SUA7/YPR086W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YPR086W_S288C   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_AWRI796   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_BC187   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_BY4741   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_BY4742   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_CEN.PK   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_D273-10B   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_DBVPG6044   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_EC1118   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_EC9-8   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_FL100   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_FY1679   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_FostersB   
   --------------------------------------------------   
YPR086W_FostersO   1   MMTRESIDKRAGRRGPNXNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_JAY291   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_JK9-3d   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_K11   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_Kyokai7   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_L1528   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_LalvinQA23   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_M22   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_PW5   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_RM11-1a   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_RedStar   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_SEY6210   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_SK1   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_T7   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_UC5   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_UWOPS05_217_3   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_VL3   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_Vin13   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_W303   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_X2180-1A   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_Y55   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_YJM339   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_YJM789   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_YPH499   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_YPS128   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_YPS163   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_YS9   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
YPR086W_ZTW1   1   MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGL   50
         

YPR086W_S288C   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_AWRI796   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_BC187   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_BY4741   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_BY4742   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_CEN.PK   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_D273-10B   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_DBVPG6044   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_EC1118   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_EC9-8   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_FL100   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_FY1679   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_FostersB   
   --------------------------------------------------   
YPR086W_FostersO   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_JAY291   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_JK9-3d   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_K11   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_Kyokai7   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_L1528   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_LalvinQA23   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_M22   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_PW5   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_RM11-1a   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_RedStar   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_SEY6210   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_SK1   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_T7   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_UC5   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_UWOPS05_217_3   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_VL3   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_Vin13   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_W303   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_X2180-1A   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_Y55   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_YJM339   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_YJM789   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_YPH499   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_YPS128   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_YPS163   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_YS9   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
YPR086W_ZTW1   51   VLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE   100
         

YPR086W_S288C   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_AWRI796   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_BC187   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_BY4741   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_BY4742   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_CEN.PK   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_D273-10B   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_DBVPG6044   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_EC1118   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_EC9-8   101   TTDMRFTKELNKAQGKNVMDKRDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_FL100   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_FY1679   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_FostersB   1   ---MRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   47
YPR086W_FostersO   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_JAY291   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_JK9-3d   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_K11   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_Kyokai7   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_L1528   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_LalvinQA23   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_M22   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_PW5   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_RM11-1a   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_RedStar   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_SEY6210   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_SK1   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_T7   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_UC5   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_UWOPS05_217_3   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_VL3   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_Vin13   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_W303   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_X2180-1A   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_Y55   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITILCDAAELPKIVKDCA   150
YPR086W_YJM339   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_YJM789   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_YPH499   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_YPS128   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_YPS163   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_YS9   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
YPR086W_ZTW1   101   TTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCA   150
         

YPR086W_S288C   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_AWRI796   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_BC187   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_BY4741   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_BY4742   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_CEN.PK   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_D273-10B   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_DBVPG6044   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_EC1118   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_EC9-8   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_FL100   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_FY1679   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_FostersB   48   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   97
YPR086W_FostersO   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_JAY291   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_JK9-3d   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_K11   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_Kyokai7   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_L1528   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_LalvinQA23   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_M22   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_PW5   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_RM11-1a   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_RedStar   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_SEY6210   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_SK1   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_T7   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_UC5   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_UWOPS05_217_3   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_VL3   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_Vin13   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_W303   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_X2180-1A   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_Y55   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_YJM339   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_YJM789   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_YPH499   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_YPS128   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_YPS163   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_YS9   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
YPR086W_ZTW1   151   KEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKT   200
         

YPR086W_S288C   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_AWRI796   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_BC187   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_BY4741   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_BY4742   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_CEN.PK   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_D273-10B   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_DBVPG6044   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_EC1118   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_EC9-8   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_FL100   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_FY1679   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_FostersB   98   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   147
YPR086W_FostersO   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_JAY291   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_JK9-3d   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_K11   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_Kyokai7   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_L1528   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_LalvinQA23   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_M22   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_PW5   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_RM11-1a   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_RedStar   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_SEY6210   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_SK1   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_T7   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_UC5   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_UWOPS05_217_3   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_VL3   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_Vin13   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_W303   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_X2180-1A   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_Y55   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_YJM339   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_YJM789   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_YPH499   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_YPS128   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_YPS163   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_YS9   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
YPR086W_ZTW1   201   KEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPM   250
         

