ROX1/YPR065W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YPR065W_S288C   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_AWRI1631   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_AWRI796   
   --------------------------------------------------   
YPR065W_BC187   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_BY4741   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_BY4742   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_CEN.PK   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_D273-10B   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_DBVPG6044   1   MNPKSSIPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_EC1118   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_EC9-8   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_FL100   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_FY1679   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_FostersB   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_FostersO   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_JAY291   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_JK9-3d   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_K11   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_Kyokai7   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_L1528   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_LalvinQA23   
   --------------------------------------------------   
YPR065W_M22   
   --------------------------------------------------   
YPR065W_PW5   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_RM11-1a   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_RedStar   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_SEY6210   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_SK1   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_T7   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_UC5   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_UWOPS05_217_3   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_VL3   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_Vin13   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_W303   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_X2180-1A   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_Y55   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_YJM269   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_YJM339   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_YJM789   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_YPH499   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_YPS128   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_YPS163   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_YS9   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
YPR065W_ZTW1   1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIG   50
         

YPR065W_S288C   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_AWRI1631   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_AWRI796   
   --------------------------------------------------   
YPR065W_BC187   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_BY4741   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_BY4742   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_CEN.PK   51   TKWKGLQPEDKAHWENLAEKEKLEHKRKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_D273-10B   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_DBVPG6044   51   TKWKGLQPEDKAHWENLAKKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_EC1118   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_EC9-8   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_FL100   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_FY1679   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_FostersB   51   TKWKGLQPEDKAHWENLAKKEKLEHERKYPEYRYKPVRKSKKKQLLLKEI   100
YPR065W_FostersO   51   TKWKGLQPEDKAHWENLAKKEKLEHERKYPEYRYKPVRKSKKKQLLLKEI   100
YPR065W_JAY291   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_JK9-3d   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_K11   51   TKWKGLQPEDKAHWENLAKKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_Kyokai7   51   TKWKGLQPEDKAHWENLAKKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_L1528   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_LalvinQA23   
   --------------------------------------------------   
YPR065W_M22   
   --------------------------------------------------   
YPR065W_PW5   51   TKWKGLQPEDKAHWENLAKKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_RM11-1a   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_RedStar   51   TKWKGLQPEDKAHWENLAKKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_SEY6210   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_SK1   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_T7   51   TKWKGLQPEDKAHWENLAKKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_UC5   51   TKWKGLQPEDKAHWENLAKKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_UWOPS05_217_3   51   TKWKGLQPEDKAHWENLAKKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_VL3   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_Vin13   51   TKWKGLQPEDKXHWENLAXKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_W303   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_X2180-1A   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_Y55   51   TKWKGLQPEDKAHWENLAKKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_YJM269   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_YJM339   51   TKWKGLQPEDKAHWENLAKKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_YJM789   51   TKWKGLQPEDKAHWENLAKKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_YPH499   51   TKWKGLQPEDKAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_YPS128   51   TKWKGLQPEDKAHWENLAKKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_YPS163   51   TKWKGLQPEDKAHWENLAKKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_YS9   51   TKWKGLQPEDKAHWENLAKKEKLEHERKYPEYKYKPVRKSKKKQLLLKEI   100
YPR065W_ZTW1   51   TKWKGLQPEDKAHWENLAKKEKLEHERKYPEYRYKPVRKSKKKQLLLKEI   100
         

