OPT2/YPR194C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YPR194C_S288C   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_AWRI796   
   --------------------------------------------------   
YPR194C_BC187   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_BY4741   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_BY4742   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_CBS7960   
   --------------------------------------------------   
YPR194C_CEN.PK   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_CLIB215   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_D273-10B   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_DBVPG6044   1   ---------------MYVLISKCFRGAEYSERLSNHSSDFSQWYTDEQIL   35
YPR194C_EC1118   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_EC9-8   
   --------------------------------------------------   
YPR194C_FL100   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_FY1679   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_FostersB   
   --------------------------------------------------   
YPR194C_FostersO   
   --------------------------------------------------   
YPR194C_JAY291   
   --------------------------------------------------   
YPR194C_JK9-3d   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_K11   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_Kyokai7   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_L1528   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_LalvinQA23   
   --------------------------------------------------   
YPR194C_RM11-1a   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_RedStar   
   --------------------------------------------------   
YPR194C_SEY6210   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_T7   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_UC5   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_UWOPS05_217_3   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_VL3   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_Vin13   
   --------------------------------------------------   
YPR194C_W303   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_X2180-1A   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_YJM269   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_YJM789   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_YPH499   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_YPS128   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_YPS163   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_YS9   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
YPR194C_ZTW1   1   MSETVKDKVIIDEKVSTKGTVDYAEGAEYSERLSNHSSDFSQWYTDEQIL   50
         

YPR194C_S288C   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_AWRI796   
   --------------------------------------------------   
YPR194C_BC187   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_BY4741   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_BY4742   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_CBS7960   
   --------------------------------------------------   
YPR194C_CEN.PK   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_CLIB215   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_D273-10B   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_DBVPG6044   36   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   85
YPR194C_EC1118   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_EC9-8   
   --------------------------------------------------   
YPR194C_FL100   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_FY1679   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_FostersB   
   --------------------------------------------------   
YPR194C_FostersO   
   --------------------------------------------------   
YPR194C_JAY291   
   --------------------------------------------------   
YPR194C_JK9-3d   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_K11   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_Kyokai7   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFEDDE   100
YPR194C_L1528   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_LalvinQA23   
   --------------------------------------------------   
YPR194C_RM11-1a   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_RedStar   
   --------------------------------------------------   
YPR194C_SEY6210   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_T7   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_UC5   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_UWOPS05_217_3   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_VL3   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_Vin13   1   -------MKIALFMIFRKTLRISSKKMPELTLEDSFKILKDSIIYFKDDE   43
YPR194C_W303   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_X2180-1A   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_YJM269   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFEDDE   100
YPR194C_YJM789   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_YPH499   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_YPS128   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_YPS163   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_YS9   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
YPR194C_ZTW1   51   HFMKKLGYENRTLYDIPEDVAYILKKMPELTLEDSFKILKDSIIYFKDDE   100
         

YPR194C_S288C   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_AWRI796   
   --------------------------------------------------   
YPR194C_BC187   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_BY4741   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_BY4742   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_CBS7960   
   --------------------------------------------------   
YPR194C_CEN.PK   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_CLIB215   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_D273-10B   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_DBVPG6044   86   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   135
YPR194C_EC1118   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_EC9-8   
   --------------------------------------------------   
YPR194C_FL100   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_FY1679   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_FostersB   
   --------------------------------------------------   
YPR194C_FostersO   
   --------------------------------------------------   
YPR194C_JAY291   
   --------------------------------------------------   
YPR194C_JK9-3d   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_K11   101   NIPHDQYEEWKRLVDLEDLDSKEGINEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_Kyokai7   101   NIPHDQYEEWKRLVDLEDLDSKEGINEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_L1528   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_LalvinQA23   
   --------------------------------------------------   
YPR194C_RM11-1a   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_RedStar   
   --------------------------------------------------   
YPR194C_SEY6210   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_T7   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_UC5   101   NIPHDQYEEWKRLVDLEDLDSKEGINEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_UWOPS05_217_3   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_VL3   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_Vin13   44   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   93
YPR194C_W303   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_X2180-1A   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_YJM269   101   NIPHDQYEEWKRLVDLEDLDSKEGINEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_YJM789   101   NIPHDQYEEWKRLVDLEDLDSKEGINEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_YPH499   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_YPS128   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_YPS163   101   NIPHDQYEEWKRLVDLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_YS9   101   NIPHDQYEEWKRLVDLEDLDSKEGINEYDSFDIRAFASAIKFHSPYQEVR   150
YPR194C_ZTW1   101   NIPHDQYEEWKRLVDLEDLDSKEGINEYDSFDIRAFASAIKFHSPYQEVR   150
         

