RPL1A/YPL220W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YPL220W_S288C   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_AWRI1631   1   MXKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_AWRI796   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_BC187   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_BY4741   
   --------------------------------------------------   
YPL220W_BY4742   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_CBS7960   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_CEN.PK   
   --------------------------------------------------   
YPL220W_CLIB215   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_CLIB324   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_CLIB382   
   --------------------------------------------------   
YPL220W_D273-10B   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_DBVPG6044   
   --------------------------------------------------   
YPL220W_EC1118   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_FL100   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_FY1679   
   --------------------------------------------------   
YPL220W_FostersB   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_FostersO   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_JAY291   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_JK9-3d   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_K11   
   --------------------------------------------------   
YPL220W_Kyokai7   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_L1528   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_LalvinQA23   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_RM11-1a   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_RedStar   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_SEY6210   
   --------------------------------------------------   
YPL220W_SK1   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_UWOPS05_217_3   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_VL3   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_Vin13   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_W303   
   --------------------------------------------------   
YPL220W_X2180-1A   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_Y55   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_YJM269   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_YJM339   
   --------------------------------------------------   
YPL220W_YJM789   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_YPH499   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_YPS128   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_YPS163   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
YPL220W_YS9   
   --------------------------------------------------   
YPL220W_ZTW1   1   MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFS   50
         

YPL220W_S288C   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_AWRI1631   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_AWRI796   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_BC187   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_BY4741   1   ------------MSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   38
YPL220W_BY4742   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_CBS7960   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_CEN.PK   1   ------------MSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   38
YPL220W_CLIB215   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_CLIB324   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_CLIB382   1   ------------MSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   38
YPL220W_D273-10B   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_DBVPG6044   1   ------------MSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   38
YPL220W_EC1118   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_FL100   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_FY1679   1   ------------MSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   38
YPL220W_FostersB   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_FostersO   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_JAY291   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_JK9-3d   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_K11   1   ------------MSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   38
YPL220W_Kyokai7   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_L1528   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_LalvinQA23   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_RM11-1a   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_RedStar   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_SEY6210   1   ------------MSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   38
YPL220W_SK1   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_UWOPS05_217_3   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_VL3   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_Vin13   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_W303   1   ------------MSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   38
YPL220W_X2180-1A   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_Y55   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_YJM269   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_YJM339   1   ------------MSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   38
YPL220W_YJM789   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_YPH499   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_YPS128   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_YPS163   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
YPL220W_YS9   1   ------------MSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   38
YPL220W_ZTW1   51   GSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLI   100
         

YPL220W_S288C   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_AWRI1631   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_AWRI796   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_BC187   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_BY4741   39   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   88
YPL220W_BY4742   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_CBS7960   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_CEN.PK   39   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   88
YPL220W_CLIB215   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_CLIB324   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_CLIB382   39   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   88
YPL220W_D273-10B   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_DBVPG6044   39   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   88
YPL220W_EC1118   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_FL100   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_FY1679   39   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   88
YPL220W_FostersB   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_FostersO   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_JAY291   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_JK9-3d   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_K11   39   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   88
YPL220W_Kyokai7   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_L1528   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_LalvinQA23   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_RM11-1a   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_RedStar   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_SEY6210   39   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   88
YPL220W_SK1   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_UWOPS05_217_3   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_VL3   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_Vin13   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_W303   39   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   88
YPL220W_X2180-1A   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_Y55   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_YJM269   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_YJM339   39   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   88
YPL220W_YJM789   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_YPH499   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_YPS128   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_YPS163   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
YPL220W_YS9   39   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   88
YPL220W_ZTW1   101   KKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTD   150
         

YPL220W_S288C   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_AWRI1631   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_AWRI796   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_BC187   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_BY4741   89   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   124
YPL220W_BY4742   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_CBS7960   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_CEN.PK   89   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   124
YPL220W_CLIB215   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_CLIB324   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_CLIB382   89   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   124
YPL220W_D273-10B   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_DBVPG6044   89   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   124
YPL220W_EC1118   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_FL100   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_FY1679   89   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   124
YPL220W_FostersB   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_FostersO   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_JAY291   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_JK9-3d   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMXXXXXXXXXFSSQRT   200
YPL220W_K11   89   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   124
YPL220W_Kyokai7   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_L1528   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_LalvinQA23   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_RM11-1a   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_RedStar   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_SEY6210   89   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   124
YPL220W_SK1   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_UWOPS05_217_3   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_VL3   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_Vin13   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_W303   89   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   124
YPL220W_X2180-1A   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_Y55   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_YJM269   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_YJM339   89   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   124
YPL220W_YJM789   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_YPH499   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_YPS128   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_YPS163   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
YPL220W_YS9   89   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   124
YPL220W_ZTW1   151   VRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMS--------------   186
         