YPR065W_S288C   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_AWRI1631   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_AWRI796   1   --------------------------------MKRAHSLSPSSSVSSSNS   18
YPR065W_BC187   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_BY4741   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_BY4742   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_CEN.PK   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_D273-10B   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_DBVPG6044   101   EQQQQQQQQKEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   150
YPR065W_EC1118   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_EC9-8   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_FL100   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_FY1679   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_FostersB   101   EQRQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_FostersO   101   EQRQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_JAY291   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_JK9-3d   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_K11   101   EQRQQQQQQKEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   150
YPR065W_Kyokai7   101   EQRQQQQQQKEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   150
YPR065W_L1528   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_LalvinQA23   1   --------------------------------MKRAHSLSPSSSVSSSNS   18
YPR065W_M22   1   --------------------------------MKRAHSLSPSSSVSSSNS   18
YPR065W_PW5   101   EQQQQQQQQKEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   150
YPR065W_RM11-1a   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_RedStar   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_SEY6210   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_SK1   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_T7   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_UC5   101   EQRQQQQQQKEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   150
YPR065W_UWOPS05_217_3   101   EQQQQQQQQKEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   150
YPR065W_VL3   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_Vin13   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_W303   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_X2180-1A   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_Y55   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_YJM269   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_YJM339   101   EQRQQQQQQKEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   150
YPR065W_YJM789   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_YPH499   101   EQQQQQQQ-KEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_YPS128   101   EQQQQQQQQKEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   150
YPR065W_YPS163   101   EQQQQQQQQKEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   150
YPR065W_YS9   101   EQ-QQQQQQKEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   149
YPR065W_ZTW1   101   EQRQQQQQQKEQQQQKQSQPQLQQPFNNNIVLMKRAHSLSPSSSVSSSNS   150
         

YPR065W_S288C   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_AWRI1631   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_AWRI796   19   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   68
YPR065W_BC187   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_BY4741   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_BY4742   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_CEN.PK   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_D273-10B   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_DBVPG6044   151   YQFQLNNDLKRLPITSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   200
YPR065W_EC1118   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_EC9-8   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_FL100   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_FY1679   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_FostersB   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_FostersO   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_JAY291   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_JK9-3d   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_K11   151   YQFQLNNDLKRLPIPSVNTSNYTVSRSLSGLPLTHDKTARDLPQLSSQLN   200
YPR065W_Kyokai7   151   YQFQLNNDLKRLPIPSVNTSNYTVSRSLSGLPLTHDKTARDLPQLSSQLN   200
YPR065W_L1528   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_LalvinQA23   19   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   68
YPR065W_M22   19   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   68
YPR065W_PW5   151   YQFQLNNDLKRLPVPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   200
YPR065W_RM11-1a   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_RedStar   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_SEY6210   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_SK1   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_T7   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_UC5   151   YQFQLNNDLKRLPIPSVNTSNYTVSRSLSGLPLTHDKTARDLPQLSSQLN   200
YPR065W_UWOPS05_217_3   151   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   200
YPR065W_VL3   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_Vin13   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_W303   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_X2180-1A   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_Y55   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_YJM269   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_YJM339   151   YQFQLNNDLKRLPIPSVNTSNYTVSRSLSGLPLTHDKTARDLPQLSSQLN   200
YPR065W_YJM789   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLAHDKTARDLPQLSSQLN   199
YPR065W_YPH499   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_YPS128   151   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   200
YPR065W_YPS163   151   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   200
YPR065W_YS9   150   YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLN   199
YPR065W_ZTW1   151   YQFQLNNDLKRLPIPSVNTSNYTVSRSLSGLPLTHDKTARDLPQLSSQLN   200
         

YPR065W_S288C   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_AWRI1631   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_AWRI796   69   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   118
YPR065W_BC187   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_BY4741   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_BY4742   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_CEN.PK   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_D273-10B   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_DBVPG6044   201   YIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   250
YPR065W_EC1118   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTA   249
YPR065W_EC9-8   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_FL100   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_FY1679   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_FostersB   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_FostersO   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_JAY291   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_JK9-3d   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_K11   201   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   250
YPR065W_Kyokai7   201   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   250
YPR065W_L1528   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_LalvinQA23   69   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTX   118
YPR065W_M22   69   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   118
YPR065W_PW5   201   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   250
YPR065W_RM11-1a   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_RedStar   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_SEY6210   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_SK1   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_T7   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_UC5   201   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   250
YPR065W_UWOPS05_217_3   201   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   250
YPR065W_VL3   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTX   249
YPR065W_Vin13   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_W303   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_X2180-1A   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_Y55   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_YJM269   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_YJM339   201   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   250
YPR065W_YJM789   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNCSQTPVTT   249
YPR065W_YPH499   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_YPS128   201   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   250
YPR065W_YPS163   201   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   250
YPR065W_YS9   200   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   249
YPR065W_ZTW1   201   SIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIINNSSQTPVTT   250
         

