLECRFF*LLSSCHLLLQ*QMIKISVVCFLHFGSRNR*VAIS*L
SVLSTYYYLF*L*TV*P*AFVVCNG*TNMESPVETKK*EKYG*SEEI*SDSIHFLYLKK*
F*SHIKLK*KK*LKFRKVEKLLHPLQWLDKDETA*YLC*YTSAISNN*HMSLHLVDIRLL
LGHLQHALTQL*TLGSNF*IPQLEAWEIPLKIAKIIFFHAYQTRILLI*NHE*LKNPLYS
HVQRSSLCIKLP*TSLPQLVRKYPLIHPEKVLASSHRKTPLKNLQ*MLLTVFQCPYLIFG
R*RHGYILQH*KSSRIYYNPPESTQCHHFQER*MSRTTILGSYCHPYSLLCI*GILRVTD
LPIRSLTDRFQRRSALSSHWA*TFCAITQKRLC*I*SQEFYYQATIWQQMSPNIQKVQ*L
FHYWKTG*GALGTIKW*YNRQ*YQHPFRFCNYKSYNATYLTTFLQNTWKLRSKIPKSVLN
LFLLLLDIQFPVRQGYFRTWIKS*DR*RILFFLKSAAYA**FSQVVVKLRHSLNLSSLYS
YSSKVESIFRNQMKYIVGKASWYQTETKMGISWSKIVTNPAKLHLLLPMVHLVV*RA*RL
VLS**NCRF*HRSYVENPAMSEYPLKIQYQPVRILFFYKNLLTFSPH*LPRLPHSLYCYL
LNFCKI*LYVYHPIKFLSHDFA*RMY*ISHQIL*TPCQLFHYHKKSQSSFFSYDPSNFLL
LPYQLRYWKM*GLGLMNSKNAFLPFCVSKTH*VR*KKLCNGPKR**MINQYQYYLCLHRH
HKPT*FLSL*PVKIHHHHRVNRNQL*RNSPAL*EQIVGFLKICQYNPQIPLKMI*QE*NG
IPLRM*FF*LWRKLAL*K*IRNLTRRNLHGKYIFLKQTKFPSNPLQFCPEWKDFLK*KQR
LRFDGAPLLLLLAQRSSEKVLY*LGSHPCF*YKLEIEF*KCVLKFSLVLLNQEFPYQ*IR
NHILHHPHHIPQYCYANPLLRQKVKYFHSRLPLNQCY*NPQTNP*PNQKCPLF*WKERTV
RKTFYKLSQATRDHQPTVYQLLMSKYH*R*TLFLFGPG*IRLT**VDH*LPLLWNYLCMI
QPSVKQ*VRIFLRQSQQHLYKFQRELELDIELGNQTFPG*KLRHGRYFRYIYPLTVFFHP
REETIQL*I*KC*SINCLGHKSVFHVTLR*DFYYNAGMIVLPCRQCQFSLSVLLKVHHYS
SLIRLKYPNISVYSPRGYPE*KLAELFFRLNPTKTKSQICQPHATPRKYRTWHLQAWLIL
VGLSHSRKLASALEVLQQWS*SHPFGYCYRRSKQLR*PSSAHV*LKNRRIGRRLIIGPFL
KCLSHVL*KYIPPFLKLVLRGQCN*SLPIFLVKLV*RVHQQLLK*IQGRPQKDYTCIYKL
AFVILILPVKFYQRVWQLYYLLRFPSV*FYRQPFDSSLICFQKVLLNSPLQYKDPRRHSQ
YSLSI*KSAHSLPNSLRSSPSFLQSSIKSRVVFFQPGVAQVLHLFVFFVLVFVRMFPKCQ
VNVGGCCQIHYYRENVQVHLLLHFCLRHCHSEFYDIHIKVQNHLHDGNRYRHLHHHLPQN
FRR*KAYVHLHLHQDNKSTHPVHGHPHHSHLLPAYPSYNHCFRYGTHVHQGCANYFQTCL
ATLLF*MFIQNFHT*DILLLIKHTERKVSIPESGLSLGMIKAIPLSNYCWL*SHNLISVQ
KTQPLGLYPAKVKEKIFFQKNAMSF*KVANICSTLAKQS*FLLLYVHHCLSSIKDLL*LN
HAKIKTFQASHFSTNR*KGQRK*RKNFR*SEGSLRYL*IRLGPTS*RRKNSSFTRNQNIL
GRL*VNYG*EESFTKSIGRKEGRRIQRKSVSIE*AL*RCHWFIVH**GCQHCQGIL*VIR
SFRLFKTEHESTTNIYNS*GHCLLTWWSNSS*GRCSNDSFFRANYEKQI*NSN*NQSW*D
HH*QSIFSLH*RRKIRCSSSFNTETIRYRCF*IQSQGVGLL*QR*LHC*KH*HQHGIS*T
IIWKPFLIDHCIKISFFCIDILKQRS*M*HSFFSTENLYSC*LSVNHF*SSQLFSGTKAR
KKDNTVCLEKNTIKIPVYINQ*GRT*EQDRKRINV*RINV*WLYYLKTPFSFKYPFSLEY
CQLE*WNFHHFLRLIHYHFCHP*EYLSIESCKEL*K*GTANKDSLIAKRLSIQRQLVRKS
NIYIAEWQNSRHSYLPCEIALKRTIGSLNLCNDANKSTQQQR*QKKKKPIQSPNNLEFWR
MTKENQKHPL*YRLAVPF**NEIRRKTKSIVK*QYDGKSTRYDLFLAFLVAIQECRLVEP
KMQLDPNRIP*IRRD**NLDMFCTLPLC*KTINPNGTYNISRKDRKHRCRK*RTFVP*FF
LFCA*K*RVT**RTV**QHPLGIHVRM*KKSYSKIQSTNR*YLYHMRWYHLFGMTQRQIY
VTHLSL*CYQK*NRHYIPRLKSSRELSRHDGNLSLGMKTRFS*PGRYHFWWLQIISAYAF
*QPF*ILLSRT*YLN*VQCPRGRSYLWKTCVLVLTSLSNCCLKGLALLST*LLFIDTVSI
*MFTGGMNNKNNSDQPTKISVWNRKTVTNKKL*F*LKSGPDYKADVAEKRVHGIQ*PNNN
K*INK*IRKKKSK*IKQNGMQQAKEGNNRKIT*KSLSRFQYFLPPPTLFV*HDQVQCPPI
*EKRVKKKK*RKWFRGSSNFVGMTGKDSCFLSNYFSFLVFFLLKPSIFFFASRFFTTVRI
T**SLHVTIM*YDSRVMIPFFFLLEY*FYSG*YWI*V*EGVSNCKVLFRPLIQRIIRATE
NV***IRRGHQQDHQ*QPSRRIKGSIRRSNQDHK*KLQKYYFGCY*ELQRAELHPYRSQR
ELCNYFQIQQGRSKVF*SRKFRNIFS*PFRAQGP*H*TI*VHACKDRERAIERTAR*IAR
ISSSELSR*CQFCCLPSP*GNK*NFYYYC*HQI*SKQFLERPLEIKLHLRFGDQGVIRSN
LYASPLLRRR*R*FPIWEGYQSI*R**RCLHNKGY*DEFRK*SRSFIFRLERKTV*GLKK
KITSHEIQN*LG*CDWQL*IG*ECGRRQMKFHACLIPFSSYFLN*IHLCTLFIFGLIGSL
K*LKQGI*NEEY**RQTHHSPYAITSL**SG*P*GRIFDIGKHRSQ*ICHLVYDRTVRDR
SVSNLLVYVSECS*FIG*PL*FPIILFKVHVHEGMIHLLIRCTEAIVSSL*HPYSKLGPI
LNTYACCR*FTYV*FGLRIPRI*HRYDDYILPFYRSLLVEFFQYPS**YTLYYFLFFFLH
VAMRGFLQ*QEN*SS*FTA*TVHSATRNIRYLPHNIHWSVTVHTKILSE*RSLREHTFLN
SKHCLKMFSHIQGRNIEQHG*SASCNNASVIRNIVQGKYQIKNFSHFANHPYRTWRCSK*
LALDRKLYHHSVTFLIESS**ELLVPQIGTKYDTTVSYYHSQHICYIFYVSTEPFVSHLT
SSCD*QSSDI*N*SF*N*SF*NQT*IHIGVH*RN*V*IKKSSISCEVKKDKTSKFLPECN
YTLSKIIDSANTPIHYFYILTSHT*YV*NIKF*VSVINFFSILHFMKLQTGVGLTFRPEK
SGLREIAACSCVHFSIIGFPFSAQCFHSQPNWQRRERRAFSGLPFVLVEYY*TEKKVI*G
*VDQVCRLYNKFNCLS**TKRVVKNKINNVHRFYCQGF*LEISRSWPCGFDQEGSIRR*I
GRYRRNY*PKEGMLNPENLSSI*GGK*TRNEI*ATKKCWQISNPLPWMKLLVNDK*M*KY
TLR*RYKKVFISLLEWPIVDYLFILLAAYLVSER**PIFAQLILKEPDHVSSNIKPCLPS
F*KNFVY*QLL*IIFLNYLL*LL*VLIDGPKAGVPRQAINLGQVVLTPLTFALPRGARTA
TVSKKWAAAAVCEKWAASSWAKKIAQRERRAALTDFERFQVMVLRKQKRYTVKKALAKA*
NMYMIFNSDIFRM*FYL*LVILLINKLQYYNY*KPLLFTHLWKKKNTNTQ*VLSKFGVPK
GLYRWGS*PSFMFYKRMHIKFTKLQKP*TQ*KEGKRVGLS*KYTPLKFCYHITIILLQLL
GILYLMDKFLFHDNKCE*CSFI*FHSRKSLRSFIIVTA*NIFQNFRNFTALRWNDIKILL
VSSFWLYTCNATFVFQGVYNVGKSCLTFTIIRRK*LVY*YSSRARNFLKIWCSSGCR*AP
FYIQFSVTNGFLENIPS*LL*SPNVV*VTCKLKS*AGIQKCAV*RFFVDYCTWAGFFRNG
MSLFYFTLIAVDTVNVV*SYAVF*VQNILLRFSDIFDQLITLVGLNVHGFVRYLHDKIF*
DNLIPFLFKFL*VRICEFRCVHVHQFI*RQFALDNVCLQFQIFFIL*IRV*RPHFLCVYL
VQSTKLDVKASFVKFFFQIVRKLLRYRYNVFPIRKLIKFCLNCFGNDEFAK*GREHFFCI
IPQFVFFFAFKIFPSRHFVFGSIRLGGINAFIPFF*PIGFLHLFGFDMNSFGTIGAPFSF
PRAFLIKKDICIIVIMVIYGLVNIIMVIFIL*NLCLL*RFQMCIQ*WVAQFTVVLRIFTH
*PIYGVFTISHTFNMLPSVTAIALYHVAMRIFCSIVVFIVRPTQTSNIALIRFVYFVCSY
IFSIFPWLLRRIRLLILLYG*INFLFSSFFLWCFSLLL*QILNIFILTLIRS*RSTDRHN
KFKLNKS*K*KRT*DNR*LPVYRTSQNTKISSTYPLSLQAFWPNCSLGIPLHVL*NSIHL
SPAPRNDMKSYS*RVILKLKKGKNKNELKKPQQKNINFIAWRVIAFLFLSVKE**SAHQC
SYLLQSGFLIWYYCRGVFFASVTIA*EH*RLLFVNQQSRISTATSLR*LVSPIAHFWLLL
STS*VYPFPFSH*ATLGIAFGPRIFEFSPKVLYFISYRLRFSYFKKLLIIPLRMANPFSR
WFLSERPPNCHVADLETSLDPHQTLLKVQKYKPALSDWVHYIFLGSIMLFVFITNPAPWI
FKILFYCFLGTLFIIPATSQFFFNALPILTWVALYFTSSYFPDDRRPPITVKVLPAVETI
LYGDNLSDILATSTNSFLDILAWLPYGLFHFGAPFVVAAILFVFGPPTVLQGYAFAFGYM
NLFGVIMQNVFPAAPPWYKILYGLQSANYDMHGSPGGLARIDKLLGINMYTTAFSNSSVI
FGAFPSLHSGCATMEALFFCYCFPKLKPLFIAYVCWLWWSTMYLTHHYFVDLMAGSVLSY
VIFQYTKYTHLPIVDTSLFCRWSYTSIEKYDISKSDPLAADSNDIESVPLSNLELDFDLN
MTDEPSVSPSLFDGSTSVSRSSATSITSLGVKRA**VFYLQLRIRLVLCRYI*IYIFFFL
FLSQDCRLA*YTCSLFNHIPLIIFRIL*IFEINGWLLMVSMLSEAFRMLFLLCLLYVYER
YVCIYMCL*RPQSKPVRYT*MD**SSFTNSKIDFFPKERCNDEALSSCLSKSTLTMDDLM
TRGSFFKVLRISDCTAADESNSIKK*YARKCFSWSFFIILGRYLMPMGTMSLTTPLF*II
SFPIVEDNSFASNFGALELVMRTSPISS*SILVKRVVLRYSFLC*SFSILFKLN*WEFPL
KG*SLVETFPG*MITAKR*IKSALKGLRLLLIRNHPFELCVFS*SVFVTSVLQG*LFHPW
TQNVKQ*VCLSGYLERMSLRKRG*KKYVVLYLDQLF**TY*R*LFEFLESKGFRKDSEGA
*KRKEKIGTTR*KTCIRN*KIGKEWASCSCESSSKRFSKNPELHPKI*QHESSTSGDIIE
NTGRSK**PNDTFYERGHWSFGWNEQNNESTSVAKDIDGV*KAE*FDGSTTGIHGRSY**
RHG**GG*RRRS*RNCK*SS**DWSGFEFTVAKHASKSGF*CADRRNSDGDS*TYWRRIR
ISR*S*R*LASSVEHFEEADLSALSIFNE**VYTIIHQLLISK*ALRIKRLPKICSVFHF
TQSRH*SFLFFSNESSNKYVLYYIYTSFIYH*MYSNRSNYKCLRMIFSLIKYS*IMVAHS
STVFWSVLKCSSGAFGASYGAEIPVNSLITPSLAFLYKPLGSLCSATSNGTSTNISMNFK
PASLCSSRALSLSTLYGEINEVIEIAHESANSLETSLILRMFSFLSFSEKPKSLFNPKRM
LSPSNLYADKFFWSSNCSSAQAIVLLPDALRPVNQIVQPSCFLNALRSS*VRFGCQVILV
AIGVQCAWRNNSNFS*CQVRTKRENERH*RIRN*CCIEILHLI*IF*QIHEVEVILSRSS
SSPLPHFLRWLVNILIT*N*WHGLLFLEKRAAIFRE*CKVPWVPYHHAEMKATVFFNVTH
SWLLAYLHFSRAGDEPNVVVE*F*KCRVICYIAKAS*PGGLTKALALNMHREI*K*LL*V
NLLMLL*T*SYFTNFKKRNW*LTSPNFCNHLSTLFTILL*FIQRKQFTLLSMCI*LF*LP
RKQILVTFLFYTFGNHEHLFL*LCN*KNIINLF*KLIFLKF*ICFYHVTYENDIYGSRER
*MQNQSIQ*IVPYLVLDH*GIRY**KYPKH*Y*QKNNIICYQLSFPSSC*PSSYWTKDTR
IVMRDRKFFKSIIYRLASTYTRTIYKICSKY*GEILKTKLESTGIDEENLNRGDDLTSVS
QYLDHLLTFFSSLNGYVVFFR*FFNILLSVKFFE*NFLNISFTFHNQFKHQSLWYNIGNG
SFDNREITTNQQLDYFCFHCFPLCHLASSF*NRRWGFQSCQFLLVFSGEEPTKKS*FLFH
NWRLTRRWLGW*WFTRLWVNSDLARM*FFFHHNHCLRTLQKVGMGCIDVSLFSFDDIDNK
LIRRNSSIL*ELNELIRNRFS*SRIP*VLWL*NNLF*HTNKFIKHQSN*T*RWFFKSSNL
LFN*NFKSFGTDKQRWGRT*TIVHNGSDIRIFDLVEWIQRVYTIFESFMEYVRNSSTTRK
FLTGKLLRLTVQDTGIFIGKISNHAQNNRTS*IHSFWAQVYKFVLIFFQCGFDFRFDFWQ
SLPNVV**D*V*LFSQIWCTTVMSFRTVRGMVLKKFSFVFKGFSDCFFVFNILLTSIDNW
DITISQRNDSSSQNIYDICTLIHQIDFCQDTNSSRSFWIDLSSQLQTIAVG*IGVSGINR
*YDSVWFRNIL*QHVLNLSFNIRRLVTYGNLRQPRQIH*RQSKNMRRINSQVNGHRRNT*
IGTCHFVSFFDDFLSNFVKIIKLLTR*MQKFTPFLFIVFRLSLVLVLS*FILFLVIIVDV
QVNQFISSLVYFSMF*LFWSPINQL*H*RSPGDNTSTSWQEIPTNNVLQNGRLS*RLGTD
NSDLW*INRRLRSSS*GRQSVLKLVNSRN*MLIHDI**YKMCSFRTVLILVL*KASLILF
*E*IDELSRSVLEDMLFS*WQSDANQRRPSLWVTRPLNNVWGRNQSIRTLVLETRPVQAH
KWFTLEHFSTIRGFKYLSNSLKLSYYPLDDIRTIFQVKRFSKSLKTLN*LNNFTVSKSLN
GLF*IKRGLELAKYLTHKLFLDK**ALKRFLVLLDLFPPWAPQQQKIN*MIV*SKN*KRK
DRSKQSKKLPIGYKC*KYCRNWHKDLFMKYRRRKICQTGWQGMLVGRFLRMGPID*ESMG
LVVISILW*LFQNM*LGKIFLRYLIHY*ERGRNWMKLHLYLMRLSRLSR*SSVVFLSI*S
VHV*TNLKCLYP*LYQIKIYCEI*TRRT*EL*MVPE*QMRY*NWYQSRMFSESL*ELLSY
GPKEGLFMLIFLVFLVVWLGPC*WLEFVNYTLTPVAQLY*TDFSSFCRNGIGHNLLS*NQ
LRMARYKFVYGIQRYMPKTGLIECPSLHQLIHQCVLPITSRNLLKKSFYRNS*EAFKLRM
IFFPIRSPGPIYSKKTIFSFDTSSI*KLLHIQGAVTSSI*NGVVLLKVR*GF*L*NWRC*
LE*KLHILSPNPLKVVIVVQPRMTMK*FKTNTVVIKLRQH*TPLNW*QMKIKRKKVLKMH
QRHI*APCT*ALTLILKTKRKKLTFTFPALNL*IYVEVSMRIMVTTKYSI*PSAS*RVTI
CQMKFSMKMKRDHQRRVKGRI*MLDMKP*RDLNQMLLQVTTSMAQPQLLT*TKTFLFIVE
*FINIG*SVINKFVPFFLNQSTFFTKQ*NVYEILSTYALSRVATFYH*VRILCYKLDVRM
IPLKA*LNWLGKERNLFLSEFRPDI*AFFFLTE*GTQD*QI*QNKLQRDVYLENYV*QLH
EV*VHAICTFIDTDILKEVTMGSKKLTVGSDSHRLSKSSFSSNKSSHSATKDQPIDTDDI
DEDDESGHNIILNIISQLRPGCDLTRITLPTFILEKKSMLERVTNQLQFPEFLLQAHSEK
DPLKRFLYVMKWYLAGWHIAPKAVKKPLNPVLGEYFTAYWDLPNKQQAYYISEQTSHHPP
ECAYFYMIPESSIRVDGVVIPKSRFLGNSSAAMMDGSTVLQFLDIKDGNGKPEKYVLTQP
NVYVRGILFGKMRIELGDHMIIKSPNFQADIEFKTKGYVFGTYDAIEGTVKDYDGNAYYE
ISGKWNDVMYLKDLKQPRSSPKVFLDTHKESPLRPKVRPLSEQGEYESRKLWKKVTDALA
VRNHPVATEEKFQIEDHQRQLAKKRIEDGVEFHPKLFRRSKPGEDLDYCIYKNIPVDEDP
EKQIRSILQIAPILPGQQFTDKFFIPAFEKIKSQKKMIENEKQNPAKQ*CICWI*YLL*I
ID*FFYMFFFFLF*LSDCSFLFLSKNLFKKSFL*PKCAKFTEVRRSFENFSGTIGVLFII
LI*PLFSSKFRISFLQVNKTESISILRVILNFVICRRHRYGGQSAAYVRSIHFTNS*VNA
SAGCT*KFKSTLFILNGTLKELVSL*KSRILSVFFSSCWHTIYANALHEEQSLTF*KQNL
LVKLKSSILLL*GKLS*NHLAVFQQ**LEKCWDPEE*NTNKISGRTSVLASRDKTNSFRY
NIQRDDDLLIRLFDEQRSR*ISLTSLTNKSGITKTLLSWKYLLSKSSCTLYTVLFSGVVS
RNPTVM**IFSLEMPPNLHQYVELLVAVTMNPKCVL*NSNSFLYFTVETYFDQRKFC*NM
YVLLGKEIKMLF*R*LVLWNGLFRLRSKGE*LKADWQ*WLT*NHDNLNMQLFFQKILCKG
EEKIA*LQQLF*AFPFSIFLFGFCLFFCVLFMYLIFHVQK*VKKS*TKCSIKIKNKT*KG
KEKMEQLLSQIM*SYKTAGSL*KIFSLLRP*SGERMCINSCIYLIKTKPIYYQRYVSLYY
YPCETNNWRTVNSII*HRETNQ*LKGIK*ATCINNIGKEKRAQWFHDYSTPSCCAILSKL
IPFSGMLTGRE*KYSSSNSTSSSDQSLSSSESSIL*SLKDTRDR*ENPNIINVVIDTVMA
VNMKILLSN*DAADMNSPESSSGKCGTCEKVVENSVACSLAAPGSEILSLLTTVGVPPSS
GEASSPLALKRPKFIPAFLFNPSGLSTATNDFVAIAFVVVVVVILKNVEVAVLVTILVLG
NHLLLAFVDVIKVVPVSVSVLVL*NLFTVVIILGLWYSFTK*RVKIFFGLQELHLVI*IS
VAV*NNGAFVFRSFLLPLLSSVSLLQFSELTFLFSWYSILPSHFLSFTLQSPSFSSS*PV
AGDRVLPLIVLSRKY*TSLLASTTSNMSTDDIVF*LLVKEVNSAEINWFFSNCKGFLKRV
LF*PTK*DNFLLENLLPLGFKISPSSKTPFVN*NCSTTICNLSYSSLEVQ*S*KQLLLRE
LKAHCKHLQLSKSSIVSLFTVTHDRQNAYCSSK*RDTHSLKFRFFTWILSVIKSREY*YL
GKFVVHTQLERKGEISCEL*PGHKLGSATVLL*TAARTLPPPPAKRTSRALRHSNIISIS
RVFLPLDDFS*L*CVTNYSLTAS*VSRQRGNIATKRTYRKDKVKKKSDL*WERKIQTSSK
SIYMYRILKCNDSSNNSINIS*ADLAVSKAFLVASSSNF*ISFIIVSYLLFCSLEVTSLT
TYMFGDA*LSENGWIAFGSASL*ASLGSLADGKIFSLIYLLNCKGVLKVVSS*SGIR*PD
LDCKNLVN*NLATKSENWTSWSTLPNVFSVACNIISSN*LSDVILSLDNH*LNGAEETAS
FNSFCLLHRLDPSPIKFSGISSNLFLLLEED*EEASLVPSSISFINCLVSLTGSWCSSCF
FLLNHDIKSPFAAEL*IHLAFCL*PESQTDLCGNGLIQCNLSSDDILILCPPFRLPIIHF
RTDDQACS*FDRSRCFTINLSATRLTSSDKERRIKESIHRVRIQYSGSGYNDRFKS*KWE
PYSAVVETIPAKRMKLC*GNSRQAMEVKETQMTNTMPNKCG*RNTNTNRNCWPGNKS*ET
LLQTPTIN**TYR**TIVAL*FKGQTCKKLLIKDNRKKVEIPGKTKGVQVMTTSVGTQCL