YPL220W_S288C   
   --------------------------------------------------   
YPL220W_AWRI1631   
   --------------------------------------------------   
YPL220W_AWRI796   
   --------------------------------------------------   
YPL220W_BC187   
   --------------------------------------------------   
YPL220W_BY4741   
   --------------------------------------------------   
YPL220W_BY4742   
   --------------------------------------------------   
YPL220W_CBS7960   
   --------------------------------------------------   
YPL220W_CEN.PK   
   --------------------------------------------------   
YPL220W_CLIB215   
   --------------------------------------------------   
YPL220W_CLIB324   
   --------------------------------------------------   
YPL220W_CLIB382   
   --------------------------------------------------   
YPL220W_D273-10B   
   --------------------------------------------------   
YPL220W_DBVPG6044   
   --------------------------------------------------   
YPL220W_EC1118   
   --------------------------------------------------   
YPL220W_FL100   
   --------------------------------------------------   
YPL220W_FY1679   
   --------------------------------------------------   
YPL220W_FostersB   
   --------------------------------------------------   
YPL220W_FostersO   
   --------------------------------------------------   
YPL220W_JAY291   
   --------------------------------------------------   
YPL220W_JK9-3d   201   RQGIVEVFQRNQEEKLLGNRRTTSRFEELMSICIFGDAFDVDRAKSCGVD   250
YPL220W_K11   
   --------------------------------------------------   
YPL220W_Kyokai7   
   --------------------------------------------------   
YPL220W_L1528   
   --------------------------------------------------   
YPL220W_LalvinQA23   
   --------------------------------------------------   
YPL220W_RM11-1a   
   --------------------------------------------------   
YPL220W_RedStar   
   --------------------------------------------------   
YPL220W_SEY6210   
   --------------------------------------------------   
YPL220W_SK1   
   --------------------------------------------------   
YPL220W_UWOPS05_217_3   
   --------------------------------------------------   
YPL220W_VL3   
   --------------------------------------------------   
YPL220W_Vin13   
   --------------------------------------------------   
YPL220W_W303   
   --------------------------------------------------   
YPL220W_X2180-1A   
   --------------------------------------------------   
YPL220W_Y55   
   --------------------------------------------------   
YPL220W_YJM269   
   --------------------------------------------------   
YPL220W_YJM339   
   --------------------------------------------------   
YPL220W_YJM789   
   --------------------------------------------------   
YPL220W_YPH499   
   --------------------------------------------------   
YPL220W_YPS128   
   --------------------------------------------------   
YPL220W_YPS163   
   --------------------------------------------------   
YPL220W_YS9   
   --------------------------------------------------   
YPL220W_ZTW1   
   --------------------------------------------------   
         

YPL220W_S288C   
   --------------------------------------------------   
YPL220W_AWRI1631   
   --------------------------------------------------   
YPL220W_AWRI796   
   --------------------------------------------------   
YPL220W_BC187   
   --------------------------------------------------   
YPL220W_BY4741   
   --------------------------------------------------   
YPL220W_BY4742   
   --------------------------------------------------   
YPL220W_CBS7960   
   --------------------------------------------------   
YPL220W_CEN.PK   
   --------------------------------------------------   
YPL220W_CLIB215   
   --------------------------------------------------   
YPL220W_CLIB324   
   --------------------------------------------------   
YPL220W_CLIB382   
   --------------------------------------------------   
YPL220W_D273-10B   
   --------------------------------------------------   
YPL220W_DBVPG6044   
   --------------------------------------------------   
YPL220W_EC1118   
   --------------------------------------------------   
YPL220W_FL100   
   --------------------------------------------------   
YPL220W_FY1679   
   --------------------------------------------------   
YPL220W_FostersB   
   --------------------------------------------------   
YPL220W_FostersO   
   --------------------------------------------------   
YPL220W_JAY291   
   --------------------------------------------------   
YPL220W_JK9-3d   251   AMSVDDLKKLNKNKKLIKKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGK   300
YPL220W_K11   
   --------------------------------------------------   
YPL220W_Kyokai7   
   --------------------------------------------------   
YPL220W_L1528   
   --------------------------------------------------   
YPL220W_LalvinQA23   
   --------------------------------------------------   
YPL220W_RM11-1a   
   --------------------------------------------------   
YPL220W_RedStar   
   --------------------------------------------------   
YPL220W_SEY6210   
   --------------------------------------------------   
YPL220W_SK1   
   --------------------------------------------------   
YPL220W_UWOPS05_217_3   
   --------------------------------------------------   
YPL220W_VL3   
   --------------------------------------------------   
YPL220W_Vin13   
   --------------------------------------------------   
YPL220W_W303   
   --------------------------------------------------   
YPL220W_X2180-1A   
   --------------------------------------------------   
YPL220W_Y55   
   --------------------------------------------------   
YPL220W_YJM269   
   --------------------------------------------------   
YPL220W_YJM339   
   --------------------------------------------------   
YPL220W_YJM789   
   --------------------------------------------------   
YPL220W_YPH499   
   --------------------------------------------------   
YPL220W_YPS128   
   --------------------------------------------------   
YPL220W_YPS163   
   --------------------------------------------------   
YPL220W_YS9   
   --------------------------------------------------   
YPL220W_ZTW1   
   --------------------------------------------------   
         