YPR194C_S288C   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPII   200
YPR194C_AWRI796   
   --------------------------------------------------   
YPR194C_BC187   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPII   200
YPR194C_BY4741   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPII   200
YPR194C_BY4742   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPII   200
YPR194C_CBS7960   
   --------------------------------------------------   
YPR194C_CEN.PK   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPII   200
YPR194C_CLIB215   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPII   200
YPR194C_D273-10B   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPII   200
YPR194C_DBVPG6044   136   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNDFFSHRVVSISLDTPII   185
YPR194C_EC1118   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPII   200
YPR194C_EC9-8   1   --------------------------------MSFFSHRVVSISLGTPII   18
YPR194C_FL100   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPII   200
YPR194C_FY1679   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPII   200
YPR194C_FostersB   
   --------------------------------------------------   
YPR194C_FostersO   1   --------------------------------MSFFXHRVVSISLGTPII   18
YPR194C_JAY291   
   --------------------------------------------------   
YPR194C_JK9-3d   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPII   200
YPR194C_K11   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFAHRVVSISLGTPII   200
YPR194C_Kyokai7   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVISISLGTPII   200
YPR194C_L1528   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPII   200
YPR194C_LalvinQA23   
   --------------------------------------------------   
YPR194C_RM11-1a   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPII   200
YPR194C_RedStar   
   --------------------------------------------------   
YPR194C_SEY6210   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPII   200
YPR194C_T7   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLDTPII   200
YPR194C_UC5   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLGTPII   200
YPR194C_UWOPS05_217_3   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLDTPII   200
YPR194C_VL3   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPII   200
YPR194C_Vin13   94   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPII   143
YPR194C_W303   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPII   200
YPR194C_X2180-1A   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPII   200
YPR194C_YJM269   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLGTPII   200
YPR194C_YJM789   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLGTPII   200
YPR194C_YPH499   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPII   200
YPR194C_YPS128   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLDTPII   200
YPR194C_YPS163   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLDTPII   200
YPR194C_YS9   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLGTPII   200
YPR194C_ZTW1   151   AVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFAHRVVSISLGTPII   200
         

YPR194C_S288C   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_AWRI796   
   --------------------------------------------------   
YPR194C_BC187   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_BY4741   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_BY4742   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_CBS7960   
   --------------------------------------------------   
YPR194C_CEN.PK   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_CLIB215   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_D273-10B   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_DBVPG6044   186   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   235
YPR194C_EC1118   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_EC9-8   19   QMFLYICGKAWAKTIPCWAITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   68
YPR194C_FL100   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_FY1679   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_FostersB   
   --------------------------------------------------   
YPR194C_FostersO   19   QMFLYICGKAWAKTIPCWAITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   68
YPR194C_JAY291   1   ---------------------------------MDPKRANVFNLVICNLS   17
YPR194C_JK9-3d   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_K11   201   QMFLYICGKAWAKTIPCWAITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_Kyokai7   201   QMFLYICGKAWAKTIPCWAITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_L1528   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_LalvinQA23   
   --------------------------------------------------   
YPR194C_RM11-1a   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_RedStar   1   ----------------------------------------MFSTLLYGIC   10
YPR194C_SEY6210   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_T7   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_UC5   201   QMFLYICGKAWAKTIPCWAITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_UWOPS05_217_3   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_VL3   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_Vin13   144   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   193
YPR194C_W303   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_X2180-1A   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_YJM269   201   QMFLYFCGKAWAKTIPCWAITIRGRKYGINIDKPWTQKEQMFSTLLYGIC   250
YPR194C_YJM789   201   QMFLYICGKAWAKTIPCWAITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_YPH499   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_YPS128   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_YPS163   201   QMFLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_YS9   201   QMFLYICGKAWAKTIPCWAITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
YPR194C_ZTW1   201   QMFLYICGKAWAKTIPCWAITIRGRKYGINIDKPWTQKEQMFSTLLYAIC   250
         

