ALG5/YPL227C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YPL227C_S288C   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_AWRI1631   1   MRALRFLIENKNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_AWRI796   1   MRALRFLIENKNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_BC187   1   MRALRFLIENKNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_BY4741   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_BY4742   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_CBS7960   1   MRALRFLIENKNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_CEN.PK   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_D273-10B   1   MRALRFLIENKNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_DBVPG6044   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_EC1118   1   MRALRFLIENKNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_EC9-8   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_FL100   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_FY1679   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_FostersB   1   MRALRFLIENKNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_FostersO   1   MRALRFLIENKNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_JAY291   1   MRALRFLIENKNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_JK9-3d   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_K11   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_Kyokai7   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_LalvinQA23   1   MRALRFLIENKNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_PW5   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_RM11-1a   1   MRALRFLIENKNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_RedStar   1   MRALRFLIENKNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_SEY6210   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_SK1   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_T7   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_UC5   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_VL3   1   MRALRFLIENKNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_Vin13   
   --------------------------------------------------   
YPL227C_W303   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_X2180-1A   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_Y55   1   MRALRFLIENKNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_YJM269   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_YJM339   1   MRALRFLIENKNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_YJM789   1   MRALRFLIENKNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_YPH499   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_YPS128   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_YPS163   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_YS9   1   MRALRFLIENKNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
YPL227C_ZTW1   1   MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAI   50
         

YPL227C_S288C   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_AWRI1631   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_AWRI796   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_BC187   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_BY4741   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_BY4742   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_CBS7960   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_CEN.PK   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_D273-10B   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_DBVPG6044   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_EC1118   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_EC9-8   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_FL100   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_FY1679   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_FostersB   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_FostersO   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_JAY291   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_JK9-3d   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_K11   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_Kyokai7   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_LalvinQA23   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_PW5   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_RM11-1a   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_RedStar   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_SEY6210   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_SK1   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_T7   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_UC5   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_VL3   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_Vin13   
   --------------------------------------------------   
YPL227C_W303   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_X2180-1A   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_Y55   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_YJM269   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_YJM339   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_YJM789   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_YPH499   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_YPS128   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_YPS163   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_YS9   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
YPL227C_ZTW1   51   DEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLK   100
         

YPL227C_S288C   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_AWRI1631   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_AWRI796   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_BC187   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_BY4741   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_BY4742   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_CBS7960   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_CEN.PK   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_D273-10B   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_DBVPG6044   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_EC1118   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_EC9-8   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_FL100   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_FY1679   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_FostersB   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRVIKFSQNRGK   150
YPL227C_FostersO   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLXYEQFRVIKFSQNRGK   150
YPL227C_JAY291   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_JK9-3d   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_K11   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_Kyokai7   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_LalvinQA23   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_PW5   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_RM11-1a   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_RedStar   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_SEY6210   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_SK1   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_T7   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_UC5   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_VL3   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_Vin13   
   --------------------------------------------------   
YPL227C_W303   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_X2180-1A   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_Y55   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_YJM269   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_YJM339   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_YJM789   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_YPH499   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_YPS128   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_YPS163   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_YS9   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
YPL227C_ZTW1   101   EKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGK   150
         

YPL227C_S288C   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_AWRI1631   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDATSKIETSSTDLKTT   200
YPL227C_AWRI796   151   GGAVRQGFFTY---------------------------------------   161
YPL227C_BC187   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDATSKIETSSTDLKTT   200
YPL227C_BY4741   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_BY4742   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_CBS7960   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_CEN.PK   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_D273-10B   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDATSKIETSSTDLKTT   200
YPL227C_DBVPG6044   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_EC1118   151   GGAVRQGFLHIRGKYGLFADADGASKFSDLEKLIDAISKIETSSTDLKTT   200
YPL227C_EC9-8   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKL-----------------   183
YPL227C_FL100   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_FY1679   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_FostersB   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_FostersO   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_JAY291   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_JK9-3d   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_K11   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_Kyokai7   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_LalvinQA23   151   GGAVRQGFLHIRGKYGLFADADGASKFSDLEKLIDAISKIETSSTDLKTT   200
YPL227C_PW5   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_RM11-1a   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDATSKIETSSTDLKTT   200
YPL227C_RedStar   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_SEY6210   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_SK1   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_T7   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_UC5   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_VL3   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDATSKIETSSTDLKTT   200
YPL227C_Vin13   
   --------------------------------------------------   
YPL227C_W303   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_X2180-1A   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_Y55   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDATSKIETSSTDLKTT   200
YPL227C_YJM269   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_YJM339   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDATSKIETSSTDLKTT   200
YPL227C_YJM789   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDATSKIETSSTDLKTT   200
YPL227C_YPH499   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_YPS128   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_YPS163   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
YPL227C_YS9   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDATSKIETSSTDLKTT   200
YPL227C_ZTW1   151   GGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTT   200
         