YPR086W_S288C   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_AWRI796   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_BC187   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_BY4741   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_BY4742   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_CEN.PK   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_D273-10B   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_DBVPG6044   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_EC1118   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_EC9-8   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_FL100   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_FY1679   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_FostersB   148   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   197
YPR086W_FostersO   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAXKVGQ   300
YPR086W_JAY291   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_JK9-3d   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_K11   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_Kyokai7   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_L1528   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_LalvinQA23   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_M22   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_PW5   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_RM11-1a   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_RedStar   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_SEY6210   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_SK1   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_T7   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_UC5   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_UWOPS05_217_3   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_VL3   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_Vin13   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_W303   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_X2180-1A   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_Y55   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_YJM339   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_YJM789   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_YPH499   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_YPS128   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_YPS163   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_YS9   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
YPR086W_ZTW1   251   QVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ   300
         

YPR086W_S288C   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGVEKK   345
YPR086W_AWRI796   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_BC187   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_BY4741   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGVEKK   345
YPR086W_BY4742   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGVEKK   345
YPR086W_CEN.PK   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGVEKK   345
YPR086W_D273-10B   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_DBVPG6044   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_EC1118   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_EC9-8   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_FL100   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGVEKK   345
YPR086W_FY1679   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGVEKK   345
YPR086W_FostersB   198   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   242
YPR086W_FostersO   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_JAY291   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_JK9-3d   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGVEKK   345
YPR086W_K11   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_Kyokai7   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_L1528   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_LalvinQA23   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_M22   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_PW5   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_RM11-1a   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_RedStar   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_SEY6210   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGVEKK   345
YPR086W_SK1   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_T7   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_UC5   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_UWOPS05_217_3   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_VL3   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_Vin13   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_W303   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGVEKK   345
YPR086W_X2180-1A   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGVEKK   345
YPR086W_Y55   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_YJM339   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_YJM789   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_YPH499   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGVEKK   345
YPR086W_YPS128   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_YPS163   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_YS9   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
YPR086W_ZTW1   301   TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDSLPGVEKK   345
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YPR086W_S288C from SGD:

YPR086W_S288C [source=SGD]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 1822  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDNLP GVEKK*


Protein Sequence for YPR086W_AWRI796 from AWRI:

YPR086W_AWRI796 [source=AWRI]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_BC187 from Stanford:

YPR086W_BC187 [source=Stanford]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_BY4741 from Stanford:

YPR086W_BY4741 [source=Stanford]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 1822  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDNLP GVEKK*


Protein Sequence for YPR086W_BY4742 from Stanford:

YPR086W_BY4742 [source=Stanford]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 1822  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDNLP GVEKK*


Protein Sequence for YPR086W_CEN.PK from Stanford:

YPR086W_CEN.PK [source=Stanford]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 1822  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDNLP GVEKK*


Protein Sequence for YPR086W_D273-10B from Stanford:

YPR086W_D273-10B [source=Stanford]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_DBVPG6044 from Stanford:

YPR086W_DBVPG6044 [source=Stanford]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_EC1118 from Genoscope:

YPR086W_EC1118 [source=Genoscope]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_EC9-8 from ASinica:

YPR086W_EC9-8 [source=ASinica]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2143  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KRDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_FL100 from Stanford:

YPR086W_FL100 [source=Stanford]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 1822  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDNLP GVEKK*


Protein Sequence for YPR086W_FY1679 from Stanford:

YPR086W_FY1679 [source=Stanford]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 1822  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDNLP GVEKK*


Protein Sequence for YPR086W_FostersB from AWRI:

YPR086W_FostersB [source=AWRI]  Length: 243  Tue Aug 21 15:06:14 2018  Type: P  Check: 5386  ..

       1  MRFTKELNKA QGKNVMDKKD NEVQAAFAKI TMLCDAAELP KIVKDCAKEA

      51  YKLCHDEKTL KGKSMESIMA ASILIGCRRA EVARTFKEIQ SLIHVKTKEF

     101  GKTLNIMKNI LRGKSEDGFL KIDTDNMSGA QNLTYIPRFC SHLGLPMQVT

     151  TSAEYTAKKC KEIKEIAGKS PITIAVVSIY LNILLFQIPI TAAKVGQTLQ

     201  VTEGTIKSGY KILYEHRDKL VDPQLIANGV VSLDSLPGVE KK*


Protein Sequence for YPR086W_FostersO from AWRI:

YPR086W_FostersO [source=AWRI]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2556  ..