YPR194C_S288C   251   QGAFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_AWRI796   
   --------------------------------------------------   
YPR194C_BC187   251   QGTFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_BY4741   251   QGAFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_BY4742   251   QGAFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_CBS7960   
   --------------------------------------------------   
YPR194C_CEN.PK   251   QGAFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_CLIB215   251   QGTFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_D273-10B   251   QGAFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_DBVPG6044   236   QGTFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   285
YPR194C_EC1118   251   QGTFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_EC9-8   69   QGAFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   118
YPR194C_FL100   251   QGAFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_FY1679   251   QGAFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_FostersB   
   --------------------------------------------------   
YPR194C_FostersO   69   QGTFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   118
YPR194C_JAY291   18   RHVLYSLQNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   67
YPR194C_JK9-3d   251   QGAFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_K11   251   QGTFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_Kyokai7   251   QGAFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_L1528   251   QGTFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_LalvinQA23   
   --------------------------------------------------   
YPR194C_RM11-1a   251   QGTFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_RedStar   11   QGTFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   60
YPR194C_SEY6210   251   QGAFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_T7   251   QGTFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_UC5   251   QGAFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_UWOPS05_217_3   251   QGTFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_VL3   251   QGXFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_Vin13   194   QGTFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   243
YPR194C_W303   251   QGAFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_X2180-1A   251   QGAFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_YJM269   251   QGTFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_YJM789   251   QGAFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_YPH499   251   QGAFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_YPS128   251   QGTFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_YPS163   251   QGTFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_YS9   251   QGTFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
YPR194C_ZTW1   251   QGTFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVY   300
         

YPR194C_S288C   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_AWRI796   
   --------------------------------------------------   
YPR194C_BC187   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_BY4741   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_BY4742   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_CBS7960   1   -----------------------------------------MFIYNWFPT   9
YPR194C_CEN.PK   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_CLIB215   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_D273-10B   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_DBVPG6044   286   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   335
YPR194C_EC1118   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_EC9-8   119   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   168
YPR194C_FL100   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_FY1679   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_FostersB   1   -----------------------------------------MFIYNWFPT   9
YPR194C_FostersO   119   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   168
YPR194C_JAY291   68   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   117
YPR194C_JK9-3d   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_K11   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_Kyokai7   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_L1528   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_LalvinQA23   1   -----------------------------------------MFIYNWFPT   9
YPR194C_RM11-1a   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_RedStar   61   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   110
YPR194C_SEY6210   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_T7   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_UC5   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_UWOPS05_217_3   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_VL3   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_Vin13   244   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   293
YPR194C_W303   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_X2180-1A   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_YJM269   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_YJM789   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_YPH499   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_YPS128   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_YPS163   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_YS9   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
YPR194C_ZTW1   301   PARALWPTVMPTIAINKALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPT   350
         

YPR194C_S288C   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   400
YPR194C_AWRI796   
   --------------------------------------------------   
YPR194C_BC187   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFYSP   400
YPR194C_BY4741   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   400
YPR194C_BY4742   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   400
YPR194C_CBS7960   10   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   59
YPR194C_CEN.PK   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   400
YPR194C_CLIB215   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFYSP   400
YPR194C_D273-10B   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   400
YPR194C_DBVPG6044   336   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   385
YPR194C_EC1118   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   400
YPR194C_EC9-8   169   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   218
YPR194C_FL100   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   400
YPR194C_FY1679   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   400
YPR194C_FostersB   10   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISYNSP   59
YPR194C_FostersO   169   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISYNSP   218
YPR194C_JAY291   118   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   167
YPR194C_JK9-3d   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   400
YPR194C_K11   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISYNSP   400
YPR194C_Kyokai7   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISYNSP   400
YPR194C_L1528   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFYSP   400
YPR194C_LalvinQA23   10   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFXSP   59
YPR194C_RM11-1a   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFYSP   400
YPR194C_RedStar   111   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFYSP   160
YPR194C_SEY6210   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   400
YPR194C_T7   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   400
YPR194C_UC5   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   400
YPR194C_UWOPS05_217_3   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   400
YPR194C_VL3   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFYSP   400
YPR194C_Vin13   294   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFYSP   343
YPR194C_W303   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   400
YPR194C_X2180-1A   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   400
YPR194C_YJM269   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   400
YPR194C_YJM789   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   400
YPR194C_YPH499   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   400
YPR194C_YPS128   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   400
YPR194C_YPS163   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISFNSP   400
YPR194C_YS9   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISYNSP   400
YPR194C_ZTW1   351   YIINILNTFNWMTWIKPSNINLANITGGVTGLGINPISSFDWNVISYNSP   400
         