YPR065W_S288C   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_AWRI1631   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_AWRI796   119   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   168
YPR065W_BC187   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_BY4741   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_BY4742   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_CEN.PK   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_D273-10B   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_DBVPG6044   251   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   300
YPR065W_EC1118   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_EC9-8   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_FL100   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_FY1679   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_FostersB   250   TTTSTTTATSSPGKFSSSPNSSVLENNR-LNSQQFKSIFTSPSITFSARF   298
YPR065W_FostersO   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSQQ-FKSIFTSPSITFSARF   298
YPR065W_JAY291   250   TTTSTTTATSSPGKFSSSPNSSVLENNRFNSINNSNQYLPPPLLPSLQDF   299
YPR065W_JK9-3d   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_K11   251   STTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   300
YPR065W_Kyokai7   251   STTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   300
YPR065W_L1528   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_LalvinQA23   119   TTTSTTTATSSPGKFSSSPNSSVLENNRXNSINNSKSIFTSPSITFSARF   168
YPR065W_M22   119   TTTSTTTATSSPGKFSSSPNSSVLENNRFNSINNSNQYLPPPLLPSLQDF   168
YPR065W_PW5   251   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   300
YPR065W_RM11-1a   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_RedStar   250   TTTSTTTATSSPGKFSSSPNSSVLENNRFNSINNSNQYLPPPLLPSLQDF   299
YPR065W_SEY6210   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_SK1   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_T7   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_UC5   251   STTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   300
YPR065W_UWOPS05_217_3   251   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   300
YPR065W_VL3   250   TTTSTNNCDIFSWEILLFSELLCTGEQQIKQYQQFKSIFTSPSITFSARF   299
YPR065W_Vin13   250   TTTSTTTATSSPGKFSSSPNSSVLENNRXNSINNSNQYLPPPLLPSLQDF   299
YPR065W_W303   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_X2180-1A   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_Y55   250   TTTSTTTATSSPGKFSSSPNSSVLENNRFNSINNSNQYLPPPLLPSLQDF   299
YPR065W_YJM269   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_YJM339   251   STTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   300
YPR065W_YJM789   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_YPH499   250   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_YPS128   251   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   300
YPR065W_YPS163   251   TTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   300
YPR065W_YS9   250   STTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   299
YPR065W_ZTW1   251   STTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDF   300
         

YPR065W_S288C   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_AWRI1631   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_AWRI796   169   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   218
YPR065W_BC187   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_BY4741   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_BY4742   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_CEN.PK   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_D273-10B   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_DBVPG6044   301   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   350
YPR065W_EC1118   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_EC9-8   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_FL100   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_FY1679   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_FostersB   299   STGSVPAAKADG------------TNLYCQTTVSHQGQSIVHNYPYASSH   336
YPR065W_FostersO   299   STGSVPAAKADG------------TNLYCQTTVSHQGQSIVHNYPYASSH   336
YPR065W_JAY291   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_JK9-3d   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_K11   301   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   350
YPR065W_Kyokai7   301   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   350
YPR065W_L1528   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_LalvinQA23   169   STGSVPAAKADG------------TNLYCQTTVSHQEQSIVHNYPYASSH   206
YPR065W_M22   169   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   218
YPR065W_PW5   301   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   350
YPR065W_RM11-1a   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_RedStar   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_SEY6210   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_SK1   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_T7   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_UC5   301   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   350
YPR065W_UWOPS05_217_3   301   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   350
YPR065W_VL3   300   STGSVPAAKADG------------TNLYCQTTVSHQEQSIVHNYPYASSH   337
YPR065W_Vin13   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_W303   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_X2180-1A   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_Y55   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_YJM269   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_YJM339   301   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   350
YPR065W_YJM789   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_YPH499   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_YPS128   301   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   350
YPR065W_YPS163   301   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   350
YPR065W_YS9   300   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   349
YPR065W_ZTW1   301   QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQ   350
         

