Sequence Retrieval for YFL017C_EC1118


S.cerevisiae Strain Sequence Alignment | BLAST search for this sequence

DNA Coding Sequence | 6-Frame Translation (with Restriction Map) | Restriction Fragment Sizes


Other Format Available: GCG

Protein Sequence for YFL017C_EC1118 from Genoscope:

>YFL017C_EC1118 [source=Genoscope]
MQYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIGQL
VTIGFDYGCYKIILDCDEKNVKFYEKCGFNNAGVEMQIRK*