QADPHRQLLTKLHQGLIRLLCLHHRIQRKYQRNS*RSCTLIY*MKFSASPR*TNQAP*RF
PFNELFV*HHWYTSFINKC*IVNEIKNHI*RIRKTSSPRKKTTKAC*RMMFKTTLSLLLQ
*RANQRIIDKVHRYGS*EA*VGN*GRWQ**KA*ILAGKTS*KPRENSACGL*RPIKP*I*
TFSR*LAYT*I*SIY*FHFGCSYRQIQRYFQRFHQTTK*EVSSTVLLQDPAANVY**NQV
KRL*IRRWSK*FSFGC*ATDKELSSLQ*I*QFDCKKLHASSNVD*I*SIEGKKFEKKLLN
*QRGQSQITALS**AS*RHGKENQPGSAGCVIS*KLRRQSQAK*TVYGISR*R*TS*IL*
NSA*PHGFIDRKAEPRNWSVFQDI*FHH*YAFSFSECSYIQ*SKRFDLQRRNNFNKLF*L
LNTKGILPRVTGFK*TWRN*FRI*QIRIRKLLSYWWWWSSRSRCVSYICS***Y*ARI*P
*RSY*SSRL*FQSFRRSRQWL*SFSPN*RLFTEPKQLQKVNSQTGNSAIRSQK*KINDI*
Y*EDKLLRERTFKNPQIQCYKIHAKRNAITLRATHHGV*AL*INTTNLHFFF*KFVFAGN
*AFTGFKAIMQSKLGRVYFQW**IESK*KRFLLHVTTHANFFNITVSFDLIIKGYRDFIN
H**RASEV*NFKCKQ*PFPTSATRK*CYWKRYEARYRKFDNRRRQQ*RYCW*R***T**Y
NRNL*YSLIRRFKSFDV*V*GQNIS*NGIHEFLDKCLTMMTISLFIVFPSYACIYIQPIY
TL*YYPSSSSI*IKTVNITHDKKVASVKKKYLKWVG*LCRERCM*GYGLTKLLNEKNIIA
IFYIIQIFFCIIV*ILPAIVLQRRYPIQ*RFWSYQLFEKRQPSLASKL*PLEYHLGKQHW
*ISLSTPHMDHNVQTMLSH*YLMYKAHAELA*EI*LLWLAWDRYVKD*NRQITCTMRLDL
YS*KSPPQNLVPFHVALQNFGQQTWLFSHPSLPFLEVHVRP**RTILRYKL*VS*F*CHK
FRSHQQLKRLYHSCQVLVKV*QVSLEFHYLALSACRA*NIVLHAVTLHN*SYRLNCP*LV
WQ*LA*ME*RRTWAKLGSLDHSRRCT*ALCLCIQVLNCTRYNPW*CT*IIHHPTPLKSAL
FARLARLP*KTPLWSSG**CCD*NQ*CGSNFL*FLPVQ*SL**KHNRNFFAIWFAHTNHR
QLRIIGQ*PFFQNTFVVLQMPTKQQVGRLEMHQSGLIIPSPRI*SLS*PFLHEER*H*Q*
FLSWHLPVQ*FY*ILKWRLLQRHNWPVQNYHKFLR*K*Y***IQTFVW*ILAILLLTMKM
WKKGGLSGQQTIPHLSFLKKICHAKYQRY*PRCLLSETYLLQFG**EELR*PHHGNLEWL
CLHHIVYLFLQQLKKDP*CHLQLPSHRTVQTRLHETSQDHLLHP*LLRLCCKAT*FSLSL
VHWEVIFLLW*LNHYNPRVDMDAEFC*MACPYSL*FPSTYLKLLQEYMSWGLD*KFVQKT
SPI*AVQRIQQRVQKWSLTLSYFRVSNRVLREQFFPVLTVSRYVVVTRFLSYVI*PMAQL
N*H*CCIWHPPSRGFPPNQLSPF*LLNN*LDQNFQIDRQGKRC**FYQISESAYKAKQHA
IAYSHLSNEHLPQMQTHVLSSLQMKHPLIFQRC*LVHQPCRILL*PFQLFSLHFH*QSRN
LPQLYLRLFLSHPPLSLQLWSYVLNHPKCHLDH*RPLLHLCLRKLVHTPYLSPLQRP*LQ
QLYL*RINFQAWLTQIRNKSNVCLASYMCTLLNKLADKSFYLSTLGVKQPETTSYIISLL
VFLVFLPHPPLLSC*C*SPLE*KLANNRREF*YGYGVNKFPRRSLSDLKLGFRNHTRLRN
*GLQQDLREVIEY*DTLFVYVNNYRNRLGRIRREAASRYQNERSKNIEA*TKR*KL*KLL
ILFQPCLSSSS*IFLFFIATYSIFNAP*LLNITG**NLLCC*NSITYSSLIDSVN*KIS*
INCHQFYNSRNVAINNSIGNERDFKFRNR*IYDDCWDFLLVI*IVVT*SLIIIPIQILCK
VTLSPSEWCIRERIFDIVVL*TRNQRYRSIMREVLKARTDRLYQI*L*L*CLESSLHTYK
CCNKNQLISMLSY*EMGEC*DNCWDSIVDKGYNIRYTEYTRSSPLRSRNPQNGIYISTY*
YYDYSSFRFICFIILLHYQSLHFSFL*LR*QLLITYVIILTPYMIIY**YNY*LIDDSGF
LFQHI*SLER*HKD*LNT*LGILEF*NFQQISGCLAERSKAPDSRNILTAVNCGNTQVS*
DARVRIS*QPYFIFFYIVFNNEQ**RIIQNDINVHE*KSVIIIYN*CIPYAISSLLLVAF
EDLIMISLTSLKNYYNSPRIFKIWLRDPNIITDRLTGRLHHFQHI*VFGTSLYLFHCHPH
PALVFH*NFQLVHDLF*N*FF*LARSSNQNHHPNHLRKSYPMKIQVTWKKKKKVKNATW*
P*LS*AAVFFLNWTVSLGHFFFFQELNS*LATWVRLVLVPEPYY*KLPPLCLYYYQQDLS
LI*LLLWSKLHLAVSQHWQKYLLGIYSPYFFFF*TL*LSIQHHQFFVSLLFYQILRISHR
K*WYWDHQSALFPDLPLLKLWIWVYLSSLFQIFRNMVP*YYSFFGP*FPQLA*TYLVSE*
FLVFLRLLHAK*MTQHPMIYQETPSQQVEIGLPYLDFDVTDYSILFQEKREEKQHFWYFE
YFVLHFQYHC*MKRYPSRN*YPEIPSMPS*NC**TNPHDHYRFH*NPLHLKMLLSFYNSH
LYLCRSMADHHLFCFEL*FLRNSSWDYEHH*RG*NIVYAYQN*YEK*CSIGSRYQSNQTK
FEGSFHLRVHNQHLLTNCVKDLNPLIRPF*RHHFSVVEWMKVYFLYCYHSLALQLPL*HE
RDLLRLCVHLMPLLWK*VAWDTFLYSVHHTCLQAVEFRSLAALILLIY**SYS*ASF*LL
DALYLYLI*KISLP*RSFFSFQ*RWILWMACCPAVSAVLPIVKVKYVDFYSSLIHLLKLP
KPHHHFQIRLLL*IQSPNHNHAYLVEIRFQWIL*NLDKVYQI*LKFH*IVVKGYCHRP*N
VKTFYNSGGS**NHYYDSTE*NFAKTGS*ERGRYSY*YCCCA*LYLHYTGP*ETLIVEYS
SVLREM**YLEHLAAPVQSVTSTFLSFTYLNQTPRRAKDIIRNVAKDWRIY*MLV*LGS*
PKMTCFPSSAKLINKQTNKLGPSCI*DLKNMKKII*QYRIMRLFFVMPM*Q**RKNRSHF
YK*LNNWFYIRTYFWSFTFILLI*WM*ML*KDMFSRK*LK*YFAIFMRMMAIRRVFSDFF
FFHKLKFSRSLSRPGSQVKSFIVFGHQFKIAFKI*LDQIVCST*MHEIHVWFRLRTFIDV
VCRDSLIIGTQR*RRQRIYRRKMS*FAFQRCGRLIV*ARCQTIFLKILFLDVILFLHRVM
IIF*SCCQKSLIR*NFGLYDSNRNNIFEVIENLHVELFLFFLLFGNALTYFIILRPKLFN
V*F*EISIHFF*TIL*PGPFIIIFKSLIILENLLPGSVLNHVSVVIHVQQGRQLI*LPTT
IRFPNEKGVTYFFIFENVEMGNTIRLQICGCTIYLQIFCYGLRSLQLNPVQFLNRMHELD
NLS*SETFLNTGQFNTWLFFTSV*VNGF*LGHGFLSLYLVFLLLFLAVCMST*L*QNSNG
FRLNLFNYGTFMLI*IPIHFLGVCFGFWSHSFDSTLERHSCLKRPGNDL*SNYITALQDV
KNSRRQKVCNYLNIKSL*AINHYVH*ECHMLKQGSFQRSSTLTDHSIERKQKVEWMATFM
LSVVIT**QNNAIRERAIILDQLARPSSSYCRSKFYHYWILFFFFFFLG*L*TFPSPAHA
F*FCIG*KKAYH*AAVSGRSSLEQNEAQLASFTIILCSRPCAFLAILQRSLIWVLAVLRT
LAMCFENVFVHHIDCTALRHHLDRSRDFRGDIREMPNEIEPAS*KGVKKENASLKWTPL*
NE*EICP*IIFPIAGINMCAIYSTFRVSHALLYM*CF*NIDVVQRQCF*SLYIYMLVAEC
YILL*WICWLLVSSFLETAHHKTIPFL**NLQR*NFLKSHYWPHLHLSLYLPQLL*LSRN
MSTKLPL*WYKV*FV*KMARL*RRSLPRALKRLLLVPLPQHQLLLWLLMLKWTA*LLPLS
KKALSWLNLQHLKNPLQKHLKHFLQQLQPYKRCKPPQVPHRMM*PQL*HLQHNLPAQLLQ
QPLPLAQPLPLAQLLPLVQLLLLAQPPLPPLNLPPQALNPQAPISQRQWLTNTTLKGRCT
RIPVL*HGLTH*QHMHKTTLTPTIVQAT*STPAVHTVKTWHLVTVRPALLMPGITKLPAT
TIPTLVLVKAQVTSPKSYGRELLKLVAV*NLAVANGAITSFVPTKPLVMSLVSLLTTLCH
*LNH*I*RIHGYGHEQQWALFLLLHFSFIVSIFIIH*GFFFSRVRKLNASKII*HCHSLM
HGK*GERKKLGDLADGYVYIYIYINIYIYIHVYCICTIIYKVTLPFSFFFYIITYILLYY
RKVAV*LKQLLLFFL*NTNHRISTATRCWIICGWPLQINVYLSVIASTDLSILLRENFVF
L*IV*FFTNILKNFLNPFTCLSTNFSEQQPLFLCVLFRFFSANCSYFLFFISTFV*IWAC
LSARRFLT*IHFVSQ*INNQVVVAYLIFQLINPVPCLL**IFLRNVINN*CCISVSIIHW
CQ*LVSFLTSSIPDFKFYNDILCFITIVWVNSD*LR*KSSTNRTFT*FIECILNKTMNNG
RFTHG*VTQ*N*FKLQHLLIIYTFTPNKLNLLPTLAL*KKI*ICPELDIEAT*QIINTDS
W*TGLFPSLPYVNIVTSYRRGRAL*T*IVRPE**SLSTKARHYEVAVWSQ*YT*C*EH*V
IWSQIDFIPLQS*CAYLIQGHVDFKI*HNDFTYLSHI*TWERLNINYCASLQLQESTY*R
YYQFTFHHTYRRKQNI*KKYSKRLMSSRSIPYSLYRKLRDT*KH*FAKNPHSSKWGLKCA
LMR**R*YKVQILSIHMTYNHKA*LLSIYCNFHLQFQSTV**NVMHPILFLNVLC*SSRF
GNDF*MRL*HFWQIKRLF*LF*IWL*NP*ISQLRHP*SGYLLK*LTQVLHSPQAFC*CCY
CSHCISLYIFSCPLFADSFLHEVIC*V*S*GILSLDRALPLYGNFCMIYYFYYYYYHFYW
RKMLFWS*V*LPDFLYVSPSAYQVLRPDFRP*PSDLYNIFSQMSEPSPILAFVAPFSKL*
HIFHSCKLDQYLS*WYSKICCFGHYLGVQVESTRFPSVFLHYLHFRF*TFELFRRSQF*V
CRYFSLHCHPLLYPLLLHSLLPQQRSY*KY*QPY*REVFL*YFSILMTLQLQYYPFFFSL
S*CSPVPHLASSPWLLLLSVFSFPRVPCKVSCQHRIFLVLKSK*D*EGLYL*AL*YSSFF
CSSSADHTLL*R*ICKL*RWKFW*VGKNLR***FYCFSLMVVECKYHRGISSFYIVFRQN
LLNKQPCEGCSNHLPLPGPYQESPFLPFQLYNIDDNRSIVYE*I*RPCSMDATDPVHLGN
PLPDNRIPQLKQQGYA*LRAQFP*SVLKK*P*YKICESYF*IL*NLPHSSSRIS*IPSPD
P*AFEADLSNFDSLQIVAIEEHTFQRKS*FQ*EPHIQNSPET*LKKNLVNFFFNYSRPYR
VITLKQKINKFMDYFQ*LICQIPLPCMAIFSYHFCGDKGDAITDTTR*KREAGNKLHTSI
IR*AL*AYREASNVIDPG*QTSFTLFLGPSHGFSV*RKQRNIIHFNRDRNTYPHSIQYNQ
YISFYQLLDMIPFTIRPGKSKYAQDLLSVSGGNFLAFPSSRNRPGT*YNICYTSNTERGT
CSSSKTVSKSIFVRSVTILMTIAYNKVFIIFCKIHILLTEKREINIAKN*QQKKLLAK**
FIKWLLIVRSRQRTNAS*QWTSRIESL*TCSRLIEPIKF*DGFLCGIGIKGCQKSEK*SE
IKNCSYSRGSYSQ*RNTKGIRTH*KV*KTNIRMMLRTTASRKIVLRRGLASINTGTTVAS
KKASHKFRNTLWTIALSATAFYAGGIIYSQKNDKFGDFFSNNVPFAEDLLETYEHYHDRP
TLFLEDSWDGLKAKSNDLLSGLTGSSQTRRSNRENIEVKKILSLEPLNIETENSDPQLKE
IIGSLNDLINSLNDSNLSIPESEFNSIKKSNQNMLTNLSQLNETLKEALSNYMIQRTSEV
ITELNTQYENSKREFEKNLQKNLLQEVDEFKENLTKQKDKELEEKLKANEELLQAKHANE
VGLLSITQVKEFNKIIKDKIEKERNGRLAHLEEINSEVNDLSKSIDRSSKILSKNEALVQ
LTFQVDEIKSRINNNNLPDVNIDKELSRLKLLSNLLSTFNKKSCCDDGDCCSCKKGNKNE
GKEGKISCKCKPKTNPPSLLSVALDELESTCSGKKILSNEQIYNRWNLLADDFKTASLLP
PNSGILGQLTAKVFSLFLFTKTGNPSNATDFDSVYARVGDNLRVSNLNDAVEEVVSLKGW
PHKVCESWIEDARRKLEVQRLVEILDCEIRTL*KNNTKRKEMYVITPQFPLCLGGFNKEE
LNT*NVS*LLLVISDSKNFEIFLKQYNFVGIGTTMCI*IVFQRQIQVQINKKIRKYTKMQ
QRLNSKITKHPAVQKT*IKQQNNQNNTKTKHSFCSFANSLT*QFSTAFH*CSGSIFHISG
LIIKLWSSFHDHFGGFYLQ*LR*RFHCVG*EHLVINENLRQIMRCIRVICHGK*PF*YGS
SLIQHF*TF**ELSINP*DTYSFL*CMNFRAQSLPQVPIKLG*NFMFVKQSIVESVFLQG
FISVLRVLTFIILIILIHCTLKKVLTVGRPGALTNPTEFVFTT*ANHVVAATIFFNINRT
FWTFFSVGQDPIQNF*FFSGFFNPSSGYFTICWGMNFESAIETESMK*ITLNER*IMQTG
IFW***RISQVHDGFTVSKRAPFIVTIMFLNKTFD*RIHQLTTRRMSHHFIYIFIFQCQG
TVHACNDVPLMQLILDVMTVAIDTIFMATFQRKCFRILFITTNNTCKVIFEFNFSEM*II
IIIFLDICCGT*AKLHKQFVHFFGPNF*QTFLVPIIML**YQYIRRWNCKNRL*MVNPLK
HSFKYTLGG*AFITEIRYTPFTQYSFVVFRKRSI*HPLIYGIDSIFIFIDVKF*ILACYT
N*LREN*SMYSKFRCIVRFIKFNRAGITFIKTIKLIIFGTTTHC*KPLTSTPKFAKDKLN
ILKEWL*FLYSSWDSNKSIQM*LP*N*GSTHSILHLPLLFSKAGSYFLRKEEGRWH*ESI
KSYVIKLRKVCTVNKYSLAL*N*VGH*EN**GKIFLKKKGMRADQNLITMNGQRGQWQP*
FSYLLSYSIHNHLRSPEPSVTILYSLEGHPCPPTSM*IEHVHKVQSDRPMDLQFSLYI*P
CHFEWRKT*VEPFHPIYHNLLGYDLIFLMSKRPRDL*LTPDLSLKLQWRDFYTQLAFSLL
APNALQTFYYNHCRSTQFRVLVK*RYHPEDFPPQVPPFSL*IAQLFSE*TYLMAGSSI*R
FSYLANSQR*R*VLRPSFGIHPFCLTSLIPFRTFSNFLNNSSQQNMCKKRVTNH*CLIAI
KYLLQLYRIDANGSML*HGQKSSRI*PVSSVSC*HQSNPSMRLLPLNALYQIASLPHSIT
IAHYWEIALLIAATHLPVFSQDATT*GHPSLHLQNLHCYWNP*LLQEYQNHRQ*IGKVHH
SKTSGLTNQYNHARFFALWLSKQVSNLLLWNP*IQPQIGPRQ*RVVIVISQPVKYQSIN*
HQNGQTHQLLLDLNLYHPKELYDLLFPLLASLPLLVVLAHLSTC*LQESCQCGRQIIFQS
SCYEFVQQIVKDPYPFVLQESVHKVYQRN*THRHQL*KSLGWTPYLHCLT*FSISWLC*Q
L**FPRFLVTYSTTF*ALKWPWPPPSYFH*KSSIGHVEGMILYKSRHKLFLEDIKNCSSI
QFFEPSLYFSKIKLLPWPKSQKLFSSLQLQNLKWPPKIQ*HHELTHL*FGRKLL*HHSHP
AKPNPRQHYHLRHSPSHAVPVRNHELVLEWL*FFLPVKAQESLPSHQNQTL*TFWLFCDP
LVTISLWIVSVVASE*TMPLF*LIEFAPFLGKKERKQKAGNNNNRED**TFF**DWPYLE
QDF*DDNSISLTVTSGGITHYIYILLYMSTYEVVRVTLVTTSYCGLQELHGFPS*YS*FL
LSSVFSFVWPSPLAYSLAQPWWKHIYLRYPKRIARQHWEVFCHTGTDRPATYPQ*KISYL
KYHLFLCLPSCKFLPIDYWAS*TASRYHGL*YPISIHLRVKY*LLRNHPL*RATSSTGSN
DGVCCLPTCFRNASFRCLLRKLYLYVISRVYPH*ISDLSCGG*AYDVQFYWQNS*SFS*F
YLFCVAWSRRPGSDQIQNQNQYRHTHHTCRWTDCTYTSDFPHVERMHDHFLRLYLQRFYV
MLF*ISYSVVVHVVPVLRCLHPFHIVKISAWAYYQILSF*TC*QASSSSYRMNSSEPSWA
NHFPGCSL***CLSLQ*MALIHITRVD*LFEIDLFVTY*K*RLKCPD*DYVWNRC*LMIG
FHFHEADHCRQVMIAREETACVWAELCCCLY*LQAP*SSRIAFYRY*RK*VNSLEIYCRE
FFGQASVIHWSRFLSLSVNECPASHSSSEFLELLVYPMPKNGRSYCQN*VSIVNALKQLP
FEQYY*HYLYLQGLTCVS*TTQHH*APLF*S*VPVLFVCVPSFVLVSALTFVAMALIT*F
EDSCSPLLEGMDC*PHWNGSGR*LAQREGNLKLLVQSKLLLYRHDNAVYQTKVSYSSANL
FLCQKNESTQALKVCSTCATRVLLWQGSITQWAFL**FNFDMLYTRNHRIFAAWKQEAVS
CTYR*GSA*KRRICGETESDEDIKYRWQNKLVTKSP*G*AV*TKIEDCS*ENSTTWKMNR
IKVVKKHV*GKKPARLILGRSKSQM*I*IPKQTLRNQ*KMTN*VQLKRISRRGQKMQKKR
*RTCPLRG*YKFTISSWAKKPRLTILSRIPFTKTIMT**KSTTFSKKLQTPMKTKLTS*S
KQ*NL*SRNCNFQRHIVAFTEHFLRESAFYYVNQFFLFFGLQVHLKNCLTLLAIALLSYE
DFAKCIPGCL*YIYADI**RRLFTSLSELPNIDSFVLFRYPHLIKNGNNSLK*ETSNKKD
NQQKVPFRTNTLESHRILLVPL*LHAPIQYRK*YCSSSVSHGARYKCST*CRPTGADNNT
TSLCKACRTHSVFKRI*N*RTV*NSPQYLTRISYRQGVETE*IKKYIDNLQRNIQNRVAG
RYTTEERRIFRC*NCCQSHMAILSGG*RHEFFHLRTSQLK*FVQSPIYER*RLST*KKRC
FSIYPTNR*TP*R**QSKSGCL*AQLIVIR*FE*QASIK*CFP*RQ*TVGYSKDTITII*
SKRIGTGKFSR*LFVTSYLHI*FVYKNIQ**WRYSKS*ARG*LSYTIQRF*RSFYFSTGR
LYLHF*TANIAILSRKYKSQFWFRGV*TVNRHREVWRIQINYTYSITHQSRKASF*WIRR
RD*SYCNFQGLERSSSL*RGNFLERDRFECIFTHRFPFRSSR*SYSASY*NLSNRVYGIH
L***WKSREGS*IRAN*KVSVG*T*RS*TASYTSWFESFEG*K*REHPLG*KIRRSS*QR
FSVRGVCPKQVYKQYTVTP*YKL**NQSPPLDKNLPSSFQEVRGQ*KTFRNKY*FSNPYF
KSTMLTREYFATELRESFPVL**RW*FRTSSRSTKLRKSS*FQYFLPKRSSFVSRSFT*R
AEDEH*NTV*SSSSA**S*KRKEKQVR*YLQEE*SK*QCLRIQTAGRKHL*AQSDSKRIN
FSSGVTIIAHHLTNSQLPTIIKLPASRF*F*SS*ARRSRFSCYSCGSSIIF*CIKGRWD*
IAILRYKFI*NS*TKTKQI*RDIGQH*GGLIQWLVSN**LIRRR*Q*WRYSIWFQLQAVN
QCSE*ER*FTHSYFAVFKHES*WEKKKSCQSTRNISVT*YNKTEQSAFQ*HKPDARQ**R
RCLSQKPIIKFQ*ETTNT*N***RHTIKQQ***QS**SRRYSGFFSRYYSIL*SKNVIRF
QI*LGGKQEPC*PSSLLG*RC**KPCTGRL*ESISRKEKISTLFSFSDRIATILLCVL*F
NSVQYIGHFIVYKYTPSIYTSISLVVKISLFNSTAIKKIT*LTFSYQ*AYLLGLL*IFPS
QFLFFLTLATSSQPSSFASRSSKPSRLFSQCCSHFHHRLGKVPVRA**FSHSICLYFLCL
KAGFPILH*FCRALHLWPSL*SFF*NPFE*QFDYP*GLAFRLESLAFHRH*SS*SPFHCY
