Sequence Retrieval for YPL227C_FostersB


S.cerevisiae Strain Sequence Alignment | BLAST search for this sequence

DNA Coding Sequence | 6-Frame Translation (with Restriction Map) | Restriction Fragment Sizes


Other Format Available: GCG

Protein Sequence for YPL227C_FostersB from AWRI:

>YPL227C_FostersB [source=AWRI]
MRALRFLIENKNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAIDEKGHEVSRA
LPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLKEKYGSRWEIVIVDDGSTDNT
TQYCLKICKEQFKLNYEQFRVIKFSQNRGKGGAVRQGFLHIRGKYGLFADADGASKFSDV
EKLIDAISKIETSSTDLKTTKPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFG
IRSIKDTQCGFKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG
SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC*