Sequence Retrieval for YER148W_UC5


S.cerevisiae Strain Sequence Alignment | BLAST search for this sequence

DNA Coding Sequence | 6-Frame Translation (with Restriction Map) | Restriction Fragment Sizes


Other Format Available: GCG

Protein Sequence for YER148W_UC5 from WashU:

>YER148W_UC5 [source=WashU]
MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSAT
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGK
MVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHG
TFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
*