VSDHHLILLSP*FRVYPHCPTILHNLFLL*HHSH*FSF*IMTSVLSVLQFLLGLVYY*CA
HLRSYCQPLKNHLIDDDSPPSSPPY*ELANHLCFASMHWYFSLNGKDLHNANYPPLLLVR
HQR*CRA*ELF*TLLVVIHKCRCHHLQNRSTLGA*FAALAYAQNHQFQPPQENHLVT*FY
FFS*SP*CVQML*HC*AELDVTRPVILLLQSTNL**LLSVMRFISIFFMIFACRVSDKY*
NIIQQERGIKSLAAANNGKVNVVRETVA*LFNLGFAVINNDKKAGY*LCNQTSSANIAFG
RV*CKSAVRTSTEYII**SRTNCFKIFGVPRS*RSIV*ICNEVQ*IIESE**KRGKKNEK
CAS*TYCPHFMEK*IKTAH**LYQ*EGR*KTKKIKG*EEKLDNEAYRSTIKSIYAIKPHK
GEKRAQIKGEITIVTRNRRSNQDARASR*RFF*KL*LSRYKASSFRHRAKLSSLW*SGLC
YRGIE*R*MRSLP*TVDF**RKNPNGRNFKSGKKRTKRFIIVLIQCVKWS*CPKEED*NL
QNNFRYG*KFIC*TGQII*FHRKEKRKRKKA**SVEIAGGKRRERSKGKTSERA*P*S*G
KPGVVSSTRTIR*TFIFPRHFGRKNKNY**CQRF*HESGGGFMGQRKRKSSCVEEATT*F
EKVGKSRKGTEWQAREVRC*HEYRFKR*SYYDRSP*GYRERNCRFR**HQ*YK*RRRYQR
P*TYTRSEK*NKYNEILGEFAFTVQSMGLRT**KTIR*AYVCEKKFRYCTTE*KNGRKGS
RHASL*FKVKSTSGPKCRRISRTEYSCCTLMNGKSLYYI**RI*PLFIFCRFYHFLCLHS
IQFFFI*INACSCLFSS*THLLFASLPYEPYETFYF*SFP*LASFHYYHPYYFAIP*PLA
FHVTQNF*LNGLDVRTSR*KTSFLERYALRKPSHD**NL*RPNF*MRNLPLLVFLYSNAM
S*HWYPTHILYRPRLYFWTISHLF**IYHFC*HSHL*KPALVFLYRISVIPNPSDDTAGY
SPYIFLLRQEVKITNFHPSHRPLLYDQLYVNGLQQQMVDPTQ*QIQRGEGLGLYLRHLYR
T**DVFPWWLHYHEQNAAM*RFSFVGIKNRAIYKSLHLGP*NLKNKET*CFLLSIVLQNH
PLDFYGARHFLKMRHNETPRCLNMIRIRLYAAFWTVDRKR*NLW*CCSK*QLMLQDATLV
GQ**SSAIVDRAQPLLYQNLSWYRC*SICNLSTPRFLTY*HHQ*V*HYITCALTYAVAWE
IFRS*WEYREQF**FH*SSHQNPIPLTYLLHPIRYTLEIDSIAP**LLYFVNDPKHDLVY
RL*NCNPYAI*LFLISYVLHQSINMGPSSDNMTQAWNKHDIFVMLVLV*EQ*PMQMHQKY
DQHEYPCSK**IL*VKDTIKSYLSLFGRE*KNRSSPRYLLFEVWPASGCS*AF*YAFFAP
DEKQED*RHLKTQTDHLSRAR*TD*WQRFHHEY*CLPQL*SLC*M*TGMKQTENRLVEFS
LECYEHFYPYIFPALQNYRNSPYAIF**NSRLYPELSLRPL*CSPFFSSRLSCPQASFSF
FFYPSIYRLSPWQLAYRNFLQCPHW**SLTA*NLHRSSWC*IAE*VCLFGI*IIPKEKEY
KQSYFLKLEISHTSTQSFIFLSSSQIFQVKWKPNMSGFLIHIVRATFNFKLKFYKNSVHF
SGLRVSILTKLFKKKRNVTMNAKDG*KREMSLNDLAQAVQGESGIG*CYR*VLTTSCLLL
KRMRKTGRRTVLMLRMNLTTLI**RMRTEQTAL*LMSKRKNPKK*KLKMILVKKKRMTQ*
SKSFH*RSPEKRSHCTCFSMLIDQG**DANLLSIRLSLQQDINPSRTYGK*IFLWMSRPS
ITRIRLRANGMGLMSKH*KAWVWKTMANMQHLSKICRFIWYLLRG*HN*SHFSNISTTQM
*QESKRTPEGTLILHHNALKWLPCL*RASTTLRKTDSLAPCWHIKSPMKRLILN*PGQKA
RLNSSKILS*KKLKIKL**P*RNKKTI*II*FEVHNAS*RKNSIRHQFHIKDALALFLLF
Y*VIACIYYVIFFNHTTS*LTLLKRHLE*GPLNL*SMQ*CILGRYSRSWAHAMHLLDRPY
DV*NPKEGRP*VDHLKTMETYEQICDFQ*PHRMVFLHYVLKHPLNRYPRDL*YHLIQQHP
QHQRTLCQPYRLPLQPRYRQ*ESRVCPFVQVKYIAGSLVC*VLILSPHI*T**TYLLHDL
IKKILLSNNHVPR*YHHQL*NPPLFLQSCYAIFWLSIQKAGHFQSNVVYSFPNHRINEDF
LRQIS*KYHNRLSGKLSSEWI**VLPWSFLLY*SFLPLFLVFLFLIA*PMLQWQQSALSS
QYLLLKTLDKFL*Y*TPTSFLSISGIRRTFKILSINYYEEIYD**WLCHYLSSMILILHH
KLHQFFHFFFIFLPDEIYLL*KKKNIMLCRKL*IWRQCCCVVSNSLDRVVHS*CGENDGI
ASLFFLIKGITNRYLLPT*DIASNSCKHNYICLVLF*KAIQAQIVWSVLERSPCSWHCCR
LSCSKHTSKIFLK*FDQISFVLLSPMS*HTAHFYYRYVFHSEILFFFRS*VSTSTTLDDC
TSRFVYSIYAVCNNILVSRPLANIR*WIFIPKNTYLTCLTTDQILKLFV*IRINYHLCTS
TQISSMFSYTV*EDDIKNEKRLLNIIEAEMQALIT*QDKE*AYKVKKRDNNITIHEYRFL
LPHF*YPRRELLVYCVS*PSTIMEHQ*LSYYSNISQ**LLFTMEPNNYFKIHTFLTS*SR
ISWVW*FELLY*VKNHAINSADT*GSQFLMSLNNSCSSWPNGHGVWLRTRRFQVQVLAGK
NFFTFIIFLLSFQLLSKNIIILEMLRCQSWCRTMPYYFSNSSSGFRGIVTPFGKNKMYAQ
WCI*IQHKNKKNKMTNGNKETLCAKKGHIYQVV*VVKYS*QINWPRGI*VFYGGLQSPRK
ARIKRLQVLFRQVLFHSNV*NQHVKTFL*IIQELWKKYMVKV*SLGRPF*VNW*ALVNLV
LVLQT*FIVQS*INFTMRK*VNSFTSRGSTPRASLCQLHF*S**NGMMVRN*NQHL*RTT
TSQPTALSISFKNWTLD*DMNLKMFIKLISLTV*MATMKYR*VILFGKKLSLAVA*EA*L
LIQILKEKYLG*WNYHLFLRTDARVIIKG**IRYANFCQDF*NVVGILQRASMQRY*ITT
*LNHY*YFCL*LQNS*QTMRSRF*TT**RMTRQILDITLL*LFLSWSEVMTAM*K*SNGY
TRY*TYYYPYCMDCHPMNLTFLI*SIASPMY*ASKQGFY*TITTMNFLYPFPHWPRIYLL
IILNLGICYLKAIFFHNSMIRHCSQSIRCPV*RNMISLNKPRLTLLSFI*TTTRHHYVIA
ENTVP*HHTS*ITS*ILCIMKMSWS*RQ*YLDAL*CPMNLSMDVLKRYGINPVLN*DLFV
DHRVTIS*TLYLSRR*IQ*EICCY*NEAKKPDKRVGL*SKYVFC*WN*SLESAGTPYFS*
DLTFSLWRVNSK**NLRTSCPQNYARRGSVRDGLMLCFWTFTKI*VLALHLKKIRLRRNT
AGWNGNYLA*LCFE*VTYPMQ*RVYELVFWQGLTLLVVTIC*TFI*PWILMMSL*EGLTS
ISF*IY**N*SPFGYDSMIDFRYFPFKY*GN*RDSWAPKLLRIK*LILLTGKLASLR**I
ICLNASLKIGMKPA*PMNALFQIFLPLSNLWQTN*SN*FNESIYIYCVCVSVFLMDKFTA
IMLIL*RG*YPNSNFSTI*QSKK*PA*K*HQYVKGILDPFQLFPCPFEDISKIRKVLDIY
YCNFTFYFFFFDGQLFVRNRFSIKSRIFYSCKGRLTNKELHLPCNSYG*LSFFLFVL*DT
KGTSLKYFHL*HFLYHLLFCLFIYFSV*LISPVILFFYFISSFT*LREDYNSMSGSFWKF
GQDYSIESPVSKILNSAFIKINKDQDDDVPTGTCEENIADDEDNSSHDYAASEDNVVNEN
EEKEEENTLPTTESEYENYRPNLDVLDDLLDDDELYTELMCSNFKLLIFLKYPDVLSKLI
EYVTNEKILDEETDSAKKPEIIEGVNDHPILIERDRKDKKEDAEEGGDSEETTNDSDHDS
GDERSVDSEETSITLPPESEEQVETRRARIAAEILSADVWPISAAIMQNKDLLGRLWSIL
DHPAPLPIPASTYFMKINERLLDMDITGMLEFILSRDSLVARFLTHVDNPSLMDFLLKVI
STDKPDSPTGVIKILKSQELIPKLLDHLNPEYGISTQSAAGDFIKAFVTLSTNSSNELAS
GIGPNELTRQLVSEEMIEKLIKIMLKGGTSLSNGVGIIIELIRKNNSDYDFIQLVYTTLE
SHPPTDRDPIHLIHLVKLFAKHMPDFADMLDKTKLPLMEMPFGNIEPLGFERFKICELIA
ELLHCSNMTLLNEPNGEMIAQERDIERAKELETSTEKENITAIVDNKSSYYDKDCVEKDI
TENLGALQINNQGSEEDELNDTGVSSVKLDVKSDAKVVEGLENDASGVELYDETLSDTES
VRECLREKPLVGDRLKIALEDTKILISILDMFTEFPWNNFLHNVIFDIAQQIFNGPLKTG
YNRFLLKDYLVDAYLTKKIVDADKACQDYEKKTGLRYGYMGHLTLVAEEISKFKEYIDEM
KLTFCNTAVSDRLEEPFWKEYSETILADTREKYNTVLGDFGNDQESDDDVIRNSDSEDII
GDTEGNENYGNGENDELLSNGHDSGNMDLYYNFNNNENEENEEDYAEYSDVDNKNYYNNV
ETNDDDYDSDDGKSKSAESEFTDKISEHRDGNSLYNEDNDENGSDKWTSGTSLFPPDHFP
SRSQPSDPKLQDQNIFHHQFDFEGVGDDDDYMDPNDDGQSYARPGNPLYTTPKTPPRPKT
ILFNSLSALDNNGEDEEVALGTSVDDRMDNEISSDEEDSEDEDEENDMGNEEGYSLYRSR
SKEAF*TKTFTLSHFHPLFINFLLLHFFRI*VIYNSSNIYFFN*GL*FNINRI*SYKE**
IFTFEYT*VYIGVRRKCPCLFQ*FFSVIRKA*FLFRMQL*GRKI**VHYTFWSGFSP*IN
RSFCHDFFCFCLTVLCFL*QFFIEI*KRRGST*FMFIL*LTLFDIVCSLP*RLVYW*KNW
NW*FFNIGNV*FVIICALRNY*RFF*SFIFFGNRNIRRMLCK*GEFEGFCNIIRIICTIN
SILLRNFWTIISIKEFLSIKIIQKYWSSFYSILSLFF*PMQNWWLTSLFAIILVENFI*F
ISVVHFSSGFHRFIKTLRVSLHFQ*ITIFRIISTAAFAVTQNCFYRIYQPIPFKVI*RVY
CHALY*F*YRMF*IPLPFDV*LLIL*NISQSS*NKFYST*FSSTAFVIPIVCILQFYSY*
FNIRLATSSQIPS*IA**ACIYIYRPMGMENDPSFSCTPYPVMVSWVSEIIFIEVQFA*N
FLNEITFYAVLFEINS*FREAWVSPGICNVSIRFDFN*HRFKGLMRILYDPIIIHMFI*E
RFDQITFKHIVFQGQVYCTICVFCTQEMLFFLGHRSQSIGRIDRSAFVFGVYTII*WVSF
PSFVPVVSIVLIR*KAIANVTNSCTRCSVPTVILITSTIV**RRFYCFYVYAFLLYFPSQ
VNVYLSWIT*VAKVIIRCHPNIFDAIANSMLPSVAVVTLDSESIIII*ITYTCNYTRVRI
DYIRIRYRPLRLLLRLIFGLFFCCRGCCCFCRRLLSSFL*R*RNCGCCSQCCCCHFYCSF
FFSLMRLIMLNSICFRAYF*SFFSSFFPF*KQ*QCGCII*ERLLFGIRY*HDSVLVFCEV
RSKTVVYTL*IMFTRKVLYYYFLYIACR***YASIMT**DE*VG*TISRETKD*FHVFNV
FLRIIYHAIKVL**KVSTTCNLE**FHTTITSNG*IITNRPY*NIKLNRFKFC*NNCKKP
ERNRFAL*FFDCHYLVNGFINVIFADLFQRLASRPARPEEA**W**KRCKTRLRSAICAD
GNQEAFQNAKEFRSRDSQLGNVPFDFPSKKSL*INILSATDEKSVGER*SFLFHLPNSLN
FTQFYYLVDL*FRFQQRQ*YGGLEHYRSFFQKFGNDGDFRFFHIWIYYGNYFLPFVE*VT
F*IQIEPK*CGRVGLLFRRSL*FIFNHPTVPILHSVFTTAHN*FTKLDFLTHW*FVILFC
YWPLLYFNLLWIQPVAILEKFELYTFTNIRIIDNLFNQFIWHRLIQEIKLLQLLSN*TRK
*KKFGSLR*ST*IT**YYYYIYLKYKNAMSNKSNNDTMDQKNA**KLFMYQRRMLITDKR
KIQVMVCSWSFLYSLNCRFPLEKVYPS*KSNFYSQLL*LTIRLGK*PNDRGSFPRFSAPY
VCQKPFD*IHKANYRITSFSIQRLFSFFPFPYPYLQHL***N*YFQPLSQSTFPGLFEIL
VLIQ*ILHILSNFVQHYRVDNETLIYRVMYFSRL**TIALQKTKK*EDPRRNTGQ*S*VS
ITLLFLRHQFHHC*S**S*ELSEKVDRPVNHHLVLDFSKYLRAIYDIHRLRYLGRH*CFL
LHCSFRLMADY*THFWYFLCLNLNVFSYL*FSSISVFFFRRVYEINIASSISF*AYSICF
YW*QFYP*DTFLDLSHWANNLKILLEFLILSFLYRQELSRPMSSMPTPLAVQLHRP*IFC
WIPFSNNRDRSHQPLFYVHHSFLILDQYLRLCGLVYRHFQFLPCG*MLALKMQNYVWAEA
FSYVMIYRSPQN*RIFHKRFHLLFPLLFHLCHTECFHHQHCFHDHSSIEG*IYNQIFHDN
LAQS*RNRSFLDRSNCYHYLPPYLGYEVFHNSLQQTFQTFQISFQQTQQDLHHNLNVPSL
IAALIPKEIFPRSNRHHSFWSLSSRCL**ELPPHYLYYPVVIFR*Y*QTL*YIFCHQQSE
F*HERRAAR*LIFH*AQKSTIFLVKRTEYIELGQYLVSSVY*M*NVHLLKLIDIGIA*LN
EDLRLLQYLLENRILALVG*E*RLSKVFSPD*L*LSYQREHHQFYSKRKSRSRQLM**RI
DSQYK*SVHFVQLTSGKHFELSIPFPLAQETSSQHF*VFEFHKSIFRVEFRTSANSSILQ
QLNLKAGLVMELTY*VS*LSISNSIFEQNVGLSLLLAHPKSSFAHHAMASSE*LFYHTLI
RMVYLNHENQQFWHLNNPYQENFDLIKILHHLVERVQKYHIYHNINLYHQ*MQMFHQ*RQ
TSRGVPKNMYFVAIDWETL*YVYLDVNLA*NAWSKDYLSQQYSPHSYKSQ*KF*YLFLHN
FSAYDQF*IPGCLSPDVASIIQGIATNHGYI*HPLPLRGPRLTTKNNHAHLPKICKTNLF
LQVRNYQIYLVSTKVLR*TF**LNSSIALTNSLICK*FSVSFHCFLGSIIIVLKIYWTSF
GVFSIFHSCLGYYWHHFQYRTLLVRHLFLNWDHE*SS*SRFRYQVCYSCSQKI*P*ISNL
LRIRLKELSKKDPTRKLGKNFLPGTIW*YVCRSCL*THVYQNEKLSNLGPWQ*I*LLNTP
VCPGTHFHDLINCLREIIRKIQTIYLHEVSNIMQCSVVSNTFLASNVSVGRNRQVRQLSL
VNVSF*RYLY*TQIFQKMIKFLTM*CCCHYRYCYFPMYEELRLQRMVYFLLFSPLHFFL*
PFLYNGGNAEVVTNDICCYHYKACL**VVGTRRFSICDVVI*YLYNFL**TI*ACLHQSH
IPSVF*IKSFRSCYT*IPPHSKKCL*CWSSLE*RVSYQNSRQYCCCCYHDGYGCYW*YPK
CCCHFSRETLLHLV*LIAEEPFSSHVRLSEIACLRTMRPGILPITNLINQRLVFVCTNLL
RLLVDAGAGYDDGRFQPV*ENLRWISVYQ*QRFS*KRGQTLSSSH*TAVGCKLQKKNAFE
GLFLPLF*NSA*NEHYCYCYGDCCRAGAYFPHQNLDEDHVH*SA*YGLMSGSVTHHSGFY
LQRIWAMHASSPPPCRWEFFVFLFVNC*SDCHSQVIAAILLGFLTHLVSNLLYLLLQSPI
YLPEVERSEFQTLLTR*TSPLFIYPTFSSCVRASQCVV*IISDRSCL*CPANFPLNLSPW
RIHRYVCVFCSTQRAVAIFTRLSLITSFHLITYH*C*SNSKECLIETDPGLISLHCGGIP
GL*SASVA*YIYTSSVSLNLDTVTVFSIFSWLFFLRQ**FCITERDIVYLPSYYITLYYI
ILYIREWCLVIR*SCPRLHFQLLLEWMIVTERTTPRARIVSLSKRPYGEEMNTVLFSVMH
VASS*SCTGNQGLSA*RRTPLSQEIGKS*ITTM*TLMPIPILTTQIKYSRERRDCLQLVV
VHYLRIIRRFLFWKSLW*AGPLSHC*NQRKPFPTQRSAPRSGENFLWTPANLVGKTTSIR
STVQIYTRQI*S*QGCLICQHY*NPHLFQIPLYQK*N*LGSYIMRRR*SN*RPR*ANWSW
*QTYTKSTYSN*TKNASNWKWNYTPELQYNLTHNIKKGCSVHDSINITGYSI*NLI*FSD
TYFYANG*HTAIYLVLENCP*RNDKNENESM*KQFDEM*ATLKV*EVRHRTEKCHVILQQ
VWKTLFSN*SLHQNNYKSKPIKPQRKKNRKLISSNVLLMKMKIYLVYMHPML*ERKMKDY
NC*SWHHGWIRSHQGYKPPSR*GRCQHQWGKFAKAWIRRYRI*TSNR*P**WTSSNSNSK
IWTPVLTYMKIWV*IRMPCWWTTIRWMN**AKLLTKMAWN*SKVQNWTMFRR*RRKRLML
TTKRKTNLHKD*EH*GAEKTC*QVMHF*FIITFPAMLCMYDHICCT*IVY*NQ*KKYNSF
YI*SFSFLKCPYIDVSIVVPIDQKSVFILDNSNSSAQLIPI**MRWFRSHPMLIALHVKD
INPSLVCANSD*FTIEI*GRYW*IVSNHVKN*ACPQIPNPYAIVHRACYQFFGIKLQTCN
SIGMAF**SHRFANS*IP*SHNAIFCSCC*CRVVTLEGSYHWCFCAK*TCTIV**TCRHF
NVAMCRCEDKVKLLNTFARR*IPVEYFFVPRSANQSFRIKRQGCDFVFM*LKIMDTWCNN
FFCLLLQWTMVQIYFSTQI*VP*LQSGILTSSNQHIVIFLIYLHAINSSKVTRQLSNLYP
MVQIPHFYYTILVA**AQGSPWCIKV*CGYAVSMFAMGYCHSESRGISAICF*DNLPVFI
VAFFMGHLVKIF*SRILTFNIT*RRYGFFILREGRRFR*SFFFHLLP*ALFTISFQIVFL
DKIYSILYQCYIILKIGRLTINVLNPFQDF*FPGF*FVDHGI*SGQLIHL*RFID*QIFH
VSFYILK*MC*VNSRVRFIHKTSINIRQLNVFFLITIRGPVYIV*QQSLLNDGNGSFESF
K*RR*ILFSGTVG*RVSLLI*MSKYSESCCRVCIIVLKGKYPYLSFLGIFCTFGPSHLSE
Q*KFGKISVDGARYIFLKLLLR*YGMW*LIKYNFDWFSYQRAFSSSIARTHIEILFFTLA
RGNLICHSWLVFFL*LFFFSITMRKVYVRNMKLHALTGDRPMVDPLSWFYTFRCKVIHNY
MICSGLCMQLGQRKYLFLRRSAPLLLQVGYLHF*PPNFIFFFSNNLSNVVRRRRMVL*HS
L*AIILKQNFFLDEAQFGRKLFIIMVQLVVILLELC*WP*ICYFGHNFKN*ISREILDKD
GFSSLVIGFFFHEHASIFQGI*EPLNLRIILEHG**CFECT*T*I*NDRGSYKIGIKNKT
VQATATCSGGSSPFIVQIKTIFVQIYFLGHMDDRFFPWSAQPSISFHVRISFNNIVEYSL
LAVST*NGLFLRVDFEQKIRLVVVTVLY*SSNVFSNACLVACSL*DGIMKNSWWLEIECG
HRVHRPINIIYTSIQAFPHSVIATSYFVR**SNFFELCLLIIFKCLLLIFALPQGYTLSC
KCKVYGIYKYIYIFVV*TLG*L*QKSLITPGCVYFIGSEFLRNNSFRKVLHDPTHSIL**
SCLGNHNSVIDTKPIICSMYLPIGPVFTHLRHHFL*SHVTTNTAYDQNLIGVNVSHSSFC
YFN*HGE*VLLQRVAKILYSDFLLARCLVE*DLIFLIALK*ILGK*IDGSQYTTHRKIHP
LYCIGKFYQVFFVRGFFS*LLDVVARRGLIRYLQSSCKSIKTITDSNIKRFTKDTVPFFR
VCNNLCISTTYIQYHRILSFSDFSPHFDVTNAVVYSHQWHVPQ*GARSGGDDN*MQRGPH
AGTFGKANYINV*CRAFDVSFGQCLFYESYAPISVMPCRVSRQKSLPRRCDICVSNIRKH
LSFAIIR*IAVGMFRQKRMLNYTNAQFICRTFKSKRNVVVPAIFGWDSVQVDHFAPDCIR
ERLGIPFT*KINICIVARSKNGYSRTHHNERIQFFRIKRYYRRNKKQNKKSPRRGIEPRS