YPR194C_S288C   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGHS   450
YPR194C_AWRI796   
   --------------------------------------------------   
YPR194C_BC187   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGDS   450
YPR194C_BY4741   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGHS   450
YPR194C_BY4742   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGHS   450
YPR194C_CBS7960   60   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGDS   109
YPR194C_CEN.PK   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGHS   450
YPR194C_CLIB215   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGDS   450
YPR194C_D273-10B   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGHS   450
YPR194C_DBVPG6044   386   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGDS   435
YPR194C_EC1118   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGDS   450
YPR194C_EC9-8   219   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGHS   268
YPR194C_FL100   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGHS   450
YPR194C_FY1679   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGHS   450
YPR194C_FostersB   60   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGDS   109
YPR194C_FostersO   219   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGDS   268
YPR194C_JAY291   168   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGDS   217
YPR194C_JK9-3d   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGHS   450
YPR194C_K11   401   LIYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGHS   450
YPR194C_Kyokai7   401   LIYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGHS   450
YPR194C_L1528   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGDS   450
YPR194C_LalvinQA23   60   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGDS   109
YPR194C_RM11-1a   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGDS   450
YPR194C_RedStar   161   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGDS   210
YPR194C_SEY6210   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGHS   450
YPR194C_T7   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGDS   450
YPR194C_UC5   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGHS   450
YPR194C_UWOPS05_217_3   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGDS   450
YPR194C_VL3   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGDS   450
YPR194C_Vin13   344   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGDS   393
YPR194C_W303   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGHS   450
YPR194C_X2180-1A   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGHS   450
YPR194C_YJM269   401   LIYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGHS   450
YPR194C_YJM789   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGHS   450
YPR194C_YPH499   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGHS   450
YPR194C_YPS128   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGDS   450
YPR194C_YPS163   401   LVYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGDS   450
YPR194C_YS9   401   LIYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGDS   450
YPR194C_ZTW1   401   LIYPFWSYLTQYLGCILAALIVIAVYYSNYMSCQYLPIFTNSLYTNTGHS   450
         

