Sequence Retrieval for YFL017C_LalvinQA23


S.cerevisiae Strain Sequence Alignment | BLAST search for this sequence

DNA Coding Sequence | 6-Frame Translation (with Restriction Map) | Restriction Fragment Sizes


Other Format Available: GCG

Protein Sequence for YFL017C_LalvinQA23 from AWRI:

>YFL017C_LalvinQA23 [source=AWRI]
MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATVWNDNEDKKIM
QYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIXQLV
TIGFDYGCYKIILDCDEKNVKFYEKCGFNNAGVEMQIRK*