YPR065W_S288C   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_AWRI1631   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_AWRI796   219   IINSSNTEVTAKTSLVSPK   237
YPR065W_BC187   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_BY4741   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_BY4742   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_CEN.PK   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_D273-10B   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_DBVPG6044   351   IIN----------------   353
YPR065W_EC1118   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_EC9-8   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_FL100   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_FY1679   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_FostersB   337   SSYTKPKHSSTSNYKLKQH   355
YPR065W_FostersO   337   SSYTKPKHSSTSNYKLKQH   355
YPR065W_JAY291   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_JK9-3d   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_K11   351   IINSSNTEVTAKTSLVSPK   369
YPR065W_Kyokai7   351   IINSSNTEVTAKTSLVSPK   369
YPR065W_L1528   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_LalvinQA23   207   SSYTKPKHSSTSNYKLKQH   225
YPR065W_M22   219   IINSSNTEVTAKTSLVSPK   237
YPR065W_PW5   351   IINSSNTEVTAKTSLVSPK   369
YPR065W_RM11-1a   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_RedStar   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_SEY6210   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_SK1   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_T7   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_UC5   351   IINSSNTEVTAKTSLVSPK   369
YPR065W_UWOPS05_217_3   351   IINSSNTEVTAKTSLVSPK   369
YPR065W_VL3   338   SSYTKPKHSSTSNYKLKQH   356
YPR065W_Vin13   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_W303   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_X2180-1A   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_Y55   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_YJM269   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_YJM339   351   IINSSNTEVTAKTSLVSPK   369
YPR065W_YJM789   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_YPH499   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_YPS128   351   IINSSNTEVTAKTSLVSPK   369
YPR065W_YPS163   351   IINSSNTEVTAKTSLVSPK   369
YPR065W_YS9   350   IINSSNTEVTAKTSLVSPK   368
YPR065W_ZTW1   351   IINSSNTEVTAKTSLVSPK   369
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YPR065W_S288C from SGD:

YPR065W_S288C [source=SGD]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4819  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_AWRI1631 from AWRI:

YPR065W_AWRI1631 [source=AWRI]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4819  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_AWRI796 from AWRI:

YPR065W_AWRI796 [source=AWRI]  Length: 238  Wed Feb 21 06:32:00 2018  Type: P  Check: 2589  ..

       1  MKRAHSLSPS SSVSSSNSYQ FQLNNDLKRL PIPSVNTSNY MVSRSLSGLP

      51  LTHDKTARDL PQLSSQLNSI PYYSAPHDPS TRHHYLNVAQ AQPRANSTPQ

     101  LPFISSIINN SSQTPVTTTT TSTTTATSSP GKFSSSPNSS VLENNRLNSI

     151  NNSNQYLPPP LLPSLQDFQL DQYQQLKQMG PTYIVKPLSH TRNNLLSTTT

     201  PTHHHIPHIP NQNIPLHQII NSSNTEVTAK TSLVSPK*

Protein Sequence for YPR065W_BC187 from Stanford:

YPR065W_BC187 [source=Stanford]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4819  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_BY4741 from Stanford:

YPR065W_BY4741 [source=Stanford]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4819  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_BY4742 from Stanford:

YPR065W_BY4742 [source=Stanford]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4819  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_CEN.PK from Stanford:

YPR065W_CEN.PK [source=Stanford]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4933  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHKRKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_D273-10B from Stanford:

YPR065W_D273-10B [source=Stanford]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4819  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_DBVPG6044 from Stanford:

YPR065W_DBVPG6044 [source=Stanford]  Length: 354  Wed Feb 21 06:32:00 2018  Type: P  Check: 1141  ..