YPL220W_S288C   
   --------------------------------------------------   
YPL220W_AWRI1631   
   --------------------------------------------------   
YPL220W_AWRI796   
   --------------------------------------------------   
YPL220W_BC187   
   --------------------------------------------------   
YPL220W_BY4741   
   --------------------------------------------------   
YPL220W_BY4742   
   --------------------------------------------------   
YPL220W_CBS7960   
   --------------------------------------------------   
YPL220W_CEN.PK   
   --------------------------------------------------   
YPL220W_CLIB215   
   --------------------------------------------------   
YPL220W_CLIB324   
   --------------------------------------------------   
YPL220W_CLIB382   
   --------------------------------------------------   
YPL220W_D273-10B   
   --------------------------------------------------   
YPL220W_DBVPG6044   
   --------------------------------------------------   
YPL220W_EC1118   
   --------------------------------------------------   
YPL220W_FL100   
   --------------------------------------------------   
YPL220W_FY1679   
   --------------------------------------------------   
YPL220W_FostersB   
   --------------------------------------------------   
YPL220W_FostersO   
   --------------------------------------------------   
YPL220W_JAY291   
   --------------------------------------------------   
YPL220W_JK9-3d   301   FPTPVSHNDDLYGKVTDVRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQI   350
YPL220W_K11   
   --------------------------------------------------   
YPL220W_Kyokai7   
   --------------------------------------------------   
YPL220W_L1528   
   --------------------------------------------------   
YPL220W_LalvinQA23   
   --------------------------------------------------   
YPL220W_RM11-1a   
   --------------------------------------------------   
YPL220W_RedStar   
   --------------------------------------------------   
YPL220W_SEY6210   
   --------------------------------------------------   
YPL220W_SK1   
   --------------------------------------------------   
YPL220W_UWOPS05_217_3   
   --------------------------------------------------   
YPL220W_VL3   
   --------------------------------------------------   
YPL220W_Vin13   
   --------------------------------------------------   
YPL220W_W303   
   --------------------------------------------------   
YPL220W_X2180-1A   
   --------------------------------------------------   
YPL220W_Y55   
   --------------------------------------------------   
YPL220W_YJM269   
   --------------------------------------------------   
YPL220W_YJM339   
   --------------------------------------------------   
YPL220W_YJM789   
   --------------------------------------------------   
YPL220W_YPH499   
   --------------------------------------------------   
YPL220W_YPS128   
   --------------------------------------------------   
YPL220W_YPS163   
   --------------------------------------------------   
YPL220W_YS9   
   --------------------------------------------------   
YPL220W_ZTW1   
   --------------------------------------------------   
         

YPL220W_S288C   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_AWRI1631   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_AWRI796   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_BC187   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_BY4741   125   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   155
YPL220W_BY4742   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_CBS7960   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_CEN.PK   125   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   155
YPL220W_CLIB215   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_CLIB324   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_CLIB382   125   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   155
YPL220W_D273-10B   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_DBVPG6044   125   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   155
YPL220W_EC1118   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_FL100   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_FY1679   125   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   155
YPL220W_FostersB   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_FostersO   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_JAY291   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_JK9-3d   351   LMSVNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   384
YPL220W_K11   125   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   155
YPL220W_Kyokai7   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_L1528   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_LalvinQA23   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_RM11-1a   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_RedStar   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_SEY6210   125   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLYMSKITSSQVREHVKEL   171
YPL220W_SK1   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_UWOPS05_217_3   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_VL3   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_Vin13   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_W303   125   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   155
YPL220W_X2180-1A   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_Y55   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_YJM269   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_YJM339   125   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   155
YPL220W_YJM789   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_YPH499   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_YPS128   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_YPS163   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
YPL220W_YS9   125   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   155
YPL220W_ZTW1   187   ---VNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY----------------   217
         

