YPR002C-A S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YPR002C-A_S288C   1   --------------------MKAIILGIQNILEVLLEDIGILKMESIFLH   30
YPR002C-A_AWRI796   1   -------------------------------------------MESIFLH   7
YPR002C-A_CBS7960   1   -------------------------------------------MESIFLH   7
YPR002C-A_CLIB215   1   -------------------------------------------MESIFLH   7
YPR002C-A_CLIB324   1   --------------------MKAIILGIQNILEVLLEDIGILKMESIFLH   30
YPR002C-A_CLIB382   1   -------------------------------------------MESIFLH   7
YPR002C-A_EC1118   1   -------------------------------------------MESIFLH   7
YPR002C-A_FostersB   1   ------MWVIRLICLGIPLLIKAIILGIQNILEVLLEDIGILKMESIFLH   44
YPR002C-A_FostersO   1   -------------------------------------------MESIFLH   7
YPR002C-A_LalvinQA23   1   -------------------------------------------MESIFLH   7
YPR002C-A_M22   1   MCTQHEKWVNDEIIVGIPLLIKAIILGIQNILEVLLEDIGILKMESIFLH   50
YPR002C-A_T7   1   -------------------------------------------MESIFLH   7
YPR002C-A_T73   1   -------------------------------------------MESIFLH   7
YPR002C-A_VL3   1   -------------------------------------------MESIFLH   7
YPR002C-A_Vin13   1   -------------------------------------------MESIFLH   7
YPR002C-A_Y10   1   -------------------------------------------MESIFLH   7
YPR002C-A_YJM789   1   -------------------------------------------MESIFLH   7
         

YPR002C-A_S288C   31   TNITNIPHSVLYVSLSYYIINPCTSASSNLDDSFS   65
YPR002C-A_AWRI796   8   TNITNIPHSVLYVSLSYYIINPCTSASSNLDDSFS   42
YPR002C-A_CBS7960   8   TNITNIPHSVLYVSLSYYIINPCTSASSNLDDSFS   42
YPR002C-A_CLIB215   8   TNITNIPHSVLYVSLSYYIINPCTSASSNLDDSFS   42
YPR002C-A_CLIB324   31   TNITNIPHSVLYVSLSYYIINPCTSASSNLDDSFS   65
YPR002C-A_CLIB382   8   TNITIIPHSVLYVSLSYYIINPCTSASSNFDDSFS   42
YPR002C-A_EC1118   8   TNITNIPHSVLYVSLSYYIINPCTSASSNLDDSFS   42
YPR002C-A_FostersB   45   TNITIIPHSVLYVSLSYYIINPCTXSFL-------   72
YPR002C-A_FostersO   8   TNITNIPHSVLYVSLSYYIINPCTSASSNLDDSFS   42
YPR002C-A_LalvinQA23   8   TNITNIPHSVLYVSLSYYIINPCTSASSNLDDSFS   42
YPR002C-A_M22   51   TNITIIPHSVLYVSLSYYIINPCTSASSNIDDSFS   85
YPR002C-A_T7   8   TNITIIPHSVLYVSLSYYIINPCTSASSNFDDSFS   42
YPR002C-A_T73   8   TNITNIPHSVLYVSLSYYIINPCTSASSNLDDSFS   42
YPR002C-A_VL3   8   TNITNIPHSVLYVSLSYYIINPCTSASSNLDDSFS   42
YPR002C-A_Vin13   8   TNITNIPHSVLYVSLSYYIINPCTSASSNLDDSFS   42
YPR002C-A_Y10   8   TNITIIPHSVLYVSLSYYIINPCTSASSNIDDSFS   42
YPR002C-A_YJM789   8   TNITIIPHSVLYVSLSYYIINPCTSASSNLDDSFS   42
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YPR002C-A_S288C from SGD:

YPR002C-A_S288C [source=SGD]  Length: 66  Sun Dec 10 21:41:22 2017  Type: P  Check: 1947  ..

       1  MKAIILGIQN ILEVLLEDIG ILKMESIFLH TNITNIPHSV LYVSLSYYII

      51  NPCTSASSNL DDSFS*

Protein Sequence for YPR002C-A_AWRI796 from AWRI:

YPR002C-A_AWRI796 [source=AWRI]  Length: 43  Sun Dec 10 21:41:22 2017  Type: P  Check: 2286  ..

       1  MESIFLHTNI TNIPHSVLYV SLSYYIINPC TSASSNLDDS FS*


Protein Sequence for YPR002C-A_CBS7960 from WashU:

YPR002C-A_CBS7960 [source=WashU]  Length: 43  Sun Dec 10 21:41:22 2017  Type: P  Check: 2286  ..