       1  MNPKSSIPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAKK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQQK EQQQQKQSQP QLQQPFNNNI VLMKRAHSLS PSSSVSSSNS

     151  YQFQLNNDLK RLPITSVNTS NYMVSRSLSG LPLTHDKTAR DLPQLSSQLN

     201  YIPYYSAPHD PSTRHHYLNV AQAQPRANST PQLPFISSII NNSSQTPVTT

     251  TTTSTTTATS SPGKFSSSPN SSVLENNRLN SINNSNQYLP PPLLPSLQDF

     301  QLDQYQQLKQ MGPTYIVKPL SHTRNNLLST TTPTHHHIPH IPNQNIPLHQ

     351  IIN*

Protein Sequence for YPR065W_EC1118 from Genoscope:

YPR065W_EC1118 [source=Genoscope]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4420  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTAT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_EC9-8 from ASinica:

YPR065W_EC9-8 [source=ASinica]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4819  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_FL100 from Stanford:

YPR065W_FL100 [source=Stanford]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4819  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_FY1679 from Stanford:

YPR065W_FY1679 [source=Stanford]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4819  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_FostersB from AWRI:

YPR065W_FostersB [source=AWRI]  Length: 356  Wed Feb 21 06:32:00 2018  Type: P  Check: 5315  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAKK EKLEHERKYP EYRYKPVRKS KKKQLLLKEI

     101  EQRQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS QQFKSIFTSP SITFSARFST

     301  GSVPAAKADG TNLYCQTTVS HQGQSIVHNY PYASSHSSYT KPKHSSTSNY

     351  KLKQH*

Protein Sequence for YPR065W_FostersO from AWRI:

YPR065W_FostersO [source=AWRI]  Length: 356  Wed Feb 21 06:32:00 2018  Type: P  Check: 5315  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAKK EKLEHERKYP EYRYKPVRKS KKKQLLLKEI

     101  EQRQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS QQFKSIFTSP SITFSARFST

     301  GSVPAAKADG TNLYCQTTVS HQGQSIVHNY PYASSHSSYT KPKHSSTSNY

     351  KLKQH*

Protein Sequence for YPR065W_JAY291 from Duke:

YPR065W_JAY291 [source=Duke]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4519  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRFNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_JK9-3d from Stanford:

YPR065W_JK9-3d [source=Stanford]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4819  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_K11 from Stanford:

YPR065W_K11 [source=Stanford]  Length: 370  Wed Feb 21 06:32:00 2018  Type: P  Check: 6365  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAKK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQRQQQQQQK EQQQQKQSQP QLQQPFNNNI VLMKRAHSLS PSSSVSSSNS

     151  YQFQLNNDLK RLPIPSVNTS NYTVSRSLSG LPLTHDKTAR DLPQLSSQLN

     201  SIPYYSAPHD PSTRHHYLNV AQAQPRANST PQLPFISSII NNSSQTPVTT

     251  STTSTTTATS SPGKFSSSPN SSVLENNRLN SINNSNQYLP PPLLPSLQDF

     301  QLDQYQQLKQ MGPTYIVKPL SHTRNNLLST TTPTHHHIPH IPNQNIPLHQ

     351  IINSSNTEVT AKTSLVSPK*

Protein Sequence for YPR065W_Kyokai7 from NRIB:

YPR065W_Kyokai7 [source=NRIB]  Length: 370  Wed Feb 21 06:32:00 2018  Type: P  Check: 6365  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAKK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQRQQQQQQK EQQQQKQSQP QLQQPFNNNI VLMKRAHSLS PSSSVSSSNS