YPL220W_S288C   
   --------------------------------------------------   
YPL220W_AWRI1631   
   --------------------------------------------------   
YPL220W_AWRI796   
   --------------------------------------------------   
YPL220W_BC187   
   --------------------------------------------------   
YPL220W_BY4741   
   --------------------------------------------------   
YPL220W_BY4742   
   --------------------------------------------------   
YPL220W_CBS7960   
   --------------------------------------------------   
YPL220W_CEN.PK   
   --------------------------------------------------   
YPL220W_CLIB215   
   --------------------------------------------------   
YPL220W_CLIB324   
   --------------------------------------------------   
YPL220W_CLIB382   
   --------------------------------------------------   
YPL220W_D273-10B   
   --------------------------------------------------   
YPL220W_DBVPG6044   
   --------------------------------------------------   
YPL220W_EC1118   
   --------------------------------------------------   
YPL220W_FL100   
   --------------------------------------------------   
YPL220W_FY1679   
   --------------------------------------------------   
YPL220W_FostersB   
   --------------------------------------------------   
YPL220W_FostersO   
   --------------------------------------------------   
YPL220W_JAY291   
   --------------------------------------------------   
YPL220W_JK9-3d   
   --------------------------------------------------   
YPL220W_K11   
   --------------------------------------------------   
YPL220W_Kyokai7   
   --------------------------------------------------   
YPL220W_L1528   
   --------------------------------------------------   
YPL220W_LalvinQA23   
   --------------------------------------------------   
YPL220W_RM11-1a   
   --------------------------------------------------   
YPL220W_RedStar   
   --------------------------------------------------   
YPL220W_SEY6210   172   LKYSNETKKRNFLETVELQVGLKNYDPQRDKRFSGSLKLPNCPRPNMSIC   221
YPL220W_SK1   
   --------------------------------------------------   
YPL220W_UWOPS05_217_3   
   --------------------------------------------------   
YPL220W_VL3   
   --------------------------------------------------   
YPL220W_Vin13   
   --------------------------------------------------   
YPL220W_W303   
   --------------------------------------------------   
YPL220W_X2180-1A   
   --------------------------------------------------   
YPL220W_Y55   
   --------------------------------------------------   
YPL220W_YJM269   
   --------------------------------------------------   
YPL220W_YJM339   
   --------------------------------------------------   
YPL220W_YJM789   
   --------------------------------------------------   
YPL220W_YPH499   
   --------------------------------------------------   
YPL220W_YPS128   
   --------------------------------------------------   
YPL220W_YPS163   
   --------------------------------------------------   
YPL220W_YS9   
   --------------------------------------------------   
YPL220W_ZTW1   
   --------------------------------------------------   
         

YPL220W_S288C   
   --------------------------------------------------   
YPL220W_AWRI1631   
   --------------------------------------------------   
YPL220W_AWRI796   
   --------------------------------------------------   
YPL220W_BC187   
   --------------------------------------------------   
YPL220W_BY4741   
   --------------------------------------------------   
YPL220W_BY4742   
   --------------------------------------------------   
YPL220W_CBS7960   
   --------------------------------------------------   
YPL220W_CEN.PK   
   --------------------------------------------------   
YPL220W_CLIB215   
   --------------------------------------------------   
YPL220W_CLIB324   
   --------------------------------------------------   
YPL220W_CLIB382   
   --------------------------------------------------   
YPL220W_D273-10B   
   --------------------------------------------------   
YPL220W_DBVPG6044   
   --------------------------------------------------   
YPL220W_EC1118   
   --------------------------------------------------   
YPL220W_FL100   
   --------------------------------------------------   
YPL220W_FY1679   
   --------------------------------------------------   
YPL220W_FostersB   
   --------------------------------------------------   
YPL220W_FostersO   
   --------------------------------------------------   
YPL220W_JAY291   
   --------------------------------------------------   
YPL220W_JK9-3d   
   --------------------------------------------------   
YPL220W_K11   
   --------------------------------------------------   
YPL220W_Kyokai7   
   --------------------------------------------------   
YPL220W_L1528   
   --------------------------------------------------   
YPL220W_LalvinQA23   
   --------------------------------------------------   
YPL220W_RM11-1a   
   --------------------------------------------------   
YPL220W_RedStar   
   --------------------------------------------------   
YPL220W_SEY6210   222   IFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKLSKKYNAFIASEVL   271
YPL220W_SK1   
   --------------------------------------------------   
YPL220W_UWOPS05_217_3   
   --------------------------------------------------   
YPL220W_VL3   
   --------------------------------------------------   
YPL220W_Vin13   
   --------------------------------------------------   
YPL220W_W303   
   --------------------------------------------------   
YPL220W_X2180-1A   
   --------------------------------------------------   
YPL220W_Y55   
   --------------------------------------------------   
YPL220W_YJM269   
   --------------------------------------------------   
YPL220W_YJM339   
   --------------------------------------------------   
YPL220W_YJM789   
   --------------------------------------------------   
YPL220W_YPH499   
   --------------------------------------------------   
YPL220W_YPS128   
   --------------------------------------------------   
YPL220W_YPS163   
   --------------------------------------------------   
YPL220W_YS9   
   --------------------------------------------------   
YPL220W_ZTW1   
   --------------------------------------------------   
         