YPL227C_S288C   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_AWRI1631   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_AWRI796   
   --------------------------------------------------   
YPL227C_BC187   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_BY4741   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_BY4742   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_CBS7960   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_CEN.PK   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_D273-10B   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_DBVPG6044   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_EC1118   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_EC9-8   
   --------------------------------------------------   
YPL227C_FL100   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_FY1679   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_FostersB   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_FostersO   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_JAY291   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_JK9-3d   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_K11   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_Kyokai7   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_LalvinQA23   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_PW5   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_RM11-1a   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_RedStar   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_SEY6210   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_SK1   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_T7   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_UC5   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_VL3   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_Vin13   1   -----------MVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   39
YPL227C_W303   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_X2180-1A   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_Y55   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_YJM269   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_YJM339   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_YJM789   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_YPH499   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_YPS128   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_YPS163   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_YS9   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
YPL227C_ZTW1   201   KPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCG   250
         

YPL227C_S288C   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_AWRI1631   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_AWRI796   
   --------------------------------------------------   
YPL227C_BC187   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_BY4741   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_BY4742   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_CBS7960   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_CEN.PK   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_D273-10B   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_DBVPG6044   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_EC1118   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_EC9-8   
   --------------------------------------------------   
YPL227C_FL100   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_FY1679   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_FostersB   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_FostersO   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_JAY291   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_JK9-3d   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_K11   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_Kyokai7   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_LalvinQA23   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_PW5   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_RM11-1a   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_RedStar   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_SEY6210   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_SK1   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_T7   251   FKLFNRAAILRIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_UC5   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_VL3   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_Vin13   40   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   89
YPL227C_W303   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_X2180-1A   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_Y55   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_YJM269   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_YJM339   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_YJM789   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_YPH499   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_YPS128   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_YPS163   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_YS9   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
YPL227C_ZTW1   251   FKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDG   300
         

YPL227C_S288C   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_AWRI1631   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_AWRI796   
   ----------------------------------   
YPL227C_BC187   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_BY4741   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_BY4742   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_CBS7960   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_CEN.PK   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_D273-10B   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_DBVPG6044   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_EC1118   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_EC9-8   
   ----------------------------------   
YPL227C_FL100   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDDKKC   334
YPL227C_FY1679   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_FostersB   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_FostersO   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_JAY291   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_JK9-3d   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_K11   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_Kyokai7   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_LalvinQA23   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_PW5   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_RM11-1a   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_RedStar   301   SKMVLAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_SEY6210   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_SK1   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_T7   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_UC5   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDDKKC   334
YPL227C_VL3   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_Vin13   90   SKMALAIDSIKNGERLGYYKNGLFIRDI------   117
YPL227C_W303   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_X2180-1A   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_Y55   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_YJM269   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_YJM339   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_YJM789   301   SKMVLAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_YPH499   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_YPS128   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_YPS163   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_YS9   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
YPL227C_ZTW1   301   SKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC   334
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YPL227C_S288C from SGD:

YPL227C_S288C [source=SGD]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 860  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_AWRI1631 from AWRI:

YPL227C_AWRI1631 [source=AWRI]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 959  ..

       1  MRALRFLIEN KNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDATSKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_AWRI796 from AWRI:

YPL227C_AWRI796 [source=AWRI]  Length: 162  Tue Sep 26 04:11:21 2017  Type: P  Check: 1279  ..

       1  MRALRFLIEN KNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFFT Y*

Protein Sequence for YPL227C_BC187 from Stanford:

YPL227C_BC187 [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 959  ..

       1  MRALRFLIEN KNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDATSKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_BY4741 from Stanford:

YPL227C_BY4741 [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 860  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_BY4742 from Stanford:

YPL227C_BY4742 [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 860  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_CBS7960 from WashU:

YPL227C_CBS7960 [source=WashU]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 783  ..

