Sequence Retrieval for YFL017C_EC9-8


S.cerevisiae Strain Sequence Alignment | BLAST search for this sequence

DNA Coding Sequence | 6-Frame Translation (with Restriction Map) | Restriction Fragment Sizes


Other Format Available: GCG

Protein Sequence for YFL017C_EC9-8 from ASinica:

>YFL017C_EC9-8 [source=ASinica]
MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATVWNDNEDKKIM
QYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIDQLV
TIGFDYGCYKIILDCDEKNVKFYEKCGFSNAGVEMQIRK*