YPL220W_S288C   
   --------------------------------------------------   
YPL220W_AWRI1631   
   --------------------------------------------------   
YPL220W_AWRI796   
   --------------------------------------------------   
YPL220W_BC187   
   --------------------------------------------------   
YPL220W_BY4741   
   --------------------------------------------------   
YPL220W_BY4742   
   --------------------------------------------------   
YPL220W_CBS7960   
   --------------------------------------------------   
YPL220W_CEN.PK   
   --------------------------------------------------   
YPL220W_CLIB215   
   --------------------------------------------------   
YPL220W_CLIB324   
   --------------------------------------------------   
YPL220W_CLIB382   
   --------------------------------------------------   
YPL220W_D273-10B   
   --------------------------------------------------   
YPL220W_DBVPG6044   
   --------------------------------------------------   
YPL220W_EC1118   
   --------------------------------------------------   
YPL220W_FL100   
   --------------------------------------------------   
YPL220W_FY1679   
   --------------------------------------------------   
YPL220W_FostersB   
   --------------------------------------------------   
YPL220W_FostersO   
   --------------------------------------------------   
YPL220W_JAY291   
   --------------------------------------------------   
YPL220W_JK9-3d   
   --------------------------------------------------   
YPL220W_K11   
   --------------------------------------------------   
YPL220W_Kyokai7   
   --------------------------------------------------   
YPL220W_L1528   
   --------------------------------------------------   
YPL220W_LalvinQA23   
   --------------------------------------------------   
YPL220W_RM11-1a   
   --------------------------------------------------   
YPL220W_RedStar   
   --------------------------------------------------   
YPL220W_SEY6210   272   IKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTDVRSTIKFQLKKVLCLA   321
YPL220W_SK1   
   --------------------------------------------------   
YPL220W_UWOPS05_217_3   
   --------------------------------------------------   
YPL220W_VL3   
   --------------------------------------------------   
YPL220W_Vin13   
   --------------------------------------------------   
YPL220W_W303   
   --------------------------------------------------   
YPL220W_X2180-1A   
   --------------------------------------------------   
YPL220W_Y55   
   --------------------------------------------------   
YPL220W_YJM269   
   --------------------------------------------------   
YPL220W_YJM339   
   --------------------------------------------------   
YPL220W_YJM789   
   --------------------------------------------------   
YPL220W_YPH499   
   --------------------------------------------------   
YPL220W_YPS128   
   --------------------------------------------------   
YPL220W_YPS163   
   --------------------------------------------------   
YPL220W_YS9   
   --------------------------------------------------   
YPL220W_ZTW1   
   --------------------------------------------------   
         

YPL220W_S288C   
   --------------------------------------------------   
YPL220W_AWRI1631   
   --------------------------------------------------   
YPL220W_AWRI796   
   --------------------------------------------------   
YPL220W_BC187   
   --------------------------------------------------   
YPL220W_BY4741   
   --------------------------------------------------   
YPL220W_BY4742   
   --------------------------------------------------   
YPL220W_CBS7960   
   --------------------------------------------------   
YPL220W_CEN.PK   
   --------------------------------------------------   
YPL220W_CLIB215   
   --------------------------------------------------   
YPL220W_CLIB324   
   --------------------------------------------------   
YPL220W_CLIB382   
   --------------------------------------------------   
YPL220W_D273-10B   
   --------------------------------------------------   
YPL220W_DBVPG6044   
   --------------------------------------------------   
YPL220W_EC1118   
   --------------------------------------------------   
YPL220W_FL100   
   --------------------------------------------------   
YPL220W_FY1679   
   --------------------------------------------------   
YPL220W_FostersB   
   --------------------------------------------------   
YPL220W_FostersO   
   ------------------------------