GTRQAPILTIKLSRNVICWIFSLSFKYLYFVELVPLQLRSRCLQVFLLCLNKNQPLS*QM
GEF*DNCWDAIDDKDYNIHTQNILEIVLEHIGILKMESIFLHNNTTIIFCFRFICFIILL
YYQSLHFSFH*IDDYFSTLCPLLTPHMIVY*QYEYY*TDDISTSCFA**TLAGVPSV*NT
SFTPRSGSSNQKIPRRISSTNLSLGLCLT*CI*NHHYPI*RTHCVARPAKNPGPKVKRNF
LILTLKLYYYEALKH**INQHRTYMIKLDTALCIFYCLN*GSNTYTFFSTHQMVSCPCLR
NLQQ*IRHTSAKDNMLRSD*SKYHYAVQIDLTPDTKENRGSMSSVGDSFRPSTGPLITFS
LIRWNLWLFFSS*YLF*DFFFQPIAYLLTRIVISDIFINNYYLFFFIPFPFDKGSLVPCR
YQAASLIYPLTSCSKVTSPISLECDNGELDLVTDKIVKCQFGCFFLRPISLSSGATGHLP
PHSKLNMISA*LGQHTFLPEFALDETYKDEGEVHLNECQ*DDVFSPRLIFEFLVYKVLFS
YCPQQNKSRKEQTKDSNIYKKQKKEIKNE*YFFVREE*SR*SETQWYYHRF*VSNSGANN
HSLKWLRCFY*RNRFRVQMARL*RFFQKGKTY*S*S*SFRS*KSGYHHCPNSIEAPLEE*
TFANDCHRWCHRYWSAGWVRYCTKNRWSRFATDWMGVYRYHDLRYGYGSG*VGCYLPYFG
WVHHVRYQIY**VLWLR**FQLYVTMVGCATIGNCLCIYYCKFLGYRSKV*RWVCCVVLA
CNCYHQYVWCQRLW*SRIRLFIYQGHHCCWVHHLRYHSKLWWWSNRWLHWGQVLA*SWCL
CW*HSRC*IQRCLFCLRHRCLFFCRFRIGWSCCQ*IRRA*KVRS*GC*TSFLENHPILYS
VAINDWSFSPIQR*KFDWCLLCGCCCFTLRHCH*DSRYQGFAKCCQRRYLDCRVICR*LC
HLCMFQNNGCPS*TEISARNLFLR*P*G*TIGGNCCHICIRSYCVCCRLQKGR*SFQLVT
SLVWVVISIHMGWYLYLSHSFQKGIGRPRKRLG*IVFQVSYRCLGFLLGVIYGYYYVHCP
ILRCCIPRGRFSKCGRFLRSLSILPTCYGYVHRTQDL*EELEAFHPSRKDGH*YG*KRSR
FRFVETRNCRRKGNYGHKAKMV*NLEFLVLMNRTTTKKDFIF*IIIINIFIFSSLI*RKK
GNVYSQKLYISVH**DKLYYERK*GISIFLLFVILFMFF*EM*K*IF**TAR*KLICVSF
NQSI*FPRILFDILIDSD*IRW*QFCFKLIQPPYSPFPY*TLGIRSSFFFPPLR*LNFAV
SLLVKHFPTINDI*NVIETKKVKSLLTFTAAPLFSS*GNPLL*S*EMGEC*DNCWDSIVD
KGYNIRYTEYTRSSPQGYRNPQNGIYISTY*YYDYSSFRFICFIILLHYQSLHFSFL*LR
*QLLITYVIILTPYMIIY**YNY*LIDDSGFLFQQILI*ALSLIANAQIPEIEQPTQR*Y
LGLSGLRTVIIS*ILHSKLV*YITFL*KYMIQFLGHQKIYLLWACGVVGSALP*HGRGLR
FDSGLVHFKISFFFFLFPYVSFFPFFFFFFFFFLHYFSMKLSSKDSMQ*KRRYE*RRLYE
QR*RQRRRKKIRKANFRQKAQERRRLRCN*QRQHPPPPMRLVRETIATSKRK*AKKHHTA
CTSGDEYAEVSREKKEKKGRWYN*S*GYAFRVR*KHSRLQVCYNRERKRPLETKS*KRKQ
Q*KRGRRFRL*PGKRYQL*G*SRRTLRAGRSTVLAHDQRRAGYLTTARHTYPSGCEFRYD
**QKRRTILHNEQCLDGCKQTRLDSPR*NPVAPGQTSLS*VQSHKTVSGH*RPVGARKDR
EKVMKKWN*TPRQRA*ALQCVRIHSVPSSWCLDLEAAALEKPFLFQIGKPNESIKRNVEV
VLTFCRFWASRSFCTARPGSCGKRKKQTKQNFSFFSPLFLLIRVYK*IPSNVFPSRDLGV
SQIKAQQRF*TAIYAPFIGN*EEKKKSTTTQFPVYSFLKLRLFFIHSFIFI*I*PTTSPS
FKQKFTLP*FFKKFQYEIIRSISFISLHRRLGRSSCPP**QPPPQRQACRCHRYSVRQRR
RRCCYSSCHHRYLGGC*WKGRVCCCCHHYFVLDCRRRYYLCRRLFFLLFLFLLFLFFLCW
FWRF*RWYHFLF*FPIRTRCCLLGLVRSRRLGFHHGHER*HRHLLSRRILLFLRLFSRLR
*DPMAF*TTFRW*IRWWFIL*ER*IIPFQHRH*QFVCRRSRLCSSC*QGLRLHCYLWYRL
SRF*KHGRSYRSWRWFLPTNQRHQGGLLLSMAR*EDLCPILR*QRWCLCGRWLYLGY*GF
RCR*LGPSCLGCWLH*WYHLLVHHSKPKQQRSTKL*HQDRCHRWLYRQWCLLLRKWCLLW
LWL*RLYCFSYFWFC*LCLLLGLFSLNIANKLLLVLFLLRSFYGLFFN*FVFPQYKKTQS
FVLSLLFHYFFFFKIPLDIIIYSILYNIKSQEKKCFYHFL*LHIFFCISNDCLHIAMLGF
LLWW*DKWTC*FQCRFVNVVVSV*QNTNPTGVQ*ETWIVYQMSVRFQFHIWNCVVIIRFD
ILNFFNRLTLLLHTQSKPNSSKITQCMSVRKDHDV*CSALTLVLAVQVLDSGNSAGKSQP
NLLSSLTVLTPISPDIPWPLLVQTA*LSQFNDFSSQHSLVVTVLPLSQVVVYHHTDLSSL
LVA*WFQNQIHSLPGTQTWRGEDISDVVWIQKLIIAENTLTGPQHLALTVGR*R*ICQTS
ILA*LGPFSLTVSDNDTSGG*RRHCCLQLSVGVSLST*L*TKCAYLS*YFFIFVL*IIME
KKNSSRG*TEKKQ*E*VSSEKCKIYALYKQILVSFIYFCICLSLTLDSNLAVGSL*RVCS
LFK*RCQEM*GQRN*PYHY*FYHCF*YSN*WLRFISIMVISTIQRLAPLQEEDHM*RVCP
TMMLVYLYRFWTRSTSFGM*AVPRKLGIFSRSN*LRTVIKINMD*YCPMELATTPSMTLR
LFSLSEFLTTPLHNSLVMECVLPLRPKMGFSHRIYSRRMRKSNT**ILRAS*PIIQI*WA
SRKICLAYLLSWIRIATKATTIRRYPLWMCL*MWPQKAIGTI*IVMVNSVHRCGLIQEAT
*NSRKMPCGIESRN*E*YIWKV*AS*RSTCSTQKRETTGLSYFKQPKICTCRKTCTRGKD
TLAVAH*MAN*RRQWSCWTYPLANSIGTTWMRPLRTPMITQRKLSYSWSRNLARSLTGNP
MSSPNGK*SKLNQTSRLGHSQLNRKLQTILTLGCSRSC*PYGIIARFCY*SWAFIFFLLA
*EFSKEGSKKLDPEEKGQARILWGYCPCSIA*ARTYIHTQIIQYRTFILGSQFTVFLW*C
YLRSTAGGFLIDPIYSVVGWPER*NSSQTSC*RILWAS*TVLNECPRK*TTSLTRNKTIL
AE*HLRCRFVVAAVAAAAVLLCLLVVHPMPLDGLLRHRIRSNATNFDQPMVATTN*WLFH
PDPTQHA*LLWGQP*CRVLVYCSRPMR*LW*WCLLFF*PTLKVCFFFPGMYDDCLTC*DF
PLAPCIFTFIVS*SSYNQIFFFFFFFRFYNFFFGIQLYIVLKQQRT**LANNR*NNRIIT
NNYIRVAGKKIRRTISAKPNY*LVDTAAGLELVWSSLEAFSFSMVALPKSNPVDTMALGT
LSDLLRLFS*TVVKRW*VSLSLVFVGSMYTDCNLSVVGFTMASYFSLARSLVGSI*FDLT
LDWISCDIPLVVEDNSATWGKEEASVTLFSSPEEPISFDAVEPCKCNGLIRNSLNRVLEM
LAT*STKNHTSQIPGVLECDFQLYSKPSTPSLNTKRLTNSSNLKAPSFPAATTCFTRRGE
LDDSETHWFTDPKTTRLKEINLSTGGRDSAYLINLDKAGYLCRCDQVACGNSTDGLEEEI
DDSDIITLRFWRVSDG**LPIHSVIFPFITLAAILLNPKEYDHPPRRRKSRLLLSLLLLL
LSS*LHAL*HIFQLTHLHVYTYIYLYMYVYICI*IYEYGYDHSCEVRWDYDCLHSGACSG
LPAKSSCSSADSPSSSSKP*SSSSSSSSSSSASSSSSSNSNSKAAPVNQSTALGISLSLS
CSPME*SKARRSSRSSSNSSSWSSFWILGGSKKLKKDSMGVIFSMVLTCLVVLFLCLRIS
RSTVTLWALSFQLISQPSAWS*IKSPE*PSSFW*K*VLHRMSLVKNGLAEESNLNNSLKP
GLPSVKYSRPISCRYSRTSASRSVIVSQTMGKFSNAVSQNEGIPFTCSSSESFWAFSSSS
TNNSVSLSDSTISWPFAICSGLGCSCPEMILDRCSQMGLYFCRNLFSSSNIST*NSFSTS
NSSLCKVFKLSSFSLTFLGRPPTYPLSWPTSEPSLSWMDCNNRGWLAKMSSSLMVPILSS
CSCAWALTGLPFFK*LGFRTDAGVL*GVGALSICIDDLGFVLIGSDMILRFALGPTGLTK
SS*STIKLPFLIPNAAI*KEKFSQLRG*YKKDIAHCYKNMYVFNIVVYRCYLR*MMYLSM
SAGSFPTNLFSQSTQSASFGFQSPLWTHFCRSIPNVGSVCLYLSTESSFGICLCNETGPC
GHEVLMYCSWSHVGKRLAISTSNR*ETSPFSNCRHFCDLILDAMSLVNNEMVRGCLCNVF
QNDIYCVCVCDLPVCYFHLHFS*RSLLVLYAPFQAGWIPRPLSARAQSS*SQTKKRKSSR
TINASSTISQQLDTLATVISEHSDGIREMQDDGRKKGVPGMR*KRPVVQAYRR*IGHGTS
HDD**FDASCHAQMVVSRFSLSLLISCEE*DEM*IFVSNPLGRAAEKEK*YWNN*VSDDE
KRGYFVLFTDDKRL*EPLMPTAKRTSSRASLALPFQLRLVHKKSWGHRLRDFISGFLKSC
RPIAKYVFPNFIVVHYIYLITLSIIGSILLYPCKNTAFIDVLFLAAGASTQGGLATKSTN
DFNLYQQIVVYVITLLSTPILIHGFLAFVRLYWFERYFDNIRDISKQNFKLRRTMTLQQR
ELSGSSGNAARSRSFKDNLFRGKFVSREDPRQSASDVPMDSPDTSALSSISPLNVSSSKE
ESSDTQSSPPNFSSKRQPSDVDPRDIYKSIMMLQKQQEKSNANSTDSFSSETNGPAFIVQ
ERHERRAPHCSLKRHSVLPSSQELNKLAQTKSFQKLLGLRRDEGDHDYFDGAPHKYMVTK
KKKISRTQSCNIPTYTASPSPKTSGQVVENHRNLAKSAPSSFVDEEMSFSPQESLNLQFQ
AHPPKPKRREGDIGHPFTRTMSTNYLSWQPTFGRNSVFIGLTKQQKEELGGVEYRALRLL
CCILMVYYIGFNILAFVTIVPWACTRHHYSEIIRRNGVSPTWWGFFTAMSAFSNLGLSLT
ADSMVSFDTAPYPLIFMMFFIIIGNTGFPIMLRFIIWIMFKTSRDLSQFKESLGFLLDHP
RRCFTLLFPSGPTWWLFTTLVVLNATDWILFIILDFNSAVVRQVAKGYRALMGLFQSVCT
RTAGFNVVDLSKLHPSIQVSYMLMMYVSVLPLAISIRRTNVYEEQSLGLYDSGQDDENIT
HEDDIKETDHDGESEERDTVSTKSKPKKQSPKSFVGAHLRRQLSFDLWYLFLGLFIICIC
EGRKIEDVNKPDFNVFAILFEVVSAYGTVGLSLGYPNTNTSLSAQFTVLSKLVIIAMLIR
GRNRGLPYTLDRAIMLPSDKLEQIDRLQDMKAKGKLLAKVGEDPMTTYVKKRSHKLKKIA
TKFWGKH*NQVYPSLPT*EPT*FSLSIICIISEVYYSLTKYKRKIRKIKTLKGVPLRFNK
HNESYP*YTFDF*LF*KNFSSFFFPLFTYCIFHN*IAFCPLRKKAENEI*TTFRSE****
**PTKAINRSTRSICQVTT*AKV*VKSELRQYNHKSIET*LLWKTNYFVGGCTGHACIHL
L*LP*YLFTP*LDTY*ITVNHMNKDYPYGYYCSCPFLVCHAQVA*LSLKQLNFMSILSEN
FMKHSLFTLFSHF*HYY*EARGTSLLF*A*ITPPQDIRYR**VKFANR*TYLILLIFFLS
KKAYYSMFGSNHFIVLVH*YAVHGSYPNSKYF*TFFIIFQ*LGHCIV*HYFGSVSIRN*L
LINHG*NFYVSN*LFLPLIGRAS*SRV*WLLESWVRETKIEPLDMCTRMGSCV*RWCLSP
SCMQ*LSLGTNTQHLAYLMGPG*NSFTL*KIFLVAVI*YGILNRLCLLVPCTIIIGTSIL
KPWIY*ALDNNPVRLWKD*SMG*DLLIMEEIVIGWHMGV*ITTLFRNQ*RNHGKMILLVR
ELFLRIQIIRLFTTTRWAIDIVDQ*MI*EEMFKVGHQWLVK*VVKCTYIHSYCAFGYIQN
KTTSTSNAFFSIIVTWMLILIK*NKCYCNFLPEDWLYMQSGSWTISPLLLFFYYYHWTCL
LQQQKWQQQQQHHHQCILALPFISCQKKLTSKRGKNINFSLKNA*HIHMQSKKWQWLVY*
PLSLVSNLAKTPSNHEPPVWLLRLYQKCSHPSLFRWRQFRCL*PVIQSLCNPTV*LTQHM
LHHLSHRKDNESMDCRNFVG*RICWQIHIS*N*TLQMGYSWPMLWDRSSKMLQSLHFDIF
A**HSKLLD*YPIVVFV*RCQRGSSMHPQQW*QWYHSVRSSLVDEFAYLQGLSGELCKTR
MYQNILHAQALPPVLPIEHPSIKPSNLPL*IFWISEISSL*RQLYSILQPALGFSEHLLE
TSKNAPLYLQMLLPVTGNVAEHVMEELRSRFPQLLTVLKYS*Y*LIFRLSFLLLHFVLLT
KVFVNKPLIK*KFYEIPIKPPNIFIYSLLLR*DDVRQW*AKDSRVFLPFSLRHALIQERV
PKYRKETRSGVSK*RFLWVKRG*TTANMHV*NPKRRSRACDAWYEHPEGI*KS*SLDSCL
KS*FFIVISSLYISKHHRWAGYQKREKKNAEFQICTHRGEFQ*CVM*IQYICISH*MHTY
ESLP*VCPSEKNWA*QKDGCRYTCVYEKPSDDFHFGNTAVQ*TLFFFTCLVMEMNLFASI
IVKSE*FN*QRVDSCLANDVFPNNHRSDTYQRPQEHLRTT*CVPTTYKVPSVSFG*PVAA
IQPTDYANERYAIFETRTFINGPDVVKQNKQAPCYTQKGKPEMFTNLEIS*SMHHPDSYK
KTDSSNCGAAK*IQHTMHTAVNSTKNQG*VVKYHQTQ*KKLCWPYQCVR*TYSPKE**TY
RSSVSRM*TGCTIFFRSVFT*CDSVNWR*FWPW*APIIL*VATQIN*ITKNVDHVPC*IA
VSKPHRHGKHDNIKHVGTHKRSVFEINVSKRRSVLFL*RMYEI*LVVCESS*ILPCLKP*
PRHLALKMLRWMITGICQ*VFAAGRSHLNLNGVLGNTQFSNRLNNGHN*ILLQACYFVYF
FEDYHCLTSFCHVINSTRC*EGSQGKADKN*ENKEKSLCYIT*ILDVRARS*EVSK*ESP
RYFN*KHAIFLQPIFLDCRYQSLIKQEEPRIGTSTEKTADKQDTRT*KGYIS*RSCSVEL
ATSLA*RRS*FKIDSLGN*SHELSESAGSIVLDSMAVSLARSSSSLC*RRGCGIRTPGTI
CKLSEPQNTCAQSLATTSRSFSSSIFPPYTIVAM*SRTCAQGMLLVELVANTFSKYTEAN
*KSQSLK*YFLENP*GTNRVLAVIKA*NHDNRKVQYTLHTPEILPVKN*EPHRSLTVSSI
PGISSYTNLSVLCSNGAGSLSPVKWHVMNILNFSCSSAAFVSSTCLCRYVFTHDSDICMF
CNNIQPPSILDFDISS*A*FRFSIDPSGMIFNDSFEAFANSINLNVPSTSRSLAIVK*LF
SELATTSAIFHSSTKNSFLNQFNADIYDLVVT*SHKYRKSLFVSTVSFGTPSLLSERTPI
IVRTASLYCSLSMSNLYKQNIVIAIIILNFLSRAVEN*QYTS*YNSQRISSTRVLAALVS
LDFLMKTRLKHDRNCPIEMP*NQ*N*PNFSNIENILTLCLPIIEYSSTRLSNCGKNSSDS
LSFFSMFMASFFRLFKVTISSSFSNIFPCELFSSSKSRFSRFFSFNLYSVFNFIKSSLFL
CISAFSSVKVMSKIRVSILSLFVTK*TNLTLDLRNIGISPLGSQE*MNNLKSPETSTS*S
PISTVTLFPA*LNSLEISLDIIGSKNSPS*IITTLPNLIAFSNLLTKPSSRKLRSTVLLP
**FEITVIMWELGSKRKGTASCEFMTMLIFSKK*SFLSKPHSSHFIFSSSVTK*SMKR*F
TSYLTANLPSRRFKMTNMSALSLSFK*PKYVSYMDEIMQFPISSWLVLLNCFVVFSHLSF
SKVKLLTKDIDLSRLACTLLISVLMASTSLINKLYFRFETSILASKSCVISSAASKLAFV
FNDSNSILFISCLSGSTFSKTLLKFIWALTH*YSGPHALLALLIVS*VKLGSDKNSSSIY
FRIWGFICKVVS*CTIL*IKSSFLINCWISLQLENW*PKMAQTASITIFTPEGGLTIDLI
SVNCCFFMFFTPRCASKMVGSIS*ILFMTTSFLFLISSSCTFNIFLISSVASCFLSDSFC
SISILSNVLRASFSFSVSSVLFFDKVLFSSLTFKTDSFSFSRPTLTNL*FSCKS*YFAVT
SFTKARKPSIKYPGDLGFTPTFIFW*KFLSKCIRILTTASLIVWIGSVNTNSLLTSGTIK
SVNSIGITSTILLATWDIVFVSQSPIQLIMQRLKRAGELIIAEDLLFVGSQIVKTT*RFL
AISPTNQSYSSCSVSNKRPKDLVLFRKLFKSLSYSSP*NKSGISALASNVFILSKKAVSK
MLDSSMIKQVRDSLSEQSEIAFFKIISKSLRLE*RWILG*TIFKPFNHATNLVKIVLPVL
LAPISIM*P*TCFNARSIRKIWSTIDSCITIGTSSSSSQNVLNLSSIKFTRSVLLTSLKS
RLNKPEKRSEVELILPKS*LGKYLSTVS*RSCSKLFFSFTPTSLSANILQAS*AHNRISD
LSVCLGPVLIAV*TPLTKRVNSLGEKR*CD*SPVLYLALHSLYK*TEARAKGSVYDLNSG
TSLKMAL**IS*I*ERDFPLG*PR*RIAACRVNLSDIGILPGSVGGLQAPTICILSIVTH
LFSGVFQNPCFSINCLKNKTTF*EPYLSSFGKLISSQNNTKFFISDFGNKVRPFDVVT*F
VCLCKADKICSVVVSFEKFIPTTS*SEEFRSALFIIIVLPDPGGPQRIIPLFELSKS*KI
FSCLIVSIVGITMSGLMTSCASKETEGISEQKELKLNLSFAITMVE*SDSSWLSCPK*VF
IVCIKALCDSPVESPASAYSRDLLINKVITSFKLLSSKF*NHCL*LDIK*TANCTAVSNL
LKVRTPRM*TKSFEHVKILVKEAISKESDIRSFNLSNSNMDSLLSSAS*LLFSRWSILED
IEHTSVENHSKPHLVIVAGVVWSRLSVSNKMRKFGGIGSLSPFGSVKILLSSRTEFMAST
YSGSKSLSNTTQILEFLKVPVISSLTLLRIEVKSPSLHSSVALSILPYKDSFVRTFVSIT
*TTLA*PSKMAMASITVFHVAVLPQPALPTSIKACCVFCM**NCIHFLRNSSDIEKPLL*
PASFKH*TIAFEFSGVPAESNIFDNSSLNTNSSVSPSDGKITLFKLSTTVFSPSPNSLIK
GLQFLNTPFSVLKPK**WFIELHFEDNSSKK*TIFEAKDLESSNPIICNIISAIVPLCGD
FIENSRKLFFKFSGNSDLPLYPGFKVINTAV*GLNGVSSSKSVIWDLPTWRPFCICWILA
DTALKTFSSSLLNSSKHPHAPICVIPTRSLERT**SKESSQLKTTTTRPRF*PNAFTVSV
LPVPAGPKKHPPYF*CRESVSVANPIRSNGVYINLSGMPIYSNLYCKR*PL*EIKTELRS
SKVSFF**NF*TFAHSSRASSLVEQFLSCPITLLKCKYSTSRASIFFFTLSEDLFNLSSS
PLIFISTSFQYFEN*LV*RHFSTSSVHIT*AERRMA*KIYLDTTTSMSVPSFSWPKQSLN
*VKTLSLISVSKMFNHS*A*IESFSSIFSFKFRTSPSTDRTPVMKSSRNIIDSMLPNIFF
INFETWSWCFPDPMIFKRSSLPKK*NLGNCLLCLSKNVDSDDFIIFKESIVNFRVVSKFG
ICITSIVVSS*NALVVIILYSLVKLLNFEVSSGKKF*MSKFSPRIPYKSNQ*NCTSTQFT
*ISDNFVSLDSKSKQSCSKIL**FEAFIETSSSRSSLQACSSTSHSLTSLSPLECSMTSY
*ASFQNFLILFRDFSITNSFWALSIIFVSSISFKVKLRTMTSLRENSNLSSRFFCICLLP
ISRNIMFQCRGFKAPSFNSTKILFTEVSMLTCENSDLYISNCLTALGSSSALRRKFAKSD