YPR194C_S288C   451   FKVTEVLDSDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFI   500
YPR194C_AWRI796   1   -------------------------------------------MITWSFI   7
YPR194C_BC187   451   FEVTEILDSGNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFI   500
YPR194C_BY4741   451   FKVTEVLDSDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFI   500
YPR194C_BY4742   451   FKVTEVLDSDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFI   500
YPR194C_CBS7960   110   FEVTEILDSGNKLDVKKYQSYSPPYYSAGNLVTYGAFICAYPLMITWSFI   159
YPR194C_CEN.PK   451   FKVTEVLDSDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFI   500
YPR194C_CLIB215   451   FEVTEILDSGNKLDVKKYQSYSPPYYSAGNVVAYGAFICAYPLMITWSFI   500
YPR194C_D273-10B   451   FKVTEVLDSDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFI   500
YPR194C_DBVPG6044   436   FEVTEILDSGNKLDVKKYQSYSPPYYSAGNLVTYGAFICAYPLMITWSFI   485
YPR194C_EC1118   451   FEVTEILDSGNKLDVKKYQSYSPPYYSAGNVVAYGAFICAYPLMITWSFI   500
YPR194C_EC9-8   269   FKVTEILDSDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFI   318
YPR194C_FL100   451   FKVTEVLDSDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFI   500
YPR194C_FY1679   451   FKVTEVLDSDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFI   500
YPR194C_FostersB   110   FKVTEILDSDNKLDVKKYQSYSPPYYSAGNLVTYGAFICAYPLMITWSFI   159
YPR194C_FostersO   269   FKVTEILDSDNKLDVKKYQSYSPPYYSAGNLVTYGAFICAYPLMITWSFI   318
YPR194C_JAY291   218   FEVTEILDSGNKLDVKKYQSYSPPYYSAGNLVTYGAFICAYPLMITWSFI   267
YPR194C_JK9-3d   451   FKVTEVLDSDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFI   500
YPR194C_K11   451   FKVTEILDSDNKLDVKKYQSYSPPYYSAGTLVSYGAFICAYPLMITWSFI   500
YPR194C_Kyokai7   451   FKVTEILDSDNKLDVKKYQSYSPPYYSAGTLVSYGAFICAYPLMITWSFI   500
YPR194C_L1528   451   FEVTEILDSGNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFI   500
YPR194C_LalvinQA23   110   FEVTEILDSGNKLDVKKYQSYSPPYYSAGNXVXYGAFICAYPLMITWSFI   159
YPR194C_RM11-1a   451   FEVTEILDSGNKLDVKKYQSYSPPYYSAGNVVAYGAFICAYPLMITWSFI   500
YPR194C_RedStar   211   FEVTEILDSGNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFI   260
YPR194C_SEY6210   451   FKVTEVLDSDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFI   500
YPR194C_T7   451   FEVTEILDSDNKLDVKKYQSYSPPYYSAGNLVTYGAFICAYPLMITWSFI   500
YPR194C_UC5   451   FKVTEVLDSDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFI   500
YPR194C_UWOPS05_217_3   451   FEVTEILDSDNKLDVKKYQSYSPPYYSAGNLVTYGAFICAYPLMITWSFI   500
YPR194C_VL3   451   FEVTEILDSGNKLDVKKYQSYSPPYYSAGNLVXYGAFICAYPLMITWSFI   500
YPR194C_Vin13   394   FEVTEILDSGNKLDVKKYQSYSPPYYSAGNXVXYGAFICAYPLMITWSFI   443
YPR194C_W303   451   FKVTEVLDSDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFI   500
YPR194C_X2180-1A   451   FKVTEVLDSDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFI   500
YPR194C_YJM269   451   FKVTEILDSDNKLDVKKYQSYSPPYYSAGNLVTYGAFICAYPLMITWSFI   500
YPR194C_YJM789   451   FKVTEVLDSDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFI   500
YPR194C_YPH499   451   FKVTEVLDSDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFI   500
YPR194C_YPS128   451   FEVTEILDSDNKLDVKKYQSYSPPYYSAGNLVTYGAFICAYPLMITWSFI   500
YPR194C_YPS163   451   FEVTEILDSDNKLDVKKYQSYSPPYYSAGNLVTYGAFICAYPLMITWSFI   500
YPR194C_YS9   451   FKVTEILDSDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFI   500
YPR194C_ZTW1   451   FKVTEILDSDNKLDVKKYQSYSPPYYSAGTLVSYGAFICAYPLMITWSFI   500
         

YPR194C_S288C   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_AWRI796   8   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   57
YPR194C_BC187   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_BY4741   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_BY4742   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_CBS7960   160   VHSKLLFNAFKDWALNLWAMRKLKSWATMFKSDYRALDDYDDPHSNAMKN   209
YPR194C_CEN.PK   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_CLIB215   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_D273-10B   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_DBVPG6044   486   VHSKLLFNAFKDWALNLWAMRKLKSWATMFKSDYRALDDYDDPHSNAMKN   535
YPR194C_EC1118   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_EC9-8   319   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   368
YPR194C_FL100   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_FY1679   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_FostersB   160   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   209
YPR194C_FostersO   319   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   368
YPR194C_JAY291   268   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   317
YPR194C_JK9-3d   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_K11   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_Kyokai7   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_L1528   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_LalvinQA23   160   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   209
YPR194C_RM11-1a   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_RedStar   261   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   310
YPR194C_SEY6210   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_T7   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_UC5   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_UWOPS05_217_3   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_VL3   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_Vin13   444   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   493
YPR194C_W303   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_X2180-1A   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_YJM269   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_YJM789   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_YPH499   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_YPS128   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_YPS163   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_YS9   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
YPR194C_ZTW1   501   VHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKN   550
         

