S. cerevisiae ORF Protein for YER165W




The matching region is highlighted in the following retrieved sequence (in blue). Click on it to go to the Features Map around this region.





       1 MADITDKTAEQLENLNIQDDQKQAATGSESQSVENSSASLYVGDLEPSVS
      51 EAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLN
     101 YTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFG
     151 DILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAP
     201 HLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASL
     251 EKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNER
     301 MHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITS
     351 AKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK
     401 DVRRSQLAQQIQARNQMRYQQATAAAAAAAAGMPGQFMPPMFYGVMPPRG
     451 VPFNGPNPQQMNPMGGMPKNGMPPQFRNGPVYGVPPQGGFPRNANDNNQF
     501 YQQKQRQALGEQLYKKVSAKTSNEEAAGKITGMILDLPPQEVFPLLESDE
     551 LFEQHYKEASAAYESFKKEQEQQTEQA*