       1  MESIFLHTNI TNIPHSVLYV SLSYYIINPC TSASSNLDDS FS*


Protein Sequence for YPR002C-A_CLIB215 from WashU:

YPR002C-A_CLIB215 [source=WashU]  Length: 43  Sun Dec 10 21:41:22 2017  Type: P  Check: 2286  ..

       1  MESIFLHTNI TNIPHSVLYV SLSYYIINPC TSASSNLDDS FS*


Protein Sequence for YPR002C-A_CLIB324 from WashU:

YPR002C-A_CLIB324 [source=WashU]  Length: 66  Sun Dec 10 21:41:22 2017  Type: P  Check: 1947  ..

       1  MKAIILGIQN ILEVLLEDIG ILKMESIFLH TNITNIPHSV LYVSLSYYII

      51  NPCTSASSNL DDSFS*

Protein Sequence for YPR002C-A_CLIB382 from WashU:

YPR002C-A_CLIB382 [source=WashU]  Length: 43  Sun Dec 10 21:41:22 2017  Type: P  Check: 2004  ..

       1  MESIFLHTNI TIIPHSVLYV SLSYYIINPC TSASSNFDDS FS*


Protein Sequence for YPR002C-A_EC1118 from Genoscope:

YPR002C-A_EC1118 [source=Genoscope]  Length: 43  Sun Dec 10 21:41:22 2017  Type: P  Check: 2286  ..

       1  MESIFLHTNI TNIPHSVLYV SLSYYIINPC TSASSNLDDS FS*


Protein Sequence for YPR002C-A_FostersB from AWRI:

YPR002C-A_FostersB [source=AWRI]  Length: 73  Sun Dec 10 21:41:22 2017  Type: P  Check: 6532  ..

       1  MWVIRLICLG IPLLIKAIIL GIQNILEVLL EDIGILKMES IFLHTNITII

      51  PHSVLYVSLS YYIINPCTXS FL*

Protein Sequence for YPR002C-A_FostersO from AWRI:

YPR002C-A_FostersO [source=AWRI]  Length: 43  Sun Dec 10 21:41:22 2017  Type: P  Check: 2286  ..

       1  MESIFLHTNI TNIPHSVLYV SLSYYIINPC TSASSNLDDS FS*


Protein Sequence for YPR002C-A_LalvinQA23 from AWRI:

YPR002C-A_LalvinQA23 [source=AWRI]  Length: 43  Sun Dec 10 21:41:22 2017  Type: P  Check: 2286  ..

       1  MESIFLHTNI TNIPHSVLYV SLSYYIINPC TSASSNLDDS FS*


Protein Sequence for YPR002C-A_M22 from WashU:

YPR002C-A_M22 [source=WashU]  Length: 86  Sun Dec 10 21:41:22 2017  Type: P  Check: 6827  ..

       1  MCTQHEKWVN DEIIVGIPLL IKAIILGIQN ILEVLLEDIG ILKMESIFLH

      51  TNITIIPHSV LYVSLSYYII NPCTSASSNI DDSFS*

Protein Sequence for YPR002C-A_T7 from WashU:

YPR002C-A_T7 [source=WashU]  Length: 43  Sun Dec 10 21:41:22 2017  Type: P  Check: 2004  ..

       1  MESIFLHTNI TIIPHSVLYV SLSYYIINPC TSASSNFDDS FS*


Protein Sequence for YPR002C-A_T73 from WashU:

YPR002C-A_T73 [source=WashU]  Length: 43  Sun Dec 10 21:41:22 2017  Type: P  Check: 2286  ..

       1  MESIFLHTNI TNIPHSVLYV SLSYYIINPC TSASSNLDDS FS*


Protein Sequence for YPR002C-A_VL3 from AWRI:

YPR002C-A_VL3 [source=AWRI]  Length: 43  Sun Dec 10 21:41:22 2017  Type: P  Check: 2286  ..

       1  MESIFLHTNI TNIPHSVLYV SLSYYIINPC TSASSNLDDS FS*


Protein Sequence for YPR002C-A_Vin13 from AWRI:

YPR002C-A_Vin13 [source=AWRI]  Length: 43  Sun Dec 10 21:41:22 2017  Type: P  Check: 2286  ..

       1  MESIFLHTNI TNIPHSVLYV SLSYYIINPC TSASSNLDDS FS*


Protein Sequence for YPR002C-A_Y10 from WashU:

YPR002C-A_Y10 [source=WashU]  Length: 43  Sun Dec 10 21:41:22 2017  Type: P  Check: 2115  ..

       1  MESIFLHTNI TIIPHSVLYV SLSYYIINPC TSASSNIDDS FS*


Protein Sequence for YPR002C-A_YJM789 from Stanford:

YPR002C-A_YJM789 [source=Stanford]  Length: 43  Sun Dec 10 21:41:22 2017  Type: P  Check: 2226  ..

       1  MESIFLHTNI TIIPHSVLYV SLSYYIINPC TSASSNLDDS FS*