YPR194C_S288C   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPT   600
YPR194C_AWRI796   58   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPT   107
YPR194C_BC187   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPT   600
YPR194C_BY4741   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPT   600
YPR194C_BY4742   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPT   600
YPR194C_CBS7960   210   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPT   259
YPR194C_CEN.PK   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPT   600
YPR194C_CLIB215   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPT   600
YPR194C_D273-10B   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPT   600
YPR194C_DBVPG6044   536   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPT   585
YPR194C_EC1118   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPT   600
YPR194C_EC9-8   369   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPT   418
YPR194C_FL100   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPT   600
YPR194C_FY1679   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPT   600
YPR194C_FostersB   210   YKEVPDWWYFAILIXXLVXGIAVVEHYPTNTPVWGLFVXLGFNFVFLIPX   259
YPR194C_FostersO   369   YKEVPDWWYFAILIXXLVXGIAVVEHYPTNTPVWGLFVXLGFNFVFLIPX   418
YPR194C_JAY291   318   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPT   367
YPR194C_JK9-3d   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPT   600
YPR194C_K11   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPT   600
YPR194C_Kyokai7   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPT   600
YPR194C_L1528   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPT   600
YPR194C_LalvinQA23   210   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPT   259
YPR194C_RM11-1a   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPT   600
YPR194C_RedStar   311   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPT   360
YPR194C_SEY6210   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPT   600
YPR194C_T7   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPT   600
YPR194C_UC5   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPT   600
YPR194C_UWOPS05_217_3   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPT   600
YPR194C_VL3   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPT   600
YPR194C_Vin13   494   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPT   543
YPR194C_W303   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPT   600
YPR194C_X2180-1A   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPT   600
YPR194C_YJM269   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPT   600
YPR194C_YJM789   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPT   600
YPR194C_YPH499   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPT   600
YPR194C_YPS128   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPT   600
YPR194C_YPS163   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPT   600
YPR194C_YS9   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPT   600
YPR194C_ZTW1   551   YKEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPT   600
         

YPR194C_S288C   601   TILQATTGYSFGLNLLIEMVMGYALPGNPIAIMILKAFGYNIDGQADNYV   650
YPR194C_AWRI796   108   TILQATTGYSFGLNLLIEMVMGYALPGNPIAIMILKAFGYNIDGQADNYV   157
YPR194C_BC187   601   TILQATTGYSFGLNLLIEMVMGYALPGNPIAIMILKAFGYNIDGQADNYV   650
YPR194C_BY4741   601   TILQATTGYSFGLNLLIEMVMGYALPGNPIAIMILKAFGYNIDGQADNYV   650
YPR194C_BY4742   601   TILQATTGYSFGLNLLIEMVMGYALPGNPIAIMILKAFGYNIDGQADNYV   650
YPR194C_CBS7960   260   TILQATTGYSFGLNLLIEMVMGYALPGNPIAIMILKAFGYNIDGQADNYV   309
YPR194C_CEN.PK   601   TILQATTGYSFGLNLLIEMVMGYALPGNPIAIMILKAFGYNIDGQADNYV   650
YPR194C_CLIB215   601   TILQATTGYSFGLNLLIEMVMGYALPGNPIAIMILKAFGYNIDGQADNYV   650
YPR194C_D273-10B   601   TILQATTGYSFGLNLLIEMVMGYALPGNPIAIMILKAFGYNIDGQADNYV   650
YPR194C_DBVPG6044   586   TILQATTGYSFGLNLLIEMVMGYALPGNPIAIMILKAFGYNIDGQADNYV   635
YPR194C_EC1118   601   TILQATTGYSFGLNLLIEMVMGYALPGNPIAIMILKAFGYNIDGQADNYV   650
YPR194C_EC9-8   419   TILQATTGFSFGLNLLIEMVMGYALPGNPIAIMILKAFGYNIDGQADNYV   468
YPR194C_FL100   601   TILQATTGYSFGLNLLIEMVMGYALPGNPIAIMILKAFGYNIDGQADNYV   650
YPR194C_FY1679   601   TILQATTGYSFGLNLLIEMV<