       1  MRALRFLIEN KNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_CEN.PK from Stanford:

YPL227C_CEN.PK [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 860  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_D273-10B from Stanford:

YPL227C_D273-10B [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 959  ..

       1  MRALRFLIEN KNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDATSKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_DBVPG6044 from Stanford:

YPL227C_DBVPG6044 [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 860  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_EC1118 from Genoscope:

YPL227C_EC1118 [source=Genoscope]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 693  ..

       1  MRALRFLIEN KNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDL EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_EC9-8 from ASinica:

YPL227C_EC9-8 [source=ASinica]  Length: 184  Tue Sep 26 04:11:21 2017  Type: P  Check: 3002  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKL*

Protein Sequence for YPL227C_FL100 from Stanford:

YPL227C_FL100 [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 400  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD DKKC*

Protein Sequence for YPL227C_FY1679 from Stanford:

YPL227C_FY1679 [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 860  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_FostersB from AWRI:

YPL227C_FostersB [source=AWRI]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 1134  ..

       1  MRALRFLIEN KNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR VIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_FostersO from AWRI:

YPL227C_FostersO [source=AWRI]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 1344  ..

       1  MRALRFLIEN KNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLXYEQFR VIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_JAY291 from Duke:

YPL227C_JAY291 [source=Duke]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 783  ..

       1  MRALRFLIEN KNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_JK9-3d from Stanford:

YPL227C_JK9-3d [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 860  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_K11 from Stanford:

YPL227C_K11 [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 860  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_Kyokai7 from NRIB:

YPL227C_Kyokai7 [source=NRIB]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 860  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_LalvinQA23 from AWRI:

YPL227C_LalvinQA23 [source=AWRI]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 693  ..

       1  MRALRFLIEN KNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDL EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_PW5 from WashU:

YPL227C_PW5 [source=WashU]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 860  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_RM11-1a from Stanford:

YPL227C_RM11-1a [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 959  ..

       1  MRALRFLIEN KNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDATSKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_RedStar from Stanford:

YPL227C_RedStar [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 1182  ..

       1  MRALRFLIEN KNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMVLAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_SEY6210 from Stanford:

YPL227C_SEY6210 [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 860  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_SK1 from Stanford:

YPL227C_SK1 [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 860  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_T7 from WashU:

YPL227C_T7 [source=WashU]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 1091  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL RIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_UC5 from WashU:

YPL227C_UC5 [source=WashU]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 400  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD DKKC*

Protein Sequence for YPL227C_VL3 from AWRI:

YPL227C_VL3 [source=AWRI]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 959  ..

       1  MRALRFLIEN KNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDATSKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_Vin13 from AWRI:

YPL227C_Vin13 [source=AWRI]  Length: 118  Tue Sep 26 04:11:21 2017  Type: P  Check: 9723  ..

       1  MVNTEAVIKR SMIRNCLMYG FHTLVFIFGI RSIKDTQCGF KLFNRAAILK

      51  IFPYLHTEGW IFDVEILILA IRKRIQIEEI PISWHEVDGS KMALAIDSIK

     101  NGERLGYYKN GLFIRDI*

Protein Sequence for YPL227C_W303 from Stanford:

YPL227C_W303 [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 860  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_X2180-1A from Stanford:

YPL227C_X2180-1A [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 860  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_Y55 from Stanford:

YPL227C_Y55 [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 959  ..

       1  MRALRFLIEN KNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDATSKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_YJM269 from WashU:

YPL227C_YJM269 [source=WashU]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 860  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_YJM339 from Stanford:

YPL227C_YJM339 [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 959  ..

       1  MRALRFLIEN KNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDATSKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_YJM789 from Stanford:

YPL227C_YJM789 [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 1358  ..

       1  MRALRFLIEN KNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDATSKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMVLAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_YPH499 from Stanford:

YPL227C_YPH499 [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 860  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_YPS128 from Stanford:

YPL227C_YPS128 [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 860  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_YPS163 from Stanford:

YPL227C_YPS163 [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 860  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_YS9 from Stanford:

YPL227C_YS9 [source=Stanford]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 959  ..

       1  MRALRFLIEN KNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDATSKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for YPL227C_ZTW1 from Zhejiang:

YPL227C_ZTW1 [source=Zhejiang]  Length: 335  Tue Sep 26 04:11:21 2017  Type: P  Check: 860  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*