S. cerevisiae ORF Protein for YGR184C




The matching region is highlighted in the following retrieved sequence (in blue). Click on it to go to the Features Map around this region.





       1 MSVADDDLGSLQGHIRRTLRSIHNLPYFRYTRGPTERADMSRALKEFIYR
      51 YLYFVISNSGENLPTLFNAHPKQKLSNPELTVFPDSLEDAVDIDKITSQQ
     101 TIPFYKIDESRIGDVHKHTGRNCGRKFKIGEPLYRCHECGCDDTCVLCIH
     151 CFNPKDHVNHHVCTDICTEFTSGICDCGDEEAWNSPLHCKAEEQENDISE
     201 DPATNADIKEEDVWNDSVNIALVELVLAEVFDYFIDVFNQNIEPLPTIQK
     251 DITIKLREMTQQGKMYERAQFLNDLKYENDYMFDGTTTAKTSPSNSPEAS
     301 PSLAKIDPENYTVIIYNDEYHNYSQATTALRQGVPDNVHIDLLTSRIDGE
     351 GRAMLKCSQDLSSVLGGFFAVQTNGLSATLTSWSEYLHQETCKYIILWIT
     401 HCLNIPNSSFQTTFRNMMGKTLCSEYLNATECRDMTPVVEKYFSNKFDKN
     451 DPYRYIDLSILADGNQIPLGHHKILPESSTHSLSPLINDVETPTSRTYSN
     501 TRLQHILYFDNRYWKRLRKDIQNVIIPTLASSNLYKPIFCQQVVEIFNHI
     551 TRSVAYMDREPQLTAIRECVVQLFTCPTNAKNIFENQSFLDIVWSIIDIF
     601 KEFCKVEGGVLIWQRVQKSNLTKSYSISFKQGLYTVETLLSKVHDPNIPL
     651 RPKEIISLLTLCKLFNGAWKIKRKEGEHVLHEDQNFISYLEYTTSIYSII
     701 QTAEKVSEKSKDSIDSKLFLNAIRIISSFLGNRSLTYKLIYDSHEVIKFS
     751 VSHERVAFMNPLQTMLSFLIEKVSLKDAYEALEDCSDFLKISDFSLRSVV
     801 LCSQIDVGFWVRNGMSVLHQASYYKNNPELGSYSRDIHLNQLAILWERDD
     851 IPRIIYNILDRWELLDWFTGEVDYQHTVYEDKISFIIQQFIAFIYQILTE
     901 RQYFKTFSSLKDRRMDQIKNSIIYNLYMKPLSYSKLLRSVPDYLTEDTTE
     951 FDEALEEVSVFVEPKGLADNGVFKLKASLYAKVDPLKLLNLENEFESSAT
    1001 IIKSHLAKDKDEIAKVVLIPQVSIKQLDKDALNLGAFTRNTVFAKVVYKL
    1051 LQVCLDMEDSTFLNELLHLVHGIFRDDELINGKDSIPEAYLSKPICNLLL
    1101 SIANAKSDVFSESIVRKADYLLEKMIMKKPNELFESLIASFGNQYVNDYK
    1151 DKKLRQGVNLQETEKERKRRLAKKHQARLLAKFNNQQTKFMKEHESEFDE
    1201 QDNDVDMVGEKVYESEDFTCALCQDSSSTDFFVIPAYHDHSPIFRPGNIF
    1251 NPNEFMPMWDGFYNDDEKQAYIDDDVLEALKENGSCGSRKVFVSCNHHIH
    1301 HNCFKRYVQKKRFSSNAFICPLCQTFSNCTLPLCQTSKANTGLSLDMFLE
    1351 SELSLDTLSRLFKPFTEENYRTINSIFSLMISQCQGFDKAVRKRANFSHK
    1401 DVSLILSVHWANTISMLEIASRLEKPYSISFFRSREQKYKTLKNILVCIM
    1451 LFTFVIGKPSMEFEPYPQQPDTVWNQNQLFQYIVRSALFSPVSLRQTVTE
    1501 ALTTFSRQFLRDFLQGLSDAEQVTKLYAKASKIGDVLKVSEQMLFALRTI
    1551 SDVRMEGLDSESIIYDLAYTFLLKSLLPTIRRCLVFIKVLHELVKDSENE
    1601 TLVINGHEVEEELEFEDTAEFVNKALKMITEKESLVDLLTTQESIVSHPY
    1651 LENIPYEYCGIIKLIDLSKYLNTYVTQSKEIKLREERSQHMKNADNRLDF
    1701 KICLTCGVKVHLRADRHEMTKHLNKNCFKPFGAFLMPNSSEVCLHLTQPP
    1751 SNIFISAPYLNSHGEVGRNAMRRGDLTTLNLKRYEHLNRLWINNEIPGYI
    1801 SRVMGDEFRVTILSNGFLFAFNREPRPRRIPPTDEDDEDMEEGEDGFFTE
    1851 GNDEMDVDDETGQAANLFGVGAEGIAGGGVRDFFQFFENFRNTLQPQGNG
    1901 DDDAPQNPPPILQFLGPQFDGATIIRNTNPRNLDEDDSDDNDDSDEREIW
    1951 *