*SSNTSTLHHGVSKVL*TSSQRFLMLLQTRSYVLTSSTTCVSWSFKTTGISNIFAAAATE
CIFFFNLVIDSLKNSRILSASGGVNVGDIGFLTDQLSFKDCERLLIFSTPSSRLFAITTR
CFCNSCST*LKLCLNELKSLSSWSI*TKCDGNLTFSFVSALITDPSSLIWISRSVRCLLF
TLTASMITVIFFKEVKFISISSTASLSLFISSCNFLASRSYIVKRCLLTYKIQESIFERI
*RCASSV*STKFFEKLFRLIIRSNFD*ESRRPFKIPKHLCVLLSTTSKNASSVICQRNSI
FCHSLT*EFILQCKF*TCSIQFCISSFSLMTSELKVRVVERG*SGSCKKLIKTTLFKRAS
ISFSKERFIAANDGDDVILPSLKLSFNTCFGKCIFFKFKRTFSKIMLIIKLLNVEIWSLT
LVRPLVKRFSKIA*ILLIISSTSCRSSAVPSKDFRPENSLAN*GSEFFNI**SERIPSID
FSNLARLCTEQDISELSSCKDSHGVIRICCNSSHTVCTFLFRKMFV*NV*ESDLLSEKKV
*ISSTKFIALGYKYM*VLAIRTMWLGT*KAI*VKLLNSE*AAAKAKSKLTFSS*SSSLFL
ISFKIGVVKRFAVAFSGKFPNQ*RNTS*GFVSLRSCTIEVDIERPSSVSFQLEPKSASRY
CTILSIRDCTFRK*EILADMGGMLFKASTCRILGKSSKPVSSCRISFFISSSSIC*FSST
FTFILGQSSINGLNFTR*LNFSVGQ*SESIKLANVFCNFFSKSSMFLLNSLSACSNFNRK
FTEISWICSNG*YNLCISS**VEGDILLMVSANEKNRLRVLKISSKVAFTDALVNVSFCI
SSSCGALFLRSSLIKRLTSWTISSHSSIMPADFSYKPKKEPYSS*NKSERLLRIASMTSC
EILSISTTNL*TG*PEYLNFFKEDAKTGNSSCKSSRLLAWRTSSIGIDDRNWLYLSASLN
LSESEPSFNKFVKL*NLFAFVRTDRHT*NSWLCVCSINDFSTS*KFDQNSTSSKKEPFFI
SLSMANVCLRTKNHLFAMLCKMFKNLILSKSLLGR*FA*SCEVAPFDTANLIMLGTIAKR
SGVSIEVCNC*NCLEMSSSFLLVLSIVSTEYVFVSDFINWPNTDDTPCVIIEARFPAFTG
PGKYMALICVAIGSASTITLLDLIINRVEYFLFAKLASYIASSPMSIVTIVLSSSSKRKT
NNVSNSLPSNNPKKN*NRSRY*QCR*SMNACSFSLGEFFIPVTVAATNSISSLASLASFL
HIA*KTF*RTFQFKL*TSIIALLCSMLSVNFYM*CLFTFH*LIY*NPYNATFRASIRDDL
IK*L*PYVKTTKDMISIPQKLQQT*VK*VQKSPIVTLFHEYTII*AKRWQLWERK*HSFA
GIALK*QSS*ITWHFR*KESSQIAYSIR*KPFYHS*L*ADETYKQTARLSPKDCCCGRWR
CREDVPADILCPRNISD*LYSYYFRKLCHKHRRTQRSNYRIGIMGHCRPRRV**T*TAFI
YECRCADGVLFCW**DIA*KCGRSLVPRG*AFLSFHSNHASRP*IRSI*S**PFRSGGTK
FSRILGQASGGICTYSMLSTIERKYR*SI*NCHTHVTFRFIICSQRAYTYNQKSL*KKYH
QIRYRFFYWRYQRLYFRNEKIKKKQVYYNVRIMMKIILLPILYALTTFEKWQEKIHTFYY
LPLSYLSRRNN*NLI*FNFHFSESGVIYRSNIFEFIPILS**FILIRCHKVLIRY*SSLI
TLNT**KLL*HKSTNLSFYFRGIV*DKVIMYEQFEFSFFFFENSDNKVKYKAHLISSIKR
WSIITCMRCFWTVQKSIFKARFFACRNFVKKHNYKLISTMTGSTEMVPPTMKHTVDNKRL
SSPLTDSGNRRTKKPKLRKYKAKKVETTSPMGVLEFEVNDLLKSQNLSREQVLNDVTSIL
NDKSSTDGPIVLQYHREVKNVKVLEITSNGNGLALIDNPVETEKKQVVIIPFGLPGDVVN
IKVFKTHPYYVESDLLDVVEKSPMRRDDLIRDKYFGKSSGSQLEFLTYDDQLELKRKTIM
NAYKFFAPRLVAEKLLPPFDTTVASPLQFGYRTKITPHFDMPKRKQKELSVRPPLGFGQK
GRPQWRKDTLDIGGHGSILDIDECVLATEVLNKGLTNERRKFEQEFKNYKKGATILLREN
TTILDPSKPTLEQLTEEASRDENGDISYVEVEDKKNNVRLAKTCVTNPRQIVTEYVDGYT
FNFSAGEFFQNNNSILPIVTKYVRDNLQAPAKGDDNKTKFLVDAYCGSGLFSICSSKGVD
KVIGVEISADSVSFAEKNAKANGVENCRFIVGKAEKLFESIDTPSENTSVILDPPRKGCD
ELFLKQLAAYNPAKIIYISCNVHSQARDVEYFLKETENGSAHQIESIRGFDFFPQTHHVE
SVCIMKRI*LHI*NIYHYVYLSRVNVFLYF*IRTF*KLKMYLRFIFQFEMNENYTKKVTC
RVILCTTIF*KFHIRYSNV**RV*RKI*GDQA*INHIQTIETSYQNGKR*GPISMFEKSI
RFFIF*RMNGKCMAV*INVRKIS*CKQNVGIRNVWKTYLWLPIISNSEGAIDQL*MQPTK
VEQFLTKFFDYFLHMY*IITHHHQQCVF*TSITNKDLFYIRSNFTFQENVLLPTESSRLM
TTHLFKSTSLRLMKKDVLSQVSTLPTLCPVTLDPEVNLMIL*TVWLKTMVC*RTSGLTHV
KRKEKEDSI*ASYRSD**VTDDFSLHYQLFTICSNSSDFR*SVLGTL*VFRL**YIVFLD
NRNLFNLKSHCILGYSV*SFAVWSP*ETPEQKKDPKTP*ILLLYLCVIHFQESKRTNNLK
LA*RGAIYVDKKQSIRVPENVCCL*AMPLLLTYFNIVGNSWWRLSRDSIFAY*CDGNV*E
AGYCHIALFRRLFTRCVCPWSPSE*IVRGSRQKRRH*NMPYCDDLSI*WHFKRASQEYFT
INIHQNCVGRAFKLPRRKHTEE**EFSSFGKT*IILCLNQSKTMGINSVRTSSLLGFRHF
TSE*RIFKVV*HYV*TNHVTSGCYC*YRLA*YVQ*RCHDANTGC*YCIRFTKLYF*KHFN
*WF*PGHFKPVLQSKLLH**AS*RQFLSRMGTVIIYV*RNYS*FRLPIFTCYELL*T*H*
VDSFHWETQAMVIVVPKEFH*KRVS*SME*GIRGI*GRTSIK*RSFEAKD**FR*N*DS*
NDNPSGCPSIERTHYESRDRHN*YSGRKRGQPERRACS*LGS*PCS*PCPIGFYQVVNNL
Y*QRSLD*SASK*KQRIFERE**QYNQ*QFKPRPRKSSK*YSGTKQLL*RCEYSS**R*A
PKCRRGG*YDR*RFKFWRRKPPR*YKHGRFFQ*QCK*STRWQKF*QF*RK*YQCRI*PFK
SRTEKVN*QYTKTKCFY**LTRRRRTTYLC**QYTVLRKRQGRL*RISSGRVRVKCNR*R
RRIF**RCKRCYRRRNEDECSCR*TGGYETYSRGNQPTATRNAQLQI*LGGL*LSIQSRE
VFP**YF*VCSRVNFHAHIRKIKRHIYVKTFSTIQKCITILYTFKLEIYFKGLSATTSDA
CCLSFLTSQRL**LKNFCILTSSIE*CAKNLS*HHRTKV*IYAALTFVDFLFGL*SFLFL
FYNKFVKRPPSNYIQDV*RYY*Y*RIPNSNQL*QGCLQVR*YGIGRKLVKRCFRLRFRRT
ICHSTTCHHAYY*RSRCLGSSSIWYW*DRYLFHCCFAKN*HLCQGSSSFDVGSN*RIGFA
NPKGCHGFGFPHGHQGPRLYRWYFLC*RR*RFERCSNRRWYSRSCF*QHPKT*IQN*QDQ
DVHLR*S**NVVFWFQGTNLPNFHLTSTNHSSCSIVRHHAK*RLGSYHQIYEKPS*NFG*
EG*IDFGRYQTILR*C*RRRIQIRVFDRFIRLYLRYSSCHLL*HQKKGRRIDH*VKKRQI
YRFCHLL*FTTTRKRHHHEGIQKWFFQNFDLH*FVG*RYRCPTSFFGY*LRLTS*QRKLY
SQNR*RWSFR*KGCCHQLCY*RRRWRYERTRKVLLHSN*RIAIRHRYFVELRETKTS*KS
IL*GYLDNVTYISKKLYMLFVFNLFFFLHSYYSSKSKRLSARRLKYPILIVCFVFLYISE
RIYLKFFKFIKNNIYKRKKKKIDALLIEIGAEKKKCTSNAISRGLGWLSQMIL*KVGWQR
KH*RL*FYNVKRTHL*KMIRTYT*SSTRAKKWA*TGTTSPVLFH*QSTSYLNQGT*TYYS
LPRIPLPCIEKL*RKTSIRRNYSRKL*VSRT*DVDSKGVN*PNFIKILTWSLPITEFTTY
FRRFLVADFITVVKNCHT*SACRKK*N*SVNKWSKNVTPFT*EHN*EVYVRIPHTFPIMT
TA*ASGSVIFKNTPYQKFCKTSKIQ*TFSLIKVRDRKAASLKEE*YLYLSRPVTVLVCLY
ISFQRLEKIRKMKI*VILNCKIKASSFKYGI*TLPMKKRDFV*LIIALIKCFKL*FLSRI
CKIIEI**AKKKKKKKRTDTL*K*NKHNKPPFACLMIFLILYISSGM*HLYMQRFFCVFS
IQ*LFI*KRRSFMQICKVFLTQVKKLLFVSLLFCLIAQTCWLALVPYQRQLSLDSYFFRR
SREVSSRYDFTRRRHMNQTLKLSSNTYNDEPLNKTKGIKNQRENATLLMLVRNWELSGAL
RSMRSLEDRFNKNYQYDWTFLNDVPFDQEFIEATTAMASGRTQYALIPAEDWNRPSWINE
TLFEEALQLMEEKNILYGGSKSYRNMCRFNSGFFFRQKILDPYDFYFRVEPDVEYFCDFP
YDPFKVMRQNNKKYGFVITMYEYEDTIPSLWEAVEEYLEETESADIDMESNAFGFVSNFD
FIGKSFGVIDSNSGYNLCHFWTNFEIGDLNFFRSEKYIRFFEYLDSKGGFYYERWGDAPV
HSIAASLLLKKDEIIHFDELGYKHMPFGTCPSAYYLRLQQRCLCDSNHPDNIDLNVISCL
RRWWKDGSGKYFLKHDS*REKRVSAYYKYVYITK*PSRKMFHTSGHHHFMGRLTENIRSN
L*RRWF*RWITSAPTVTLFGTEDLSTILIILSLSHPEIIY*K*TMPKKRKEKNLKKTRAI
ATVLEVRIG*KLVKKTNPAPINHQTIGSLKHHKLLCFLLREMFFKASKVQGKKNSFW*QM
L*FTAFIVKMLYARRKRKARAYFG*EVHLRIRAKELIRSELVT*PCAL*NTRKLLHRTVL
YQVVRSIWKRE*SFAMSKNRDPLLANLNAFKSKVKSAPVIAPAKVGQKKTNDTVITIDGN
TRKRTASERAQENTLNSAKNPVLVDIKKEAGSNSSNAISLDDDDDDEDFGSSPSKKVRPG
SIAAAALQANQTDISKSHDSSKLLWATEYIQKKGKPVLVNELLDYLSMKKDDKVIELLKK
LDRIEFDPKKGTFKYLSTYDVHSPSELLKLLRSQVTFKGISCKDLKDGWPQCDETINQLE
EDSKILVLRTKKDKTPRYVWYNSGGNLKCIDEEFVKMWENVQLPQFAELPRKLQDLGLKP
ASVDPATIKRQTKRVEVKKKRQRKGKITNTHMTGILKDYSHRV*GCFD*IIFVCILG*RD
CDYIYMHVRVQHTTQLYSLQRIYNEHWKQVTGHQRVWVSNFEPLTNFLLV*LCSPLVYFF
YLLFRNCSFSVSKTPNRLVYHWYQPLMPDSLPSSMERNLFPQE*NHTALFHLH*TLMINC
LCFPSVLPRFPLCYQFVFSVFCFSMSYQ*FFQSLVWPA*IGKNTISSMTHFHQ*VSPNFA
IYF*NFYC*GYL**HLTAFFVVLSRH*ISFLKLSLYYYHLVGFCNS*LPTQ*PSNQNCSN
*ALKL*VKVGHNC*KISQEPHCDKWIISKVLAIDANFP*S*FLMNLRVNFSSFRHHSSPN
YPQKSYYL*LNYRLHSPTPICIPETRF*VASIYQVF*LMTPYISPVYHFFCIRNRYHHHR
HHHPCHLLIPHRSSSDHIAKITLHWRPNEAFLIQVNLSHVYPSVSNQQTRTAVQF*QLMC
VRE*RTEIVALDPISH*QTESKPLHTITG*E*NPDVLLNTLPFRLAIPHMLFVL*SPPRE
VNIGNPLVGSSVLFALHAVAYLQWFLCFSGKTKVSAPLVQQNPSMERFVVVSLDCPFFIA
F*K*LLFKLI*AFLGIFFTLSATAMSLLIFHIRVIFCITISHEFIVAILQCYESMKRRKK
LETN*YQTLVDN*SHNGI*LPS*DKKTTSNYCSMHKLQKKEK*VRSNETMWNMCTTGRCG
QLCLSHR*LWTT*KQSFIE*C*PSEETINSCGTNKSRFH*EKKIVTDKTRRRSLAKSTRT
*KSIITLLSTNS*RNSIFY*PHP*WVLFRDQKVC**FIWSVHG*SN*KSRPLSPSNGNI*
KYRNQKNDG*IGKQRQ*CEKWKLA*IFRSFIHFRC**RTPH*R*CCW*GQ*LPHASDYSQ
IIV*QIRSIQRK*C*KIQLRNYISKGLFASFKNT*K*GFSTF*RKNLQYDTDFRYESFAS
*NNDILSKYSRERESNFYKTLRSYGFLHNLVDY*NMPTFCPVFEANSIYIPGSSRN*YL*
VFGSC*TLFVRDEGPQKM*FITVAMSHITKVLALVCP*RWRWTRNSILSNLNGDNNIIM*
RNGH*LVLLLSSRKIFI*NKPTYEAFIRYNET*RLHFSFQKDMELCFILGQEDVFY*R*R
MSNWENLAVPFQRRSRYTHMVYTNVNPG*LDEKDKRYVER*SRKGRFELVAPTNK*FKKK
LSYFKKPVEKRKRNNASF*FRNGMDNRFILTKFAARRNDLL*I*LQYYKIL*EFPRFVGY
GHSYLREVLQLLF*Q*CLRGGFIDKVLYQ*NRGNCRKQSFGHCSGIHSQRRPLQNNSVRR
QEENDRISLRGLVCVF*RIWL*VLSLF*KNVHR*NCLQDLESLM*KRCMENYFKIFAE*I
ETRR*R**LYRLQRYEIK*HLSNNTRISGDSTKI*WV*ARYSKYMEQ*VLSHR*IQR*YD
RI*VSNAHKGNARILGYGEIFRQV*YFFILL*SRQFTIS*TY*S*YQHKHYE*TSS*NSA
KRTTTTTFSTRFAC**FNCLRV*RD*RYF*SCGFRIIFLKSEIKETYRTYTIFIPFTSSL
FHSNYLVALYIALLYSYMYIYRV*EEGKDHTFNHKNSLAFFA*A*QSLNHCLYSFKEPIF
SP**SGTGLLKL*EEASTLLLMICFRNSLFLLLNCANCWLWESLKTCEPTIGPNK*PSAP
EAIIPAEITVNGSNPNSI*VGSISIVER*AHETLQPKRAVNSEEPTLILRCCFLNLKKSD
HVKILES*RDAG*EYDLKGKVVAVERNAAAVTEG*LANSLCDDNLMALVNILKRRTMFSE
CF*HFFEHSFPYDIPLYGFPFFIDVPYKRIR*YSEKSISLNNNKYNK*INNTKYNQ*IIS
FLSDL*TLFL*SLENKWTGRVFRESDTVLQQFFKSFGKILEELVLVISVFFHNA*VLGIL
NQRIISGQHHVAALRVPLFVVRVVLFQFPVFIQQVQVKLIGKDVVSGSPWPFVSRVLQVG
LAQSVSPHKSNYFSVIHIKSLKKCSDIVSVFISVRQSPVVRGSILWRVDSTTSPWNLGTL
HFLHGSDTP*TEQITRGDPGKLFVNGLQELEAILQARIGWIVKLLFESVCTTV*PACIVV
LVPGP*SVPSKTD*YGPIAYIVVIFVIFPQLECNRIVHLLEVLV*PPFFDRGDMNERCSG
SQSSCLPPVVPSVVTTTPGRRR*SLLGLRVSKSCSSSSSSSSGEQVERPLMGGSAQ*R*K
PNSSSHNCRYTCVFASA*MRNSCS*VSERVQ*SLLKYFSLQGPFLNW*QPAWAGPWMPRE
SYYSVLRTK*LIAVVGKENYKSGPDHGLRNS*QSRIFFGFGISIGEI*LREKSSRHYVSY
IGR*SVVATRQR*MITSNWCGATTFSHRSKLVFWLSWLFLLVILNYYSSCWNTSNPPLLR
IFEVNGSL*L*G*EE**RGERKEERP*RSGSLSIR*CLFVLRR*SKILLSHLIKPINRSV
IAPFPLCLLPLPIITLPNLFLMYLKRPDGTKIHTMDSYTIYIHGCMMCLYFCLIFCSLFS
SEKLRYVVHITFPKLGCQPSLCVPLMQISSSTRLW*CRKPVC*RHQRESPDPECLVLLLL
SRVLRKDLSLSLVTQWAVFPCLEFRTT*SQWMRILRFTLRT*RTTRKSSRAAPRTHRLHQ
*TLRKGFLPSPCLDCPTT*VMLKSRKSRMMKR*SCPLHSEHRNQKWWSS*LMVLILNMQR
KSTIRKLSRVFLITCIRRAV*VFSPRVVLMTVLRYYPSRQVLPLWLWAQ*PLILP*KLLL
YPVVCIISTEINSDLELF*NTANL*WWMGNMAKCIRTPHVRPFPNY*KRSPILCFLLPKM
LQITIL*WSFRLPEDYINR*KSGYLCLPL*KSTEGYFSVIPSLKMIQELFT*KNWYMTTT
GN*IQWV*KTIR*CN*KLPN*KH*GAL*L*SFD*LNFLSLLYYRYRVLFSSLQFSLFVAY
TQKRRPKRV*RNHWLKLRVPICWPHGNLSWR*YWHQFYTLLTRSC*LFWQENNTIVASGF
LPITHSYNLSIFMRYWFSPRIPL*RPVKSVLTFSNL*DHFLFLLFTPVRRSKKSKQQERI
*V*S*LLFVTI*DLWFSLITIN*RLRYSLRETVMMSLLMQSLL*VV*VYNLEAALLLYIL
LAR*LLTPYQE*IQEAR*PIFQFFLMQSKVNGKVKVKLVRMRMNLMRKILP*YKPHEVLI
*IRKTVATQIYLRRLLRW*DRKENTKRKNDQKIEK*KKKHLTMFVNNII*K*LLNKNIKD
NIST*ENNVYLNNDTNNNKNHEKKKLTCPLIFADRYFVF*NSI*LNLDLRLRVSSQDIRH
KPDITIQLHHFK*PFQNTTQYIGIPERFHSVHG*LHKVSQWVFIQNQ*KSILVMRPVRYV
GCDV*KYFECTLT*YFACLH*ILTAWQCRSSQEILNKSTPNIISHAIQMIIHFVKVPFII
LAQLCHYGPIC*RK*FCINFFCFIFPDLFSHGLQRPRLRGRNHF*PSFGYQ*TLEALLCI
PISIAMGNHSYDHLLCYYYIKFNVGQTG*HVTLSGWPYLWLGVSQVFKFLAPAVKVHRIA
LIYLFISKMYNPRSLSPTYLLATVEITTTATVKISFSIFVIGFSTFLYTIRQT*IILYVF
LFLEMPLCT*HYKLW*KKALIINCERTHNEICFTM*IIANKLATKVEYA*VKKMIYIYNL
LMCFCKVVGFI*NCSDIPSQLKKARIE**IN*ENFKRMVRDLVTLPSSLPLITAGFATDQ
VHLLIGTGSTDSVSVCKNRIHSILNAGGNPIVVNPSSPSHTKQLQLEFGKFAKFEIVERE
FRLSDLTTLGRVLVCKVVDRVFVDLPITQSRLCEEIFWQCQKLRIPINTFHKPEFSTFNM
IPTWVDPKGSGLQISVTTNGNGYILANRIKRDIISHLPPNISEVVINMGYLKDRIINEDH
KALLEEKYYQTDMSLPGFGYGLDEDGWESHKFNKLIREFEMTSREQRLKRTRWLSQIMEY
YPMNKLSDIKLEDFETSSSPNKKTKQETVTEGVVPPTDENIENGTKQLQLSEVKKEEGPK
KLGKISLVGSGPGSVSMLTIGALQEIKSADIILADKLVPQAILDLIPPKTETFIAKKFPG
NAERAQQELLAKGLESLDNGLKVVRLKQGDPYIFGRGGEEFNFFKDHGYIPVVLPGISSS
LACTVLAQIPATQRDIADQVLICTGTGRKGALPIIPEFVESRTTVFLMALHRANVLITGL
LKHGWDGDVPAAIVERGSCPDQRVTRTLLKWVPEVVEEIGSRPPGVLVVGKAVNALVEKD
LINFDESRKFVIDEGFREFEVDVDSLFKLY*YVYKDKISFKR*R*SFKVNRVCIMF*IHQ
HWILSKKDVSEARKGPSTKSSKYWQAKRAARMIGKRFFQTTSKKIAFAFDIDGVLFRGKK
PIAGASDALKLLNRNKIPYILLTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSL
VNKYSRILAVGTPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPD
LTTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPIYFSNQDLLW
ANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKLTYDFAHHVLIDWEKRLSGK
IGQSVKQKLPLLGTKPSTSPFHAVFMVGDNPASDIIGAQNYGWNSCLVKTGVYNEGDDLK
ECKPTLIVNDVFDAVTKTLEKYA*KTTMEYLFLPLSCTVMIDLLIA*TLLQNICNIHNGL