     151  YQFQLNNDLK RLPIPSVNTS NYTVSRSLSG LPLTHDKTAR DLPQLSSQLN

     201  SIPYYSAPHD PSTRHHYLNV AQAQPRANST PQLPFISSII NNSSQTPVTT

     251  STTSTTTATS SPGKFSSSPN SSVLENNRLN SINNSNQYLP PPLLPSLQDF

     301  QLDQYQQLKQ MGPTYIVKPL SHTRNNLLST TTPTHHHIPH IPNQNIPLHQ

     351  IINSSNTEVT AKTSLVSPK*

Protein Sequence for YPR065W_L1528 from Stanford:

YPR065W_L1528 [source=Stanford]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4819  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_LalvinQA23 from AWRI:

YPR065W_LalvinQA23 [source=AWRI]  Length: 226  Wed Feb 21 06:32:00 2018  Type: P  Check: 9695  ..

       1  MKRAHSLSPS SSVSSSNSYQ FQLNNDLKRL PIPSVNTSNY MVSRSLSGLP

      51  LTHDKTARDL PQLSSQLNSI PYYSAPHDPS TRHHYLNVAQ AQPRANSTPQ

     101  LPFISSIINN SSQTPVTXTT TSTTTATSSP GKFSSSPNSS VLENNRXNSI

     151  NNSKSIFTSP SITFSARFST GSVPAAKADG TNLYCQTTVS HQEQSIVHNY

     201  PYASSHSSYT KPKHSSTSNY KLKQH*

Protein Sequence for YPR065W_M22 from WashU:

YPR065W_M22 [source=WashU]  Length: 238  Wed Feb 21 06:32:00 2018  Type: P  Check: 2391  ..

       1  MKRAHSLSPS SSVSSSNSYQ FQLNNDLKRL PIPSVNTSNY MVSRSLSGLP

      51  LTHDKTARDL PQLSSQLNSI PYYSAPHDPS TRHHYLNVAQ AQPRANSTPQ

     101  LPFISSIINN SSQTPVTTTT TSTTTATSSP GKFSSSPNSS VLENNRFNSI

     151  NNSNQYLPPP LLPSLQDFQL DQYQQLKQMG PTYIVKPLSH TRNNLLSTTT

     201  PTHHHIPHIP NQNIPLHQII NSSNTEVTAK TSLVSPK*

Protein Sequence for YPR065W_PW5 from WashU:

YPR065W_PW5 [source=WashU]  Length: 370  Wed Feb 21 06:32:00 2018  Type: P  Check: 6978  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAKK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQQK EQQQQKQSQP QLQQPFNNNI VLMKRAHSLS PSSSVSSSNS

     151  YQFQLNNDLK RLPVPSVNTS NYMVSRSLSG LPLTHDKTAR DLPQLSSQLN

     201  SIPYYSAPHD PSTRHHYLNV AQAQPRANST PQLPFISSII NNSSQTPVTT

     251  TTTSTTTATS SPGKFSSSPN SSVLENNRLN SINNSNQYLP PPLLPSLQDF

     301  QLDQYQQLKQ MGPTYIVKPL SHTRNNLLST TTPTHHHIPH IPNQNIPLHQ

     351  IINSSNTEVT AKTSLVSPK*

Protein Sequence for YPR065W_RM11-1a from Stanford:

YPR065W_RM11-1a [source=Stanford]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4819  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_RedStar from Stanford:

YPR065W_RedStar [source=Stanford]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4591  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAKK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRFNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_SEY6210 from Stanford:

YPR065W_SEY6210 [source=Stanford]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4819  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_SK1 from Stanford:

YPR065W_SK1 [source=Stanford]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4819  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_T7 from WashU:

YPR065W_T7 [source=WashU]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4891  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAKK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_UC5 from WashU:

YPR065W_UC5 [source=WashU]  Length: 370  Wed Feb 21 06:32:00 2018  Type: P  Check: 6365  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAKK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQRQQQQQQK EQQQQKQSQP QLQQPFNNNI VLMKRAHSLS PSSSVSSSNS