       1  MMTRESIDKR AGRRGPNXNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAXKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_JAY291 from Duke:

YPR086W_JAY291 [source=Duke]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_JK9-3d from Stanford:

YPR086W_JK9-3d [source=Stanford]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 1822  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDNLP GVEKK*


Protein Sequence for YPR086W_K11 from Stanford:

YPR086W_K11 [source=Stanford]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_Kyokai7 from NRIB:

YPR086W_Kyokai7 [source=NRIB]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_L1528 from Stanford:

YPR086W_L1528 [source=Stanford]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_LalvinQA23 from AWRI:

YPR086W_LalvinQA23 [source=AWRI]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_M22 from WashU:

YPR086W_M22 [source=WashU]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_PW5 from WashU:

YPR086W_PW5 [source=WashU]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_RM11-1a from Stanford:

YPR086W_RM11-1a [source=Stanford]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_RedStar from Stanford:

YPR086W_RedStar [source=Stanford]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_SEY6210 from Stanford:

YPR086W_SEY6210 [source=Stanford]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 1822  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDNLP GVEKK*


Protein Sequence for YPR086W_SK1 from Stanford:

YPR086W_SK1 [source=Stanford]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_T7 from WashU:

YPR086W_T7 [source=WashU]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_UC5 from WashU:

YPR086W_UC5 [source=WashU]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_UWOPS05_217_3 from Stanford:

YPR086W_UWOPS05_217_3 [source=Stanford]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_VL3 from AWRI:

YPR086W_VL3 [source=AWRI]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_Vin13 from AWRI:

YPR086W_Vin13 [source=AWRI]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_W303 from Stanford:

YPR086W_W303 [source=Stanford]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 1822  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDNLP GVEKK*


Protein Sequence for YPR086W_X2180-1A from Stanford:

YPR086W_X2180-1A [source=Stanford]  Length: 346  Tue Aug 21 15:06:14 2018  Type: P  Check: 1822  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDNLP GVEKK*


Protein Sequence for YPR086W_Y55 from Stanford:

YPR086W_Y55 [source=Stanford]  Length: 346  Tue Aug 21 15:06:15 2018  Type: P  Check: 2003  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITILCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_YJM339 from Stanford:

YPR086W_YJM339 [source=Stanford]  Length: 346  Tue Aug 21 15:06:15 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_YJM789 from Stanford:

YPR086W_YJM789 [source=Stanford]  Length: 346  Tue Aug 21 15:06:15 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_YPH499 from Stanford:

YPR086W_YPH499 [source=Stanford]  Length: 346  Tue Aug 21 15:06:15 2018  Type: P  Check: 1822  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDNLP GVEKK*


Protein Sequence for YPR086W_YPS128 from Stanford:

YPR086W_YPS128 [source=Stanford]  Length: 346  Tue Aug 21 15:06:15 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_YPS163 from Stanford:

YPR086W_YPS163 [source=Stanford]  Length: 346  Tue Aug 21 15:06:15 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_YS9 from Stanford:

YPR086W_YS9 [source=Stanford]  Length: 346  Tue Aug 21 15:06:15 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*


Protein Sequence for YPR086W_ZTW1 from Zhejiang:

YPR086W_ZTW1 [source=Zhejiang]  Length: 346  Tue Aug 21 15:06:15 2018  Type: P  Check: 2087  ..

       1  MMTRESIDKR AGRRGPNLNI VLTCPECKVY PPKIVERFSE GDVVCALCGL

      51  VLSDKLVDTR SEWRTFSNDD HNGDDPSRVG EASNPLLDGN NLSTRIGKGE

     101  TTDMRFTKEL NKAQGKNVMD KKDNEVQAAF AKITMLCDAA ELPKIVKDCA

     151  KEAYKLCHDE KTLKGKSMES IMAASILIGC RRAEVARTFK EIQSLIHVKT

     201  KEFGKTLNIM KNILRGKSED GFLKIDTDNM SGAQNLTYIP RFCSHLGLPM

     251  QVTTSAEYTA KKCKEIKEIA GKSPITIAVV SIYLNILLFQ IPITAAKVGQ

     301  TLQVTEGTIK SGYKILYEHR DKLVDPQLIA NGVVSLDSLP GVEKK*