NNGLGNW*SRYNEYLFSSI*KNKNYQLFLVKLVTYQSQSINASKKIHLHQSRPIDVIY*N
ECAGFTSHLKCCPN**VDQA*KQEDPSRDNHYI*RHPLENKNHSRQLSSHR**NQSRSTR
LL*I*QLYLVEILYRLFHFLPVLSYHRCNLYKPSSS*FWIYRM*S**SLTYQNHPRRLIL
LLQWNHRWYPLDQNIGLWKSH*RNHHHRYPQSGRLRLGRLLVQWSF*N*VV*SCLFP*L*
VAYCDLLF*MRVN*RLKN*LF*KLVAYYHSVA*YCSFSFFSVV*KQFGLV*RNPF*SSNN
LVR*LFQTH*LMHLLYKYHLNQLVSRLVSMSQLRQKLTFSET*YQSGLLASNSVLFHILR
FPKLWTHHLVY*LKTGPRT*LSLMQLEP*CSLLALAL*SPPDVLKVNQFCIVTSIPSLTV
YMLRSNVMKDFCLEYLFNMS*N*MITNHFFFLFFFSRSF*IVSDLFRYRDMSKKEK*ETN
RYLPRK**MYLMNY*IIKISNK*RFI*RALCTLVWHYIPTASKKGKKFVTFCKYAA*ICL
MSIFPEITKHK*VECV*CICNS*TIY*CLSIIPGVSASSSSSSSSSSSSSSSSSSSSSSS
SSSSSSLLFSFLSSVSSSSSSSSSSSSSSSSSSLFFGYPPNFITILLTISFQSIIPPRPI
SPFISITFSDGLKTVTQDISSFIVCSCFFVIIELKVLLTIEGAKRMG*LGFQALMTLVRR
LSHRPKAIFDNVFAVNGATTSISAQRRSSI*STGSVRCFHASHSSWSVHS*ICGGNSTT*
AMLHCPGVGVTGVAGVDSYCDILFSFSEDLIIFLVYLCSKNCVAD*VRIT*MLILSRPYI
SSSFLIIGLILNTDNEPVAPNNTCNFPSS*GSLGSKFLEFSLLGMMEGMTDCFTGVSSGV
ERTLIWPETLLA*SCASSFRSVILVGALAVTLLFSLLIGVEVAMILSGFMVSTILRALSF
FLGS*SFISLTSGDPDNCVVLEVLVWFGITA*LPGMEFETGAGLLFGDLVLSESFFS*VR
LSCFCCCFRSLKVTAGTLFKPGSGVLLTTAPEVPVAFIIDFVVVVVAFDKVGLIDCLPDT
GELIIESFPFASSWSNKISFCPRENLGHSIDWLWSASCFPLVEATAVIAVCF*IFLPY*F
FPN*YFFIFYPGI*SSMTAKKARLKKDLSKCNWTALISGQVQVRDRDPRALCDFFSSNIT
SPEKHRCHFLQEKKLRASLPTSTWGELYNIRILL*LMLKAKEKIIMIIRDTSKTIMALTQ
GTCVRYDRVPRAYKLRLE*YNTLKFLDHVNHYHFLGHPTDNGETT*LLCRSLFMLDGWPS
GMHPSRTQFMKPQV*CSGKPISHVFRHLMRI*KHSLYVTRIYHRTQISSNKFPRSN*TLV
VDMGVV*WW*PLFRLY*LFI*VSPPKNSSLLAQLVERSAFKRICLSKDTEMSGVRAPYEE
FFTFLDSAFNAKEKK*K*VSINSERKGRKLELKCVDYLPQIFSCLVALFHEFN*KAENVN
NLS*L*LGRAINLKCQTTKELRYYNPSNKIFPI*KRQEHSAARLRSC**NCKGPVQ*RFE
QNSK*RFIQTIP*C*V*YFKDIHARTWFQDG*SRDQF*PR*RLDFRHRE*QKKAVRVWH*
E*NRNFAFQQRGLPKV*RKP*RKMVRCCLAYGLH**VSAMNILHIYIYICCVREYTRM*I
NIKCVCGNAEESKLSFKKQPGSYKKCLLP*CQMYSC*THNELLLLFHQNENYFDGDGDDG
DDGDGDGGGNVGYRLC**GIRG*SPLSRSPSSSRLG*TSTSWGIVPSFRS*GLQNLHLWR
KF*CM*NAGRKWKTCENQQTMGMKCLLISPKRCHCSL*KR*SHPPPRLPSIPYFSLKQIL
DFLFVSGQFGSGPAIFRFHYYLC*SNLDRTTPLHRFLCSS*WTVDWIWSSVNHSDLWTNA
SRGNDVA*RGTCCNLARPLKSNLVIEVVYVCASSIVVSMKPIFPSLHH*IHDGNSQSQAC
CSWSCYPVTLYSGTKLLYRPN*SFSVYVSICVCMNTCV*YLNAIRERAKVELNAKSKTYK
TVLTIRFHIYIYICLFLLRPGNCTFSAVIQGKTKEERKNKINVPRFFLFLAEKAQI*HFP
AGVSL*RVSSRKRKKKKDEKMNFSGRLKIEVPAEKMQQKQNTPFKFPLSRPSHASLSPAF
GFSGYGISVESCRKNPKKHKKKERGEEKKIPFYLFLPRPIRVLASGSAVVYND*CRELSS
LSFSCGKGNAI*KDTTWGSKP*IRCLSCYVCSEFLFVILLVYGLGLCILQYDFVRKLVIA
RPEQIVR*NKNEHQFESLMPTAQSNHLVLQRYLLRIIKKIRYFKVV**RM**RGNVLLVN
GHLRMCPINS*GFSCILSRRVCV*TCK*HCKMIHYPDYGVIFFPFFFYI*FHYYAN*RVY
S*DFNTLN*KVLQRKPTQKAW*RKLFHLYFTSSDGPKTF*TYQYSFIICSLLFSVTKILV
SS*NFTPLFICLSVQPLSTLFHFLYKGS*LGNAALTITTVLTRIYPNPAQDK*EMSKQWA
SGTNGAFKRQVSSFRETISKQHPIYKPAKGRYWLYVSLACPWAHRTLITRALKGLTSVIG
CSVVHWHLDEKGWRFLDMEKQLEDSEDFLEHWHDVAGGIRTAKEDSSKSFAEIKNDSQRF
MVDATNEPHYGYKRISDLYYKSDPQYSARFTVPVLWDLETQTIVNNESSEIIRILNSSAF
DEFVDDDHKKTDLVPAQLKTQIDDFNSWVYDSINNGVYKTGFAEKAEVYESEVNNVFEHL
DKVEKILSDKYSKLKAKYGEEDRQKILGEFFTVGDQLTEADIRLYTTVIRFDPVYVQHFK
CNFTSIRAGYPFIHLWVRNLYWNYDAFRYTTDFDHIKLHYTRSHTRINPLGITPLGPKPD
IRPL*QAVIK*SNVYNLPELPLFLYSIG*LTRNALKCKKRPGNYI*RNEIFS*YDIHAQL
YSFFYFVVCYSSLSVSFYKRF*QGSSF*TNQWYTQHRNNSRDSAPHRNLATLLSSRQSEP
LQCKRPPHWITNHLQLLCHRLQ*RFTAGLPVSVNFHCLLGKMVRLQYWGL*TSFPLIHRK
WRNLYQRKSLLLLTVSKRLVYYLC*KK*ETRAVLSTKNIVKYH*SLRQVCNQQLLHLHH*
CPTS*SRLPKS*LPQELRMQTPI*I*TLLHFRLKQVSLPISMEFYLKTSRLLTQPLIHRV
IPPVTS*IIITVAQIIPTNFFLIYHFNHHQGNSGLLQD**IPFPYRTGTPVS*CHPQERR
ILNLQTITSIQILLKHRC*DALHYRT*MR*FHRTLIQPITQIDRTIYLWTRTPIIIMVHF
QNRPIII**NLL*FRYL*KKMMPQWHYENLSPESRSIWFS*NTLRKISLYIQNRRTLFN*
FYSIFFFSH*IV*WKQNALRLCEKVTQ*GIHGTADQNCNPTD*IWRTTRRHMRAQALE*T
NLSFKGRYP*TTPKGLSRVLALA*VMMRIVRQMYKIIWPHRPQDRNFKQIWPLIIGYWKK
IQSTKNFSLKKEDVEDQKAVLTS*LKVRALDKKITLMIKFSA*EYYQAPI*TL*RILYG*
*RSLPSQMLKKQSQELFLISIGYIINYKITTGEKRFLRLQGPTFL*RRTNLP*IIFL*YV
IMRSMIQFLISNRNISYHCN*WQ*LSTYSMTRFYVWIQIS*ILLVGMTIFLKVCK**SMT
VPSQGIKY**HLLNFEN*KSFINNQKKWNQ*QIHMLR*YP*QNLPKYI*ARPNYSLEKTT
KGFFNLKAQTTPLITMTR*FKSGYQKAKHYSLVYPLVQVHLLIKKRQLRYRHAMTG*AYP
RSNGNSYSTMYYSTL*TRQ*R*IL**TNLLSVLSKFLWTKSLEQTLNYF*NFPN*MNPF*
KNSKVHRGKTF*S*SYYLMKM*DFANHLNPS*IKD*SLVKF*AS*KWI*TRRKTFLTNYL
RETTTVTMKTLRYARQRMNTALY*KDITVLSRAGRKLWKIS*MNGKNLRREKPPRLIVV*
NQ*EI*TWMKRNTIYNYGKTLYQMST*ANEYVHNNVIKEDNLLLKKQQYKKLR*IILIFL
VFLKFDFQILYAFNVINIFFFFLFFNKCLIQQWKNTLLFTNFLIINDHTVESKTKFSRHH
INIIV*LGQFGISLGKVC*DQLPSIHFVRNTDCFINSAVFFLHGILQ*LIF*CSFVN**I
*IIAYFEGKFLDVRSCIA*I*NLECIMLIVFVHSEGN*VRICPVTMYSSASLKIFYR*IL
IHLSDQVNIPI*RISIQFQFSV*FLIAIFFQYFIELCQRNRLCLHSYKRIIDEMLTTYVF
DSL*NLFIF*N*PFINKFVILPWSNHIYITRFIILVIFVPFI*HADYSQMVVCMQVTQIY
HFQILKY*LDC*LRKHPVYGT*SIFTSI*HNVSIYGISIGVSKRNFNKCGDNVSIFRRQC
TTGS*GDNFNVFLLFC*IVKVIHV*LIIDNCIDIS*GKF*WFYMFFENFLPREIRHFTVD
VAFHRFFVHPKWFESYCLVL*KNMNVILLYYCIQRLFLGFTHRCTSAEWCIESVVEVLGK
HTICFW*IVIIYL*CL*FQCGQCRTEK*YRVWRNFIVGYHMIYFTIIVFLKYVNERE*II
INGNLITKKIIHHAKLSTIIILEFFYESVQI*VIWDIQDQYFGKMTFILQYLFRSYNNTV
IQSNCLALG*LCK*GTLRNT*FNSFLHFKFTPHWTE*NLVIRRNFHFGV*VRQLYIQVRI
TRRIVPIGGCMFGEHFCYYGT*YTFLKTIEDA*PVFPPIFQNIKGFNSYYLIFIYFLVFH
NVIVQVYSESKDEVSPSGNYVIQNVIAVMQNKITFPLISNSQNHSR*STYI*PV*FTSKE
NILQFGYPDLIFSQTPLGSFTNFTEEILFPMCRLD*QQWVLCIRCRMGDGYKCEHR*KPS
RTLFFAGGRSISLLLFRSLSV*FIPPDQMGKCR*EGFQV*MTI**YIRQFELCLRKIISL
PLYILSGILEREKEAKNNHLDRIIKRWYELPKKGPRQGLGC*LCLPFTSVIDYAMPKNFF
HCG*VF*NTEQLLCRNATSSFEISVGDINATRNTATPLQWPSKHSVTAILIC*VGCSFFY
SMTMISVGTVTSYFKYAFEKK*PN*GCSILFMQAVTSIN*YFMALFATPRYPKRPYFFAK
NPKTIYSFPSPSPDKK*KPCDSFWRSQPESTQALIFPMNW*IDFYNVVKTNITVFTIMIY
*LSRKGKKATTQSI*VPCNQLLLGLRYNTSLSIQVYSIAKHSKINSYQHNPSI*IYREMS
KPGRTILASKVAETFNTEIINNVEEYKKTHNGQGPLLVGFLANNDPAAKMYATWTQKTSE
SMGFRYDLRVIEDKDFLEEAIIQANGDDSVNGIMVYFPVFGNAQDQYLQQVVCKEKDVEG
LNHVYYQNLYHNVRYLDKENRLKSILPCTPLAIVKILEFLKIYNNLLPEGNRLYGKKCIV
INRSEIVGRPLAALLANDGATVYSVDVNNIQKFTRGESLKLNKHHVEDLGEYSEDLLKKC
SLDSDVVITGVPSENYKFPTEYIKEGAVCINFACTKNFSDDVKEKASLYVPMTGKVTIAM
LLRNMLRLVRNVELSKEK*NICGCSNKHR*NRIHKNKGKKERSFVMYLLHTYRILLS*II
I*YTKFMGLISSVF*QRAQYQWH*RTLLRILVHHPNTTLHLRSLHLPLHHLLQFLGRIWI
SNPSSFLFVVYPNLVCPYGFYPIYHP*YLILHSSLSSFLIVLASCELQ*PYLDLEYEFCR
F*NLDVAQSPPIQYVVISYHLGRFYNFLICKHGIERSAMAHHLGSHLEWSWK*HVVIPQH
PVNQ*IRL*RNLKTKI*FACIRDVYQMQHLGM*T*ASTLQ*MLIS*NQITT*NYLQPLVQ
SYHIFCSQMYV*RSCCFYAFWNLSSAPSMNSHSFH*RTLVATCLRKDEYHSYD*TSSYLA
SSRHSNLP*YRADSCYSFALE*IALA*HSLPT*LPSLPKLSWLLHSWVLRF*SFFLPVFS
CAFGYDNFNTTHRYTKSLSNNALHYKKIRSLAHRKKMKNFQIV*NDIFEDLGIKIAE*TK
TYTI*E*GLEELEHTVTSNSSEVH*DSHMSEKKVHLRLRKELSVPIAVVENESLAQLSYE
EESQASLMDISMEQQQLRLHSHFDNSKVFTENNRYIVKTLQTDYSSGFSNDDELNGYIDM
QIGYGLVNDHKKVYIWNIHSTQKDTPYITVPFRSDDNDEIAVAPRCILTFPATMDESPLA
LNPNDQDETGGLIIIKGSKAIYYEDINSINNLNFKLSEKFSHELELPINSSGGEKCDLML
NCEPAGIVLSTNMGRIFFITIRNSMGKPQLKLGKLLNKPFKLGIWSKIFNTNSSVVSLRN
GPILGKGTRLVYITTNKGIFQTWQLSATNSHPTKLIDVNIYEAILESLQDLYPFAHGTLK
IWDSHPLQDESSQLFLSSIYDSSCNETYYILSTIIFDSSSNSFTIFSTYRLNTFMESITD
TKFKPKIFIPQMENANDTNEVTSILVMFPNAVVITQVNSKLDSSYSMRRKWEDIVSLRND
IDIIGSGYDSKSLYVLTKQMGVLQFFVKENEETNSKPEVGFVKSHVDQAVYFSKINANPI
DFNLPPEISLDQESIEHDLKLTSEEIFHSNGKYIPPMLNTLGQHLSVRKEFFQNFLTFVA
KNFNYKISPELKLDLIEKFEILNCCIKFNSIIRQSDVLNDIWEKTLSNYNLTQNEHLTTK
TVVINSPDVFPVIFKQFLNHVVFVLFPSQNQNFKLNVTNLINLCFYDGILEEGEKTIRYE
LLELDPMEVDTSKLPWFINFDYLNCINQCFFDFTFACEEEGSLDSYKEGLLKIVKILYYQ
FNQFKIWINTQPVKSVNANDNFININNLYDDNHLDWNHVLCKVNLKEQCIQIAEFYKDLS
GLVQTLQTLDQNDSTTVSLYETFFNEFPKEFSFTLFEYLIKHKKLNDLIFRFPQQHDVLI
QFFQESAPKYGHVAWIQQILDGSYADAMNTLKNITVDDSKKGESLSECELHLNVAKLSSL
LVEKDNLDINTLRKIQYNLDTIDAEKNISNKLKKGEVQICKRFKNGSIREVFNILVEELK
STTVVNLSDLVELYSMLDDEESLFIPLRLLSVDGNLLNFEVKKFLNALVWRRIVLLNASN
EGDKLLQHIVKRVFDEELPKNNDFPLPSVDLLCDKSLLTPEYISETYGRFPIDQNAIREE
IYEEISQVETLNSDNSLEIKLHSTIGSVAKEKNYTINYETNTVEY*YL*YNFTYI**TLL
GNDNNKYVYAIIATAFFRFI*DPFLSVHSLPSTLILTIVSGKGTRSSSSSLSSSFLSFSC
ASRPVSFDCSDSFFLESFHGPIS*SPSAYCNNPKLACDILFIIESQLFINWATESAFIPI
SLICSFNSVS*IFKPSVKLVIFCND*SSFRFIAICSSIESIITV*IMSFSNLFNSFLDIF
RGRYSFVLSPSNLL*VLSYFYFRVTLNSNIKKGSLLMCRN*KNYIQKRIKFLSSIFTLLL
SYFGYFTCRNGSTVLSKNNSSQTVIFMGS**RNPPLYFN*FYFYKCSLFRA*MSNLFLAC
SIALVYK*NQSFDSSRLLLDSDEKNKRCSWQQRSVHVKGGQFQNKTLC*MNGRIIN*CCQ
ITILNIFWIGFAQFQSDKITLNGNICLFVIR*LALLRTNLNFIHNTTLFRRIYCQRFTRL
NRT*FQFS*N*C*IVTCFFRWDDLQHRKQKRIIFVNSFILL*NLERRIFQSRH*VRTIVP
LSHFICIFNFINTFSGKATDRYPINIILKKPNINQIWQQFRFNLFKPLLGPVNIIHLIHS
NNQIVNSKTRCQ*HMLLCLPIQVKS*FESIGATVYTKYSHICL*YPHYSVWNKISMAWRI
HNSKICPMGREMRCTN*HCYTTFALFICLIHNPCKFEG*LTHSFTLSL*LSQLGLVDNVQ
IIK*SAH*S*FSRINMTKNNKT*VR*GRFNKCRNIMRFLWFRWHRSLIVSLNCLFIIGFL
TIAFTLTFFLVKPVWKPIIWPLLRN*DVCQFLSNIRTPISSSNWLLWCLLLLQSFLQFRQ
RAFQIEIVVKQS*LK*KIIPALVIL*LRL*SRKYLVH*IIFIVIQIIIKFTFVVKVRHVV
CSIAVVTVSHLDSQ*LSKQKPLGVSKLYLTLFKLLIG*LSCGIFKSH*WASPCIVINI*I
RSTYRVVFTRLLLYLYSIHAWYHRSFLRLRSSLAIRLFSFQRDWISCNLLSIICTCCSLG
FETMDTNNGEMPYFAAKNLRVYF*GLSRRNFRISSIS*GPR**VLPFTVLLPTRTFGHCF
ALVL*TGMSSPLRGSLAAIKLRGMVSLLTDPVAMDSDG**YIPGASLCFKYPL*LDALLV
LL*IVVTCVLGNPNCFQADPAVWNDLQHTPLPIILVLFYFVFNFPF*LVESISFCPLFYF
LK**KR*KLKNS*DDCR**NTRRPKDNTNTSGMGHSGREERIKDIFKELTSKELTPGLLL
TLQKLAQKPNTNLEQFIASCKALTKLSSNNPIIFNELLELLKNKSEEDSTGPKKIAPSIN
KRKKFKIQLDLDDNEDELDSPVQKKPAPTRTLFKRIDKLKAKQLRQYSPTVKDPSPNSEQ
QTQNGHAETKDYEPTRSEVVEEDREWYDNDDDYGNLVPEPLSELPEEAKLLPVIRNIDND
DALRNTVQLYPIPLKQRMEWIPPFLSKFALENKVPTSIIIGSISETSSQVSALSMVNPFR
NPDSEFSANAKRGSKLVALRRINMEHIQQSRDNTTVLNTAMGEVLGLENNNKAKDKSNQK
ICDDTALFTPSKDDIKHTKEQLPVFRCRSQLLSLIRENQVVVIIGETGSGKTTQLAQYLY
EEGYANDRGKSIVVTQPRRVAAISVAKRVAMEMQVPLGKEVGYSIRFEDVTDSECTKLKF
VTDGILLRETLLDDTLDKYSCVIIDEAHERSLNTDILLGFFKILLARRRDLKLIITSATM
NAKKFSAFFGNAPQFTIPGRTFPVQTIYTSNPVQDYVEAAVSQAVKIHLANDCSSGDILI
FMTGQEDIETTFDTLQEKFLQVYSKKFGTANFEEINDIEILPIYSALPADLQFKIFQDLH
GTKRKIIIATNIAETSLTIKGIRYVIDCGYSKLKVYNPKIGLDSLVITPISKANADQRSG
RAGRTAPGTAYRLYTEDTFKEDMYLQTIPEIQRTNLSNTLLLLKSLDVTDELSKFPFIDK
PPLQTFLSSLYELWFIGAIDTSGQLTPLGLQMAKFPLQPSLSKILLIAVRNGCSDEMLTI
VSMLSVPQVFYRPKERQKEADIARNKFFIAKSDHLTLLNVFEQWRANNFSSHWCNKHFVQ
YKSLVRARDIRDQLLTILKSQKIPVISSGKDWDIIKKCICSGFAHQAAKITGLRNYVHLK
TGVSVQLHPTSALHGLGDLPPYVVYHELLMTSKEYICCVTSVDPFWLMEYGGLLYDIKRI
KNDQEATTTGLFGEHYEHTLDKVEDDIDINIRRCKDMRDSVIQELKMTDNSNKEDKKQKT
KKQNILNGKENSMKPFKRRKPFF*FMGRAC**AKYSYMLLYSYMHA*NKGLFIGYKRKEH
NSWSAYIEKKLL**LPILLQSDCS*ISLAFGNHFDIFSILRVLAGCVLRNSIFTTPPLFI
CFSKFAILSHTFIDSCG*KHALDIIIRPM*SASVSICLDAGIRKNPSNSILLIA*APVTV
YNTKPKREYIGAFDKFSAVCLAS**ANSCAKTVAIPSSLAQIGKIELNIKTLPPGKTNAF
GEAVGSLTT*ISHLIPSSSELSTLGSL*AASTIFMKIFSILMDSGCCGGNISCCVCLQID
LYV*FPIVNSNGRDTQMNLDLSLTGALSKCV**KREHPPNNKAKYFLDDLSRRMLLNDDF
WEYSPLLNRRYEGPLS*R*HRVN*TRNDTGFKNPPLVPFPNPLNLMMLRNISCILSFHTL
T*IG*CRFEKLLFVF*VLYIGRRKK*K**FGLPI*NQLI*TYINVYGGLDLKRQFR*LIS
GHLTVAVL*F*ISLLSLEV*EPCCKT*D**CDNNAYQVKYPRSCRFRFCETLYTRTYK*I
DEQLWCGYYVGNGKVAYRDTVNTSYGTISQRIWEGT*SQ*S*NPIAIVFL*N*SQCFKSS
IQMHKLFCS*MQDRLEHNERGNGTCYRSQS*RNPSLKTDTIDQPSSGG**GVANHRRKCD
KEYQNH*YKMC*HLFSQIVRSNNNFM*NRIMEDEQQYTHYH*HYAEEDNDNLLP*A**IK
IKL*FLNILPDIMHQSLSRGHIINV*KIIIINIYFVIE*QSSISTNPLSIITIWHDIVVK
VFEIAIKFIILPLAHIGISCFVRLTHLCNQYLSSTIIIFSNMLKVLF**SGFFS*CSSRE