     151  YQFQLNNDLK RLPIPSVNTS NYTVSRSLSG LPLTHDKTAR DLPQLSSQLN

     201  SIPYYSAPHD PSTRHHYLNV AQAQPRANST PQLPFISSII NNSSQTPVTT

     251  STTSTTTATS SPGKFSSSPN SSVLENNRLN SINNSNQYLP PPLLPSLQDF

     301  QLDQYQQLKQ MGPTYIVKPL SHTRNNLLST TTPTHHHIPH IPNQNIPLHQ

     351  IINSSNTEVT AKTSLVSPK*

Protein Sequence for YPR065W_UWOPS05_217_3 from Stanford:

YPR065W_UWOPS05_217_3 [source=Stanford]  Length: 370  Wed Feb 21 06:32:00 2018  Type: P  Check: 6328  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAKK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQQK EQQQQKQSQP QLQQPFNNNI VLMKRAHSLS PSSSVSSSNS

     151  YQFQLNNDLK RLPIPSVNTS NYMVSRSLSG LPLTHDKTAR DLPQLSSQLN

     201  SIPYYSAPHD PSTRHHYLNV AQAQPRANST PQLPFISSII NNSSQTPVTT

     251  TTTSTTTATS SPGKFSSSPN SSVLENNRLN SINNSNQYLP PPLLPSLQDF

     301  QLDQYQQLKQ MGPTYIVKPL SHTRNNLLST TTPTHHHIPH IPNQNIPLHQ

     351  IINSSNTEVT AKTSLVSPK*

Protein Sequence for YPR065W_VL3 from AWRI:

YPR065W_VL3 [source=AWRI]  Length: 357  Wed Feb 21 06:32:00 2018  Type: P  Check: 2433  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTXT

     251  TTSTNNCDIF SWEILLFSEL LCTGEQQIKQ YQQFKSIFTS PSITFSARFS

     301  TGSVPAAKAD GTNLYCQTTV SHQEQSIVHN YPYASSHSSY TKPKHSSTSN

     351  YKLKQH*

Protein Sequence for YPR065W_Vin13 from AWRI:

YPR065W_Vin13 [source=AWRI]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 5762  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KXHWENLAXK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRXNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_W303 from Stanford:

YPR065W_W303 [source=Stanford]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4819  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_X2180-1A from Stanford:

YPR065W_X2180-1A [source=Stanford]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4819  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_Y55 from Stanford:

YPR065W_Y55 [source=Stanford]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4591  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAKK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRFNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_YJM269 from WashU:

YPR065W_YJM269 [source=WashU]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4819  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_YJM339 from Stanford:

YPR065W_YJM339 [source=Stanford]  Length: 370  Wed Feb 21 06:32:00 2018  Type: P  Check: 6365  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAKK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQRQQQQQQK EQQQQKQSQP QLQQPFNNNI VLMKRAHSLS PSSSVSSSNS

     151  YQFQLNNDLK RLPIPSVNTS NYTVSRSLSG LPLTHDKTAR DLPQLSSQLN

     201  SIPYYSAPHD PSTRHHYLNV AQAQPRANST PQLPFISSII NNSSQTPVTT

     251  STTSTTTATS SPGKFSSSPN SSVLENNRLN SINNSNQYLP PPLLPSLQDF

     301  QLDQYQQLKQ MGPTYIVKPL SHTRNNLLST TTPTHHHIPH IPNQNIPLHQ

     351  IINSSNTEVT AKTSLVSPK*

Protein Sequence for YPR065W_YJM789 from Stanford:

YPR065W_YJM789 [source=Stanford]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4439  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAKK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLAHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NCSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_YPH499 from Stanford:

YPR065W_YPH499 [source=Stanford]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4819  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAEK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTT

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_YPS128 from Stanford:

