Sequence Retrieval for YFL017C_L1528


S.cerevisiae Strain Sequence Alignment | BLAST search for this sequence

DNA Coding Sequence | 6-Frame Translation (with Restriction Map) | Restriction Fragment Sizes


Other Format Available: GCG

Protein Sequence for YFL017C_L1528 from Stanford:

>YFL017C_L1528 [source=Stanford]
MEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATVWNDNEDKKIMQYNPMVIVDKR
TETIAATGNIIIERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIGQLVTIGFDYGCYKI
ILDCDEKNVKFYEKCGFNNAGVEMQIRK*