NNDFDFRFENDMNEKGHSNKYIDEKEYLEDI*ASPCFLIE*NWWCFCAALKKKASIETVS
SL*LEKGVFHQCYDA*NCPLNHYESLRLNRSYLSVSM*DGLLYPNLCIICCYC*PIFCSY
ASSIYSFGQNAISCLPWQVFQCWQNVG*VHGFPGHRSWHP*ETLAGPYLFFSAELAVGVH
*FCWIASTSLMWEKQLKMKRIWLVALKLK*YLISFFGDAD*EKRT*WNTAV*TRKVTAHM
CLHSHVTIAKSLSILILISCHLKHWKYDCHPWLES*LAMLNFLGFWTHLTFALEL*LIQ*
LNQQIGRGFLKRR*QSSYL*YKKSPYPEQIPGHSDFE*WKPWAT*LLHHW*FPLIKILLL
GLTTAPLF*KAYTCRAK**CHQNIVEIIPISVL*ARFWQFPSHFQFLEYE*LHWP*NCIY
LISFALILH*IRPQFPRQHRIVIVSKREIREYSPGMR*YGLH*TFQKDEKWASHCPQNHR
QI*PNYYQSMVSFLPFLDLFRKVGSRGKFPVVNMMHIRRTKSGRLVQSNYSASAVVQIKM
PAKRLYSKFYPFYCKLP*MSNLPKILSLYLPDACYQTTYRF*RT*IFLLTNSRFHFSVYR
L*KC*ILYPKYDLVKPEFLLCDGQIICLLQLHQHCYH*SLWVINPIQIEYQGHRCGKDQK
FHPH*ELKRYDQYFFSFVAVYPKGNYHQDQTPLKILALT*TPSYTRQLNIWCLHGSAYIG
LHSPYFPGFVPNSS**CTTIERNSYSSAPHAF*MLNLLLACNHTRDFPISASILFSQ*GH
PIWRPQNTILQMTSHVAFVNRLCQ*ECLFHSFPQKRCKEMICIYWLKMTLAFHLRLRLSQ
PSRYHYFHFLLLSLGHRQVYPRFQYPG*NLLCS*FCSCQFAVFYQHPPPPFQHLNYPYWA
**TCSSDLK*ELCSGKCPGSVRNIFRLVVA*QGGAYFV*M*DLIFCCSFRLLLHIPVLPS
IIITALIFLIKYLNTGLFYEYNNDIMTI*INHTL*LWFSVS*SQLSYKRGNMSALVYPTF
FKPLKIFFPFF*YLTY*YW*VNLMTF*SA*PYFFRNFQFASFFNSMNNRKHEKISK****
KSWSVANLRGSLKIYFCCVEYLIYTARIGYYSRIFFKLLQSL**IT*GEKQE*I*QKKRS
SQCITQSTGPPSLK*IRRSATKLL*KEQGLTLSRVIRSVVRGMLPLEVYKLP*SRRQ*PV
KEMYLPPHLFRSR*RVRIRRLQRVLIHL*RASLTFIRLPYWRIARGGV*LLQRIAILRLR
DPVTYLVLFPGPASVLRKRIPSVLNAT*TVRRNNMLPLGIHVNHLLTRNSKPQITSPSTS
NKKMLVILKGNKI*ALLKEVS*C*LKMTLQAL*IL*TKPITEVCSTKNSEKNSKKRKVQS
NMKVKDSRRMRMILKA*ILNQILNYR*ILKMNHFKMIFQKQNKRKRIQNLKFRKLMLRGK
VIHHL*P*TH*TLKYILMITFLAWNLQRNRNHLVCHHRQQKLKI*VLMG*MRNVFQ*LLQ
KTWKHHTLLRTSKSNN*LLN*TMFPYLEMQSSI*TAIASTQWTERLLDSKSQAHIYLGIP
AWIYP*RSKHQLCKTAIRTYPDKLFW*IKAMSMKTRHLNLQLMVAHPFFTSLNSRT*NTP
IMKGWVRKKLSERNFPQLKHYNCSISAT*QI*EKKLIIPNLMTLMYYLTAALRDTALMQI
IKKRSPLSLNIRLGRDLAEHAAWKSQGKECFPKRKTNCRVNGIVNVLNALNVVSNSINMF
PVIF*AMNHIVKSTITRRITVFVRFVQIS*RVNVWKMIRWNDSTWIV*TVSYARLPLLMI
IIYSMGKFHCAVITTWKLS*RKVSTMLHQAMIRTILSLKGERGSSTSTSITTHLSFLAHM
FHNILNKILIFYIISQPCSFINCIAQEKGICLSMVSTTLVVIS*LVIKTSFTHIHYVVFF
STTTSNCFFTRHLIVANFYFWTFSYRCIKG*KLKREQEPKNRE*GNLFKERLSNEMFRYF
IVFSRGWKKNLSTNG*IIDEYNVS*DT*LGNGK*DSQIESLNDKRIDLSQPGY*I*QPSG
DAGKEIFQNFNK*SARFSYICPFARWQ*GSHISIQRTISFSRTNNTYNTQV*ECRNVSIP
HAPIGFSHSGYRGRE*RFRTGVFTHAKIKTQLRNG*AIKGT*ASSFDSSTSDGKDTKGLL
***ICR*A*ALSLVR*IQKVSEFSGRFIRSCSVLEGNFVQTCQKQ*GRQR*RFAVTLVIS
*KNAKYTGEFFTRSCCYRYIIEDVLIGLN**FGFRIYTWLWLLLGL*FLLFISLIFSI*L
RRKKKKIFTSRSQKHKKKNN*KKLLLNA*LFSDAITYIPGYLFFLFSKENNTKYYCYHFC
YYYYCLYYYYFSIVAIITICLLYNLKGDYSRQRVLFYVSYSFNLGICMNHFLM*WIHLCK
NLSSFYFCSS*NLYLLLYLIFHLPFHPMFQPRLCRCCLSTPKLRN*SSIYLLWKNAFFGP
L*SRRFQQECSIYWRLMNWKQMELIR*MRQAFLRPWIRLQLLLLFPIQS*NQSLSRNPNR
RNQKM*IRRNLNQTSLKNRTSLKSLSPSLSRNPNLNPRKSC*SWS*SRSQMKSRWSWSRS
QTKSR*SWS*NLIENLIQNLIRNQKNYLS*NLSQNQIPNLILILKMTMTR*SLTPMRKSF
LVQF*PF*SP*HLRCLILLLFSWFHLLIRIPKKIRQN*S*RKKKIHWS*SRIH*KIQSHW
NLSLS*KKKMMMS*IQSHCCHCCHCCCCCCCCCCCLKIRR*NWTRKMKKKRRRRRRRRRK
KKKKISLQSPSP*HLILALRQL*FSWKPLLCILSVLRLGFLSCFV*KCDEFNHQVNFFFS
ACIEKKKIVCSSDGKVFSSSRSKLPRTNSTFSRPVVKKWVRELNCNKLRIIVLIQT*RDV
QTTKQE*NNSNEGYTFCNKTNSL*LPYWSEKTRLCRPPLAIKNINDCNTRTPQGEGQR*I
NQSEEDDVESTRYP**GEE*EKSVSNVNLCV**KYLHTKIIILLGKTK*HLCPVFVIYFF
LCQMSFWSPTHPLHPCHNLLSVTNLDDLHQRHIFESVETNYVNKQKVNIL*MWLQNHRIL
VWEKILIGPERTFLIQT*EVAVTALVYYMRTAAKSPRKRHKTTWDKLGVTQSVLFIFFPG
KAKSFLAR*DNGAEGSGELTYLRRLRRTAPKNPAIT*HQWANGVRRTVTQSAVCVKTEKW
AASPLSTLPSHG*ILRRFLWWKWHQKCHWLANPDYFVSKKHAYLHNKKKRPALLTSCSGS
SKNRKKDNRPFHFTFAGLSSI*WRLHKRWRLEKSWVSYLYGDHSPHMIAV*SDLLFDWPY
FLHLSSFLLLSPITTTHIILHFILLFCTIFRFVKYISDVHIFYILSVCVYFRVGLLRIIP
TLFLLAYLKKKVYHSAAPLQTI*NIINYFFFSSFELDH**TLIMLNHPSQGSDDAQDEKQ
GDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLSPSPEDEDFEGPTEEEMQTLRHVGGK
IPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGATGLSYFFQFWC
YVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAIGGFIAAIILI
GIATGMIKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLS
LMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAKSFKVCWILTK
NKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQAS
MMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTW
AAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPA
SMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYND
TEEEMNAMDYEEEDEFDLNPISAPKANDIEILEPMESLRSTTKY*CV*LTYCLFFFFFFN
HITLTGVFCAAVICFTELSPLPLLSNR*NGISLCIITIV*YSVNLNFKLIYLNTTTWKQL
VLFRLTVSVYSYFAYLHTIISNDLLLYLDIYCIIEQFVKRGPY*DFLPFTNRIEKEIYM*
*KNRDVYKLWICGDRNKSIISTSSLDAIGWCDHTFSFYSW*LLVVIWRNIYDKQICHSCI
WKPRLSKMVQ*YHLLISRPNVKWIPFGCCSQIEFYRLPIAYQQRSIFVGQVGYLPCLGSW
T*HCQWCQKIQLPK*WSYQSKS*RSCTKLE*VHLWSKHRRACVHHKERNFTLVKNIFYAT
K*I*LCYAK*DGTNKPFSTYATFSICSTDLM*TQKLAAGNSFSQLLLV**IVSLSIIFHL
CLSFMAFLLSYNPHIISNIVFCIRRNIHLHFEPLVALPLAEREKVIYKVALICVFEIMSC
IPIMPGIDG*WLV*GGSYGGLSAISYCGTSESEKHEKKKKVQQKWKDCTQTTTQIY*RHG
WK*YLKRIVER*YGLR*EERRLSSSTYRTQMNANR**ITKSTSL*KVRNNMS*ISLLPYC
SGA*RQIALPIIEEHNLTR*YLKQ*IQVSLCKNLKISLSI*TEPAFFISLHISQKAFLLS
RKN*GMGQPSIDSIWNNKIYFLLTLYQGEYY*QK**LKSSL*YDDRRAG*RALPIFVSFH
SS*HDNKSIWEKKTGRQIEYRQRYQ*KWSIESYGAGEIRSIYNIY**IYCCLSIFPSLVL
TRT*LILAEATQIVSNATF*DNVGS*YSNGKHTKW*KFRRKIERHCVFFRLLFRAG*II*
R*CGKTP*R*TFTV**T*IGESKGYRLIR*IEG*FFKEN*WFEDRNGKRYKRK**NPKRE
E*YFC*VRICRK*KDEIIK*ARVCEKEAR*FN*GEKGNPE*STANPENTG*KTKRNRIGQ
G*E*SLQ**M*ETTLYNNGFRNKTTGLYY**PEF*N*TGKKNTRIDFIAVK**LARKGAT
FKK*TVSLLQTKNRQSNSRYQE*IKSFKE*FSNGKNE**CFEAKK*RIVKIFTRKTTGNQ
GSIRLPKFRKARIFCRNVPKATFSGPFRITIERCKRRIEQYKRVEHCKGNSR*FKKTNSR
K*RLT*GIAVNERKISTMRKRMSTFILYN*RSR*R**KFICKI*F*FYIPEETIN*RKAY
QGTSSKSN*NIHRRVGT*SAHYKLFQRKN*HVGKRIE*RCIVTRAYIEREECKG*GIKCQ
KPKASGM*K*SSNFN*TTSRSMPSNTIPFNYQFCF**LEGTLT*GRNSIYSKHYAGRR*Y
YHRI*LSKSRN*KTS*IQKHYSITRKKCRTFESSKKLSR*VGIERKEI*TKSSENRK*NS
K*G*RGYNNFKE*KNGSRIKN*GTTERA*RIENFCSQRRCVIQQCNYKTVNRN*ERPRIS
STRLANSYLANY*GVY*KYVTFKQGDTGPV*QQERHIH*AWKGKIIENIGRGTI*TTFEY
VRSN*S*ERPTAQKV*LFTEYYFKTRFQNTRDT**IRFL*I*VKHC*NRIIEPERRTEIK
SSFRKELETRTE*TLP*KGQFTHHGNSITNFTKGA*RSIGRD*EIMSKENR*T*RCSQRT
*KGNFSKRPSYQTAGRRQQFKYRMVPK*NRSFEERL*ISNNFCR**AN*H*EITI*SQIT
RKGNRGGQDSFTYL*CYG*NN*R*FPTQGVGKIQD*LN*CLFTNQRIQGSLRDYLSVFAA
NEF*IG*IFQGLY*PD*KPN**KN*FGG*DFASKRANV*FE**ARFAEKRDGKRKS*L*E
KDINFTEQ**RSRSC*VRI*IEVIKNPKRP*STNYIC*YCAKQL*TRTTETCRCF*DD**
IKRAITYVQRSS*DPELIA*STGECSERKRKELVLPEGIFIRTARFIEFSY*GFILPK*T
IV*SNTNLHSCGQRSQ*FDKRTWFE*YFNYTTSRKGYS*YKSDGG*KRCKNVETKNFFDG
C*ITRCSY*AR*FKS*KGKSFFHYSTA*RHYGEIKSIKSIKRK*HNIAE*AGKQQ*QEEG
TAI*IR*IEAKCCAYRVRIDSLEIFYARKRARAQIS*RRGSSLEKALTRHIGET*TIELK
RL*EARKRDRKFEGGTRK*GASRSGSRGKI*QAEKTSAREIKNIKTLTGLID*TSK*SKG
CKERVGKFLE*GKRENRRVTKCKSSTR*QPVRSNKKITRRRRKGFKRASSQVRRKYDFLR
IYDKRLK*RDYNIKRRN*KTKANPATVTSYICK*TK*LI*HS*VYEKVF*RR*NQIHQRK
NPRS**KNTRGPRKAKSTFQYQYGGD*KKMGI*ARTGSISKDSRS*GSPQKANQITH*GE
N**DNRTKEGGIGKRV*RKG*GENKINGTIWRNRRGASKTARS*GSRETKGIGKRV*QKI
TRRTQRCTTLKSYLR**KGQITSRNRKQVEGGVQQ*TASHKEEILRRRKATSNDENYPFG
KKTCQDGISIVRNKTKCRESSEIC*QCTKSITRIT*ENRREFKFTIQSVTFR*KTLKAKF
*VFIRWI*PFYLAIPK*ALTK***QKGVVG*QDRSTNSFGTQLQHSRLKGSNIFIFHFVN
*YK**RTY*QQSCPKGFIEQKCSIGRGYRKKERGRTC*KRRGNRRADEIQQATY**GRRA
EK**RRHYRKH**VKKDQD*R*GRKRNR*GE*REQYIKEIVKTRDQYKLNLFQCGGASFC
PMSRPFVIYVQQHSCFIKFIYV*AKMKSRK*LKCRFFNTPNTESSIYGNGIMNLTVCVLN
VPNRFS*CSDLCSTHQTRKK*VFAKTPATPLVL*VKII*MVEEPRST*LKQVCQHRQLRK
LMTSKREKSLDHTL*VEAVFQWEDRTA*FTNYLNFPNIRELKIPFETERQATIATKVLSP
DPILKPQDFQVDYSSEKNVMLVQFRSIDDRVLRVGVSSIIDSIKTIVEAMDVLS*IIRTP
Y*CTYSISI*TAFMHIIT*IFKIALR*KNKERYSC*MSWGCV*INNCLL*VKQACGW*MR
PYLLPLAG*RRKF*YERVTALGVFLGL*KSC*ALGVR*ERTNKSFGKYQLRRLF*RGYRA
LVLAYFPSLLNFRFFVFFFPKFEEQLFILISFFPGAYWLNHQRLTTNKLDPELQTGEIHI
*TEGVSQSTILCQKPLFRIH*GFLKMKILVRCFCLHHSSSGHLPLHPSLGWYGIPQQI*V
YQIFKC*IRLLKGKIQTRFTMI*IAVRGE*VDLDFQISKEKIMTILTQKEQQSRNQRKIL
LPDM*VVRKGP*KGKTQLELLNPLH*FRNHLVKTAEALHMRNGARKI**NH*TFHRIR*L
SWMQGQMNSPRVKL*AVSSVNLIIVKKSTTRITVPEIRISITVATTTIITITVAITMTIT
IITTTTTTTTITATAVIITIIVMIVMKGKKMIPASQQVIRDRALL*YKNYKNCTK**LSK
KLNCRSGAHN*QTLKPPN*KACGLSIKSIQILLTIMSLLSLQLYYHPNRLTIWSSAKKLS
KYIGSKEGYGFTAR*HF*TF*RTFLTSWILKFAANLSLTSLFHYQL*FLTYRPNILSLGY
KD*ETYQEWL*HYIPRVLSIGN*VLSIGILRR*NTYTIMESYIIICLPYSKTLLKLL*IW
GKASFVRKHSLRLRNICNWLLITFIKEPL*KEIMAILETLY*LSI*NIVKPCYYPVF*KV
QIYKMSC*AISLKSSV*MQTVVTFLTQKICLFRILIFSSISSGMAPLLHNRIFYKLLDLE
SQKTHLQFYLNCRSI*RRGKTRRNVKNLQIMTPP*RKVQRAIAEMTTKMTMK**VLPLPY
LITIS*QNSSMTSIP*GVRYCLQC*QTKHGWKH*SF*I*PH*NAV**CFGSFYMGL*VSH
YPISYHGYTLSSQFV*KAAN*VIQLVKNSG*LLLRELFHGIQWLPL*MF*LCIYWITKHR
TLLLEIYAMTTIN*AFLNF*NYSMKAKNYQKFWAVGEHCGLTQFAKRIRIRLVVKIIFKK
SV*KIIWHWIRRQMELYLMKRTKMVKNSGKGHAEPYFFLESCQEVFQ*A**SETIR*YIV
HHFKILIYWEV*SSNSNPCAIYTTIYQY*VPWKVLLTYLRQEVKTTLICTLCRN*VSTRA
IISSTMLATRNFVPIIRASIKMENF*APRFTLHGMSRTATTLT*RTTSIITAKRKMKVYF
WNV*NLIIQK*ILKLHTLSLMQLLG*DIPHAYSS*LKTDC*DLPFV*PHSKS*DFYESQR
TKTSWRLPQEV**L*GSFTMRIKYYP*DSQVM*RHTSKRT*NLKNK*HGGHMSTSLSSNP
**RRKKN*RVPANRVFPLAALTT*F*YLTTTP*RKKQKKKK*KR*AHDLCFLCAQNLANS
AICVQTDRSLYVHLQQHQFYSPP*ITL*F*YILLYAYNQLTSIQF*PEHLGRAPTQGLVG
KNRNIPHDPPENIGTLTGEWRSGFPNLDTSLFFF*LTIGKNRASFHPARLCSTYH*SSGY
FKLYKGKMPARLASFRLLNIMDRRIKGPNRIVKLRRFWLDNGTFVY*VRLGWG*QHWAEY
RRPQKKGI*GQRSLCNVCNFSSMCNQYFYLLLKYTEVRQITNSLSQIYIYIFISA*TIII
FV*LKNKKKKPNSRN*LFHNKITTCPLLK*MLQ*DLLPKLNKKSDKNWLLVTKSPPSDAM
LQLPFCMKMV*KKIKLSFHQAVH*SLIPVLKPEDLQRTNVLLKNLPRKTKFGGVRSINHV
LKEHGLSTVKELQIT*EQETTFILSMHLQDGIQNTESKSALFVPGLTTLYS*QICLLDLQ
KKN*PILENLILLSGTLVSSQPIYTPRICLQRVL*KLTSKQWK*SF*VPNTPVK*KKVFS
QLCFT*CLCTITF*LCTLPPTRVFKTVTLLYSLA*VVPGKPLYPQTHIDC*SAMMNIVGP
TMVSSISKVVVTPSVLIYLPKRSLKFSTLSSLVLY*KTLSMTRSRM*STMTTLLLLKILD
VPTQLTTFQVPRFHVWRTLIQRTLSC*LVMLRVFYHQYLN*LLNKSCTISSLVTLLKWLV
LSKVSLNLNQHFHLVSDNPS*PCTLLDTQPC*LQRCLNIKLMRT*STPAGLVLPTYLVVN
VAH*STQGPFWILFMMVR*PMKRTKLYRFSIFKYLPRLTVFQLSF*ILLKTGLKVNPNTE
VQLPTWPTCLFKISRFIKTEPHQMY*PLVLNSSKRNMFVRYVQSKKKKKN*NYFDIINVR
NILFCQFFLFPFQLFFNN*NWINKHMFF*LIFQTYLCIYIRKIQKSDAINRILLHSSLHP
FFRRIRRIPHR*TFLFCRLQSCCDPCDVAVYNRHQM*PKLVYSVQFHGSFLCSQQKYSVH
**GYRNDSPFHITCIESLYRSLK*CSISKGRLLQCCFFLLNHNRTLINE*QVSEVKL*SL
NS*SWLTF*NFASLHFLLNHRCYGDDGDDGGVILTLIWNENRIWLIFSSG**FLLFWI*N
Q*FYN*DNPKHCRLTVLHRL*ISLCNPLI*FFSTYL*SYTMIVLESQVTEHRR*NSYKKN
YHSADISKCSPTALDICDQLEINHQ**HFSRTISRIWMG*LVKHSHHMTLDLDNT*QHFR
SRALHVFVLKLLVEIPVYPVDHLGCSNLALTSCTFLRIYLV*SLFLHSNTFF*TKRKSSG
KVGLLSDIC*Y*GIAYISWLKTNPEIR*CQTDIELYC*YSMYCMDFAGQ**ITLITDH*N
LQLLVDCKLSGPKILWPRSFLLPPLAFPPWIKRMKNLG*NL*FVTKPPRSARGEQLLD*T
AF*IMHPFQY*VLNTRVLIMLLCLCSTPLQNQLPIYYLMLSDYFP*LCPLSNYHLLVLLA
HSVFHVVSHQTCYVLTKRPYEQVKAVAVRSRLFFFLWSCKFRLTPLNTGQQ*QYFHLLPL
LTHNPSRVRLDSRFLALRNCCRDYFLFGIVTIVE**GTDNNNQ**MLSKLPFPD*FLNPS
GKH*TDEQHGLTILLSSLAVIANKTV*YLLHILFELGLEFDLGLITLSL*LPI*RKENGK
*DQCHGYLVY*RS*KTTSSSSNLSELIINLMITQRTI*KGFSTNSRRNVNPFFKHSGKTL
**MWGNHL*RCATEKLFFFFFFSFFFFFWSEQCDEPDEEKNKK*E*VIMLRPLEEIGSSH
RIKPQETLKQSKLTSYIYIIRNFSY*FTIKD*CTFFVFNYLLSDNPVC*FESFSATIVDL
*WGKQN*FCLKLLL*RFCSFFFIAEYILSRMSNISTKDIRKSKPKRGSGFDLLEVTESLG
YQTHRKNGRNSWSKDDDNMLRSLVNESAKELGYENGLEDVKTIQQSNHLSKCIAWDVLAT