YPR065W_YPS128 [source=Stanford]  Length: 370  Wed Feb 21 06:32:00 2018  Type: P  Check: 6328  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAKK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQQK EQQQQKQSQP QLQQPFNNNI VLMKRAHSLS PSSSVSSSNS

     151  YQFQLNNDLK RLPIPSVNTS NYMVSRSLSG LPLTHDKTAR DLPQLSSQLN

     201  SIPYYSAPHD PSTRHHYLNV AQAQPRANST PQLPFISSII NNSSQTPVTT

     251  TTTSTTTATS SPGKFSSSPN SSVLENNRLN SINNSNQYLP PPLLPSLQDF

     301  QLDQYQQLKQ MGPTYIVKPL SHTRNNLLST TTPTHHHIPH IPNQNIPLHQ

     351  IINSSNTEVT AKTSLVSPK*

Protein Sequence for YPR065W_YPS163 from Stanford:

YPR065W_YPS163 [source=Stanford]  Length: 370  Wed Feb 21 06:32:00 2018  Type: P  Check: 6328  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAKK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQQK EQQQQKQSQP QLQQPFNNNI VLMKRAHSLS PSSSVSSSNS

     151  YQFQLNNDLK RLPIPSVNTS NYMVSRSLSG LPLTHDKTAR DLPQLSSQLN

     201  SIPYYSAPHD PSTRHHYLNV AQAQPRANST PQLPFISSII NNSSQTPVTT

     251  TTTSTTTATS SPGKFSSSPN SSVLENNRLN SINNSNQYLP PPLLPSLQDF

     301  QLDQYQQLKQ MGPTYIVKPL SHTRNNLLST TTPTHHHIPH IPNQNIPLHQ

     351  IINSSNTEVT AKTSLVSPK*

Protein Sequence for YPR065W_YS9 from Stanford:

YPR065W_YS9 [source=Stanford]  Length: 369  Wed Feb 21 06:32:00 2018  Type: P  Check: 4869  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAKK EKLEHERKYP EYKYKPVRKS KKKQLLLKEI

     101  EQQQQQQQKE QQQQKQSQPQ LQQPFNNNIV LMKRAHSLSP SSSVSSSNSY

     151  QFQLNNDLKR LPIPSVNTSN YMVSRSLSGL PLTHDKTARD LPQLSSQLNS

     201  IPYYSAPHDP STRHHYLNVA QAQPRANSTP QLPFISSIIN NSSQTPVTTS

     251  TTSTTTATSS PGKFSSSPNS SVLENNRLNS INNSNQYLPP PLLPSLQDFQ

     301  LDQYQQLKQM GPTYIVKPLS HTRNNLLSTT TPTHHHIPHI PNQNIPLHQI

     351  INSSNTEVTA KTSLVSPK*

Protein Sequence for YPR065W_ZTW1 from Zhejiang:

YPR065W_ZTW1 [source=Zhejiang]  Length: 370  Wed Feb 21 06:32:00 2018  Type: P  Check: 6547  ..

       1  MNPKSSTPKI PRPKNAFILF RQHYHRILID EWTAQGVEIP HNSNISKIIG

      51  TKWKGLQPED KAHWENLAKK EKLEHERKYP EYRYKPVRKS KKKQLLLKEI

     101  EQRQQQQQQK EQQQQKQSQP QLQQPFNNNI VLMKRAHSLS PSSSVSSSNS

     151  YQFQLNNDLK RLPIPSVNTS NYTVSRSLSG LPLTHDKTAR DLPQLSSQLN

     201  SIPYYSAPHD PSTRHHYLNV AQAQPRANST PQLPFISSII NNSSQTPVTT

     251  STTSTTTATS SPGKFSSSPN SSVLENNRLN SINNSNQYLP PPLLPSLQDF

     301  QLDQYQQLKQ MGPTYIVKPL SHTRNNLLST TTPTHHHIPH IPNQNIPLHQ

     351  IINSSNTEVT AKTSLVSPK*