YPR010C-A S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YPR010C-A_S288C   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_AWRI1631   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_AWRI796   1   MRPAQLLLNTAKKNIWWLQNTRRINTVISRCWCSFMLWDILHI-------   43
YPR010C-A_BY4742   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_CBS7960   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_CEN.PK   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_CLIB215   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_CLIB324   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_DBVPG6044   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_EC1118   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_EC9-8   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_FL100   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_FY1679   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_FostersB   1   MRPAQLLLNTAKK-----------NNLVATKYPSN---------------   24
YPR010C-A_FostersO   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKIKNXR   50
YPR010C-A_JAY291   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_K11   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_Kyokai7   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_L1528   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_LalvinQA23   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_M22   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_RedStar   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_SEY6210   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_T73   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_UC5   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_UWOPS05_217_3   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_VL3   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_Vin13   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_W303   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_X2180-1A   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_Y10   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_YJM339   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_YPH499   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_YS9   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
YPR010C-A_ZTW1   1   MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDE   50
         

YPR010C-A_S288C   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_AWRI1631   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_AWRI796   
   ----------------------   
YPR010C-A_BY4742   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_CBS7960   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_CEN.PK   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_CLIB215   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_CLIB324   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_DBVPG6044   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_EC1118   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_EC9-8   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_FL100   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_FY1679   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_FostersB   
   ----------------------   
YPR010C-A_FostersO   51   DFEIDR----------------   56
YPR010C-A_JAY291   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_K11   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_Kyokai7   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_L1528   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_LalvinQA23   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_M22   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_RedStar   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_SEY6210   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_T73   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_UC5   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_UWOPS05_217_3   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_VL3   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_Vin13   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_W303   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_X2180-1A   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_Y10   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_YJM339   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_YPH499   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_YS9   51   TLRLTGNPELSSLDEVLAKDKD   72
YPR010C-A_ZTW1   51   TLRLTGNPELSSLDEVLAKDKD   72
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YPR010C-A_S288C from SGD:

YPR010C-A_S288C [source=SGD]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_AWRI1631 from AWRI:

YPR010C-A_AWRI1631 [source=AWRI]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_AWRI796 from AWRI:

YPR010C-A_AWRI796 [source=AWRI]  Length: 44  Tue Apr 24 09:03:20 2018  Type: P  Check: 4905  ..

       1  MRPAQLLLNT AKKNIWWLQN TRRINTVISR CWCSFMLWDI LHI*


Protein Sequence for YPR010C-A_BY4742 from Stanford:

YPR010C-A_BY4742 [source=Stanford]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_CBS7960 from WashU:

YPR010C-A_CBS7960 [source=WashU]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_CEN.PK from Stanford:

YPR010C-A_CEN.PK [source=Stanford]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_CLIB215 from WashU:

YPR010C-A_CLIB215 [source=WashU]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_CLIB324 from WashU:

YPR010C-A_CLIB324 [source=WashU]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_DBVPG6044 from Stanford:

YPR010C-A_DBVPG6044 [source=Stanford]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_EC1118 from Genoscope:

YPR010C-A_EC1118 [source=Genoscope]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_EC9-8 from ASinica:

YPR010C-A_EC9-8 [source=ASinica]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_FL100 from Stanford:

YPR010C-A_FL100 [source=Stanford]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_FY1679 from Stanford:

YPR010C-A_FY1679 [source=Stanford]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_FostersB from AWRI:

YPR010C-A_FostersB [source=AWRI]  Length: 25  Tue Apr 24 09:03:20 2018  Type: P  Check: 4540  ..

       1  MRPAQLLLNT AKKNNLVATK YPSN*

Protein Sequence for YPR010C-A_FostersO from AWRI:

YPR010C-A_FostersO [source=AWRI]  Length: 57  Tue Apr 24 09:03:20 2018  Type: P  Check: 4489  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKIKNXR

      51  DFEIDR*

Protein Sequence for YPR010C-A_JAY291 from Duke:

YPR010C-A_JAY291 [source=Duke]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_K11 from Stanford:

YPR010C-A_K11 [source=Stanford]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_Kyokai7 from NRIB:

YPR010C-A_Kyokai7 [source=NRIB]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_L1528 from Stanford:

YPR010C-A_L1528 [source=Stanford]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_LalvinQA23 from AWRI:

YPR010C-A_LalvinQA23 [source=AWRI]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_M22 from WashU:

YPR010C-A_M22 [source=WashU]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_RedStar from Stanford:

YPR010C-A_RedStar [source=Stanford]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_SEY6210 from Stanford:

YPR010C-A_SEY6210 [source=Stanford]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_T73 from WashU:

YPR010C-A_T73 [source=WashU]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_UC5 from WashU:

YPR010C-A_UC5 [source=WashU]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_UWOPS05_217_3 from Stanford:

YPR010C-A_UWOPS05_217_3 [source=Stanford]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_VL3 from AWRI:

YPR010C-A_VL3 [source=AWRI]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_Vin13 from AWRI:

YPR010C-A_Vin13 [source=AWRI]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_W303 from Stanford:

YPR010C-A_W303 [source=Stanford]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_X2180-1A from Stanford:

YPR010C-A_X2180-1A [source=Stanford]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_Y10 from WashU:

YPR010C-A_Y10 [source=WashU]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_YJM339 from Stanford:

YPR010C-A_YJM339 [source=Stanford]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_YPH499 from Stanford:

YPR010C-A_YPH499 [source=Stanford]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_YS9 from Stanford:

YPR010C-A_YS9 [source=Stanford]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*

Protein Sequence for YPR010C-A_ZTW1 from Zhejiang:

YPR010C-A_ZTW1 [source=Zhejiang]  Length: 73  Tue Apr 24 09:03:20 2018  Type: P  Check: 7361  ..

       1  MRPAQLLLNT AKKTSGGYKI PVELTPLFLA VGVALCSGTY FTYKKLRTDE

      51  TLRLTGNPEL SSLDEVLAKD KD*