RFKHTVRTSKDVRKRWTGSLDPNLKKGKWTQEEDEQLLKAYEEHGPHWLSISMDIPGRTE
DQCAKRYIEVLGPGSKGRLREWTLEEDLNLISKVKAYGTKWRKISSEMEFRPSLTCRNRW
RKIITMVVRGQASEVITKAIKENKNIDMTDGKLRQHPIADSDIRSDSTPNKEEQLQLSQQ
NNPSLIKQDILNVKENESSKLPRLKDNDGPILNDSKPQALPPLKEISAPPPIRMTQVGQT
HTSGSIRSKVSLPIEGLSQMNKQSPGGISDSPQTSLPPAFNPASLDEHMMNSNSISDSPK
HAYSTVKTREPNSSSTQWKFTLKDGQGLSISNGTIDSTKLVKELVDQAKKYSLKISIHQH
IHNHYVTSTDHPVSSNTGLSNIGNINGNPLLMDSFPHMGRQLGNGLPGLNSNSDTFNPEY
RTSLDNMDSDFLSRTPNYNAFSLEATSHNPADNANELGSQSNRETNSPSVFYPQANTLIP
TNSTATNNEIIQGNVSANSMSPNFNGTNGKAPSSTASYTTSGSEMPPDVGPNRIAHFNYL
PPTIRPHLGSSDATRGADLNKLLNPSPNSVRSNGSKTKKKEKRKSESSQHHSSSSVTTNK
FNHIDQSEISRTTSRSDTPLRDEDGLDFWETLRSLATTNPNPPVEKSAENDGAKPQVVHQ
GIGSHTEDSSLGSHSGGYDFFNELLDKKADTLHNEAKKTSEHDMTSGGSTDNGSVLPLNP
S*EGKAEKKHKSFNCLTY*FCNKHKCILYIAQDG*YSLKKTCSFMTRIFFFFSFMLINIL
EFCI*AV*KVVLFHIRRFCIIKNFALYTILLGYSSKISLLIFSLYKSL*QHNFLEILREY
ISFRPQTQRAFSKLCGDV*KRKQAKRK*KMRL*TLRIMS*LIF*NPSSMKSSVCIVYV*C
LK*I**NCSSFFLLFLTII*CLVYQQYYLGLRLSMNSLLLCE*LVNSFSY*SSSAISPIL
PTS*LFCNLYKSLSLSVIADLLSFTEWSASIPSLSLSKVFGNCD*AALLGVANTSSRASR
LFTDVIEEFLVWKDAFEMLPFKNEDEALLG*YEPKS*FCKFLIRFSLLDWRVLCLSSIIE
ALFWSLLVLVSLEGSAKKFGPSSEITGTI*S*TLICLFVICRWEDDKETLELLFILGKST
TDFCLALLP*LLFRT*SKFIFLRYAGT*YLLFFFPNGFS*SRDFPSFSSG*ADPSDEPEV
*SGFFSSELASAASSLLSLKGPKLSKDTKPLSS*IALSNSLSSCSSLLYLFCRLNQKHTA
IIIPTPTGIPTAQPTATDVLAVISFTSYYDELPKKKYIPDK*HKTKKPDLGEE*NKDSKF
CLILNNSVQKLPHSIKYPT*RYSF*LSRAGKR*LILSHNNKSMLSVEKEQIASESASRI*
RGLQRMVGKEFLTRNLKRMVDSLLPIF*KSLTLISRISTFSMVY*YRPRKVCRENLGTCD
PECILSNIRMRTIMSIITRRYKQLKNYKIISKKMLQINSRLAVIDGWLVDTVKRKPINFR
SPEVRLLLPNDDDYKKLSQQNLVDWTRLKKDSNSVLVGVKSMELFKHIKLVLREFFLLED
GRIILKRIRSKLRYKVVKKLTCKCCRLYLPKWGTVYIHPMLKDKEKPLAGVCEFSLDVNP
DREYPLIEINVSHQYIIIEGFLLYLNERRLYRWNDNNLRSQVGLTKWAHLRKTYNPVSLD
ILYSLNSNFYFVKDDLLFQLLGKRVFVKFCKVMENGKCGKAPLWYRVKRTTTAKATHIAY
AISNSTAPDSFKSKNNDYRFIVREKPIVENTISNLDYSDIKKQQFTEAEVVKRKISADIS
QIENVHTQFNSQKEKNNIRVNKVSSEVLDQISKFPVSRVTLLLMSAGQDKNYIELVEELA
RRLEKICIEKTTQSLEEIRDTFQANPEMQASFDKEYYQSIEEYKITLELIKEDLLITLIK
QMENMWAAEKKFSTEEEYVSPRFLVADGFLIDLAEEKPINPKDPRLLTLLKDHQRAMIDQ
MNLVKWNDFKKYQDPIPLKAKTLFKFCKQIKKKFLRGADFKLHTLPTEANLKYEPERMTV
LCSCVPILLDDQTVQYLYDDSIIPEFEATSSYATKQSKCGRKMSLQMEPDLLFQEAIRRM
RHLTAYDVLRRNYIAAFEELYMGNCND*IVGKIISYGYQHISG*CLISMRSDNWYSFAFN
TLV*QKLVFNCLIS*VTRAVL*YR*IYIM*DLVEYTNNRYCN**SQLLFY*LTFTEMFSF
SDFIFSWRTSSS*L*LNLYIA*TDNNAWVVLHAEFVN*III*ALDRSP*DDILFITKTQQ
HYTPE*LLNFVMACTYTI*PTKDD*IRTKYFSRDKIRVAIVRKADQEAS*ACEKRRKKEM
NFLAVFRLDLRFTSISNSSSSLVKCQLPLKY*PPFFLRKPLL*PSAC**GEK*KTEAIAV
S*S*PCKVTTNLPINSSNSVFFKASGAFERYLGFRSLQKHADLEVVKLLIGVNFEIDLLS
RI*LYQTIFVLERIYFTFRCV*RCLCSFPINSIR*VYFHLI*RRTCRGYMISFPSFYRFW
LVYASFEFLALLCRPNMEIIYFNSIIEEAFPGTYKYEYKCCAAVIFG*NYQPDCGLYIAF
FWTFTPGVMLAAVVPIPVCHPFGYYYNFKIWEDYFLESC*KNHSGIFATD*SNVARQSSY
YEFKSSLIFLYISIVMSTNYQLKREKFYELLDDYAVQNIEVPRDNDNTHS*RAS*KAD*R
GTRKIISSVL*GYF*TK*ARRLLYS*ASQKLWSLPVETKLYFLLLHLCFI*IAHKEILTP
NSNESLQFRISIETLYSPHLFQIRII*RIH*AQITADL*T*SLRIHVSMIGDTLSEH*LA
IGFQHLQLQSWINTQGDVQT*LRKCSI*SLLFPQLSTVKSINKPFQ*L*FFFLVMEDLN*
SVLVNQLE*EFFIPKILYLKISLSKDTSVSLSVQSVR*FQLRCLPIPQRRPKNKRFV*RS
VLISALVTWGSKIQILLFFEKEKREC*NVFTFISTRKTKPEANDYHNYCPLMGKLLKITH
YLLREHKLLIVYLTFFT*LLQRLVMKCFKKKKKIENPLYCIRNGEF*ARN*LTSLHSFPH
ERTVMLASPELLILEGPSPQFSNEPRTSLSTVVSSKIFTTYIACCIAFFGKPYFTTNLF*
D*SLKNFFVCLKIAQL*ASRMFYTKYPSAAFLFFLSCGSRKVLHQHE*QLMVSVS*FHAL
KLISPFVQKLSGGVAMMDRKNVML*DYCTII*IC*SASYSNRAVNFVIQFQFTLS**CFI
SFEFLAHESLFSFIILFRNYTLLQFRSA*QTGRMRTLQGCCDPSRVCKTR*RVVMC*LCG
RNLYFSFKVVWYVSAVKKVRKHPNGLLPECFLR*TYTPIVKKVA*IYSVVTNDSWFNFFR
L*YN*QVYIFAQNMFECESVDI*RDTSFTFHCFEFTLKICFRVLNQRTTNKKCLWLLDIY
F*PAYFCYL*LMLL*VLQRLVCQLERRKMV*L*TFTNIP*KIHLHTQIRHIWPMVMLMQK
NWVL*VGKQSFPSIIPSHVMAHQILVLVPMMMLLNIALPRLYQ*SVALNFVLIIQLFLLK
LRNVKMTIAIKALPTGVQICSDSTQHPPT*PWK*QVTFYHQKLVPTHLASLLWMIQQFYR
LEVMLPLNVVNRNSLLSHQRISLLTVLNHGTQMHLPT*RGQRTCTPVTITRSKLFIQMLY
PGVRFLLVWYCQMVLRLMMILKDMFFLLTIMLLKLTVPFQTLLSMQELVYHLQHLPGRPV
KSVQSVPRPSLPVM*HHMSLALPGRPVKSVQSAPRPSLLAPLLHMSPALPRRPVKSVRSA
PKLSLPVM*HHMSARLLLPQTTLAHSHRPVKSVQSAPKLSLLAPLLHMSLALPGRPVKSV
QSAPRPSLPVM*HHMSARLLLPQTTLAHSHRPVKSVQSAPKLSLLAPLLHMSLALPRRPV
KSVQSAPRPSLPVM*HHMSARLLLPQTTLALSHRPVKSVQSAPKPSLLAPLLHMSPALPG
RPVKSVQSAPRPSLPVM*HHMSARLLLPQTTLAHSHRPVKSVQSAPKPSLQAHPLHMQPH
LLAQLLHLPLQLPIP*RLWSKQTQPFLSAYLQL*ASIPTLQLHL*SQMLVLSYRQIKAAL
KVMLRHPYIALRPCILVTKP*HLALLSPHQLLPNLLNPRPQLPFYPQLSLLNSNHLQ*KR
RSLVSPHHQLI*LPAMTLHLRIQLLVHPHRL*A*SLVFLYQVVIQLLANKYFTAPSLVQT
VKH*QVFLRPKSVPQNLLNHIEHRPLHPVNQASNLQALKSNLQVPLLSAFTKLLQPPPPF
KYLLSL*LHPPLFPQLPLVLQGSIVKLKVQILPRKPCRLKIAPALCLLHQLHLPKQAKLP
VMKLLPDFLVIAPLCIG*LQKHPPQMNKQL*LL*VLVNQIAAQTQSQVL*FPRPPLPSMG
LPLNILHGALFLLRN*QR*VN*SQKKKPP*LRLLLVSLVSVPKLLHLLSFRQPLLPSMMS
LQFIPHGAHRLQIN*RLVLTSKIVPVRLHSFQRLLRQNP*AETTILFQLLGLLLLKHIQP
LQATRLKIATMFLLLRLSVAKVSQIPC*LVYLNSLVAHQQVV**DLVQPL*RCQATSALQ
IIY*PIVVLVFSLPPYYWQSFNRCRNILWIDTSASTIRPSAILCTYLFTIHFFVLLLQIA
QNVLFFY*NHFYI*D*RETIPGVASLCFLYVSHTRERCCTKTPISSIEAY*K*TDIF*YI
*ISIKDKAYWTWSRCFDQ*IFNKLNGLL*IPFEIKYCILMKHKVNQQLKLNNSYYCPALL
SQQFVLPKNCDLY*KTFFFSDNFA*RSKM**RRTFG*KTPKIV**TDSGISTIDTS*DVG
TVFKSWLEILEGISQLLSAHPNKQLSRKEQRF*LTQHAEEYRKRSSGNG*ASKKSITLYL
KASMIYLSTQQGSVFPI*EAYGVIEANRAQHES*QTEQTLYPSEF**VIILFTSIQRNGR
TIEITVD*NYRGPIRLLQSTRKGTFTMNNTKQLANVLKTIERCYHAEIHVFKSGLYYNEP
MCSLKLLVCFPNMKLLLEEIDIVIIYVSI*SHTGCITLIHVMFLKLMYSLCMDVTHILNL
NYEYKHT*VESSTSS*FSACKL*FTRKAIYNFLFEN*SHNLMKVYKVG*AFFGTDFLNCH
QQSLIYLKS*NLLTIKSSMAILGKSIKNFWQEPKFTVILIEHHYSSVFIELANTKVVFST
SEFPDNIIDAHTKKIFTIRTFHKY*PRIFIFLFE*EWKIKKC**GITECIFNRKEMNKNK
RDLSLIEST*ATSRTGNGKNNCFIAFLQRVFVIDIWVENSGALRNDELKAKSSKTLQCSA
F*KASFVMSNKYM*A*KDRLSLPESM*IENFLRPTSIYWRKIKPRLMHCVL*IGSGITNV
LLDKMGYF*TLYFFSSAEPGGFYDLYT*LMITVLESKALFGILCKYIVVFIG*WCLDLTK
ILDLFRL*HHFFFDQNFQLFESAIFHKI*HLSHDLEKYHNHSSTILFLYSPTTVAYILTT
RLKYSRFMRLSSNGI*NKKKLYLRVLV**KE*KRSRNITF*HIFLGFIFTRTDGQRSLES
TRFFDENHDS*FFRHVVTFSKLQFQGVQFTVNMQPKI*QSPFEQIKSDMTVQRMIDY*TK
MGYHTVLEVIGCITLS*KNHVTIYKKCLKNWITTCYGKISKI*DNHSVSLAFWNICFLVI
KHTFHDSQY*FLGMIKNGTCPYWERDDLSECARREYIEFKFPLFILLTGMIYAFCKVFRA
FYLRGKNHTNEAPEFEEQGNGNHEYARFSVLRLKSAWESRSFCNVNNRSTFDKFKKFIEG
AFIVLQLTIHLYILSSMPMDNKKFFHQGFLVQMFLWILLLVVITLRLISASQSFRWVLAC
KRDLWAVSFYSYASLFTLSILPLRSVFIGKIKDKIMVKYIISETFIDLALLLLLSTSSIE
GTRYSFLVENENKKLPPAPTVFGLLTFSRIDRLIWKAYKHCLGNADIWDLDINNKSIAIL
ANFEMSSKKGRLLPNIICYFKAVFISQLFLAFVSSFLNFVPSLLMPRILSYVNDPKSKSW
NLVSLYVSSMLVSKIIATTCRGQGLFLGEKGTMQLRTVLISNIYSKTLRRTILKDSTTSL
QKNASTSFEENPDSSEAEPRKKSSRKDNSVNNVMSIDAFKVSEAMNTFYLACEAVFMTVT
ALMILYSLLGWSAFAGTFALLAMIPLNFWCATFYGNYQADQLILTDKRTSGISEALNSIR
VIKLLAWENLFYQKIINVRDGEIRLLKKKATIFFLNHLIWFFGPTLVSAITFSVFIKFQN
QTLTPTIAFTALSLFAILRTPMDQIASTVSLLIQSFISLERIQDYLNESETRKYEILEQS
NTKFGFEDASMEWEAAETSFKLKNISIDFKLNSLNAIIGPTGSGKSSLLLGLLGELNLLS
GKIYVPTVESRDDLEIGKDGMTNSMAYCSQTPWLISGTIKDNVVFGEIFNKQKFDDVMKS
CCLDKDIKAMTAGIRTDVGDGGFSLSGGQQQRIALARAIYSSSRYLILDDCLSAVDPETA
LYIYEECLCGPMMKGRTCIITSHNISLVTKRADWLVILDRGEVKSQGKPSDLIKSNEFLR
ESINNDSKNTTHNQIDLKRSTTSKKTKNGDPEGGNSQDEVCAEVENFEETKMEGSVKFSA
YKWLADYFGGLGVVFVFTSSSILIHGITLSQGFWLRYWLDTGSSGSKSTWLYRIVEGHSN
IYFLLTYIIIGLVSSFLTSGKVWIAIISGTNVTKKIFAKLLSSILYAKLRFHNVTPTGRI
MNRFSKDMDIIDQQLIPNFEGLSYSVVVCLWIILLIGYVTPQFLLFAIPLCALYYTVCTL
YLRASRELKRIDNINISPIHQLFAEAIKGVTTIRALADERRFITQSLVAIDRSNAPFFYL
NMATEWITYRVDIIGTLVLFSSSVMIIMKAS*LDAGLAGILLSNAFSFTETAQWIIKVFS
SVELLMSSVERIKEYTDIPSESNGYISPPANWPQTGDVELKNLSLRYSPHSSKALDNVSF
KVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQ
DPTLFDGTVRSNLDPFDRYSDVQIYGVLSKVGLIEECDELCLIFEQEQPNFSSHKLRNRF
IDLNTVVKSGGSNLSQGQRQLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETM
KNTTILTIAHRLRSVIDYDKILVMEMGRVKEYDHPYTLISDRNTIFYRLCRQSGEFENLF
ELAKVSFDNKR*DN*NFLFLFIPVLATKYTICLRHIFVCN*KAFRKSLLTFQGYMS*STT
FFENFKK*LL*TCLCQTKFCWYILWYINKLRYYYFFLIVLLILENNIISSQKKLSR*ESR
IFSRSKKKIP*FKCLFST*LLILSQVYYWRVPWFISCYFYLYLNL*KFIVVYYVILCRIG
GKDKSTDSKQFF**EFMSRNKRKFCWPNLLTPLM*LRLRSVITQLLSCVYLRFSLQVIAA
FLSRKEKKTTFFLHCDEYIQAREFSRFLTKDTSLNAPA*IL*TTDPYINRF*VHIEYLRN
YIPLRYTYLILIVLKSV*KAKKNKMKIRK*LRYLSSKLSSGVSSFFGMINFLLDEKLQNK
NPKA*NPRSIQNTFLMESLKMFPIVE*EPS*F*RRYKIMSSTVFPS*GSR*ARDTLL*KE
AEKTVVESTPPRVVPNDFMNVLKAVTSIKSIAASGRSLVI*SCALMSDACRANPRENPGN
SKTPI*VDFVDVFVISVISPAPITPRTPPNIKSGLTKPSFLVITPLAMAAITLVITIGIK
*RPAFHALDANISWKNWTEYIICPL*PVHNRNVTMFTIIMAGFATNLLRRRGL*DILSGS
GLNLSNRKKSYTNEKIKSKTPKTKYVMTWPEFQLYLLPPKVSPSRKRTSPAEQRAKPKKS
NLKIMPFISLLKLTWCLNLLKVKLEIVPIASLIC*SIPLFSAL*VSKNIIMARPPIGRLI
*KHHLQVTWVVKAPPIIGPTIAATANAQLRMEITNGRDLSPTIVQPITKQSVWSPLPPTP
ATTLPKMSIFIEEARAAIRDPASKISIAKMRLCWKPMIDANLPQMRLRIAFGKL*PVTSQ
PVLE*FPNCSATTSIIVPTIKISSAVMNSTRVNEARQRYKESPIGESLLPLAFNEASEPH
APSISCCEEYLVSSIFLNFYRLSSIPGMIWSDQF*V*V*LEYIYIYVYIYLNQKKKKFAS
HKGVMTLLSFAYFVDSYHVRAAYEVRRYLLNMY*FAPAAKEMWHYFYSHVNFHLLYIEKR
VLLSIAD*FAQILFTQRKLCISNPYGLFMKELCSSYTTGSRYSIF**FCTCAHILSTGTA
FFSLFQQT*TQASLISLKRDSFDGTVFLSYKSLRYNWFVVDFRKVS*LYDDRSKLKLKSP
GV*TPH*RGVTAIFFIFF*YSIITSI*F*YFQKKVKKKIVTKCVSKIYMRTWNVLK*FHF
*QM*RP*NLKYYLHK*EK*NSFMDWNEKKKKKNNQVNKLSDEF*CCWCLK**KKWN*AVL
*DY*ARTSLKR*HVLYDIDLF*AQRKRNYVCTV*FLEI*NSTDKYRVCMWVWN*FRLHT*
IDLYGLCNELIFRTLLTFNCPSYQCCCECRIPSCLL*TL*PLRKTKAFFSCNYFLYNGNH
HSITGDPSHHVCSRIGFL*LWIRRNKSAPDINTLRFLLLEMENVLPVRLILAIYHNTMDF
RQYYHSSKSSEKLVLEYCNVGFYLPTLYLANYISYSLYEVQIFKDC*VEISQRTG*KGKN
GRII*EFGVSILETRYCWHIINNCVARVYSCSFDVG**DITKVAQFKNNCHFSFRWLFIF
HFFILGGQICQISSSTVQITK*SWNLGTPWCYFFQFFHLFHFVRLSVSCFAGIDERIVHF
GCSDSKPS*LCCCYCISILQFVGGKDKETETFCNRRLCCMDGVHGPFLQIQRRIWVS*RC
YRCICYHGFERSPMQQFSDRHTASHDYA**DGCNNRHSVYLFKARRCYRCLRFWCHMDTN
HA*PTLQEPWKRYIGRNSICITLYIH**LSLGLTGKRCCG*ILQICSTNNNDGWLGMYGT
VLYVYNVHEKPGTNRQGDTRRIH*RWFGCLAR*GKYFLSNQGTF*T*SK*QEIRMLIPKL
VKKGQKKNESKITKKAKTSDFYIFITSDKNDITG*DKHAR*THI*TCDAYSCVVLFIFTS
VGKNSASVKTQRQ*KSQRH*Y*KCGRSYYPINDAGNALCMNALIMLYRKRKKERKKRISC
NF**GRHVIALF*VYAIVNHSKRKKVICLLVFCIVVVTS*CVP*CECNMRFWYRKKGTDH
MGTDTTILYACIEIIVFLESATVYG*TQ*SSSKSTNRTLCRNLHITDIIRPIKLAASDFQ
NKYYIERVQRAQKKWT*KSC*INCISFKLAATMIATSAIY*RY*PFEILHQCCSVI*F**
NHFC*KSRILYRLKYTVLQYITYFK*YSHVFWGYQR*YHTRLSWNS*DC*QMSTMAPY*Q
SMVVKLIQIMSHSCSHISIESCGVFPDTSSSANGSTTAKVELIAHP*IVDS*CMLL*LRR
*R*ASKSCVLSSSSSTSIS*AKNLR**FGKKAKAKPMCFITAALLKRYKKR*LNYKST*R
N*SCETEQ*LTPL**PFLTVNYGKLSLKFNVNASFCYFCESRRSQRDDML*DSTSLRMIL
SVIDALYQGLSYHSIRRAMHIHS*I*CDMESNN*IYARKMCSI*EY*KKY*NEN*KRPL*
YTQIMPSLPVKDK*DKLAMLCCLFIC*YKELRSILYALA*RKN*TFLYKISIRHVGLLLL
CVHIPVLRYCMRDGARRDRRDI*HLRNNLV*NLSLFPV*TLASRYFFYRGVECGNPIA*Y
E*CFSIVSELF*IKKTYSSKPLIR*YLRNYSFYVQNGNYVILTFT*HVEESNKLTTI*HI
S*IVIHYVNIP*NYLAFR*LLQKQQTYHRIVFFRYSLFV*VVSHTRLKMH*LCF*DIAVS
IWE*K*DAIVS*HLHECEPLPYCFSVNKECVYVLLSKDRIFLCLGDFGGDFLVILT*VYI
N*VVSIWCKSGITYVLRAFIRYLGPPNEI*ILKCG*SWELCVNGTGYRPLRQVPCIMMWV
HLVLI**EWAMDWSVRVG*V*EWYIL*HPCAYDRSEYK*GWLWHVVVGLEW*GKYVCIIY
DHLLTFHMVGRTTVW*VTDG*W*GNGRVSGGVGYG*LEGNGYDGWWLGLVGLNGTG*RMM
SWVMEV*VVRQVHQGWSRVVLGLWVCGCGVGVVWVWVWCGCGVGVVWVCGCGVWVCGVWV
CVGVVCVGVVCVGVVCVCVGVVCVWVWVWCVC