PEP4/YPL154C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YPL154C_S288C   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_AWRI796   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_BC187   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_BY4741   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_BY4742   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_CBS7960   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_CEN.PK   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_CLIB215   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_CLIB324   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_D273-10B   1   MFSLKALLPLALLLVSANQVTAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_EC1118   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_EC9-8   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_FL100   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_FY1679   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_FostersB   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_FostersO   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_JAY291   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_JK9-3d   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_K11   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_Kyokai7   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_L1528   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_LalvinQA23   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_PW5   1   MFSLKALLPLALLLVSANQVTAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_RM11-1a   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_RedStar   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_SEY6210   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_SK1   1   MFSLKALLPLALLLVSANQVTAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_T7   1   MFSLKALLPLALLLVSANQVTAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_UC5   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_UWOPS05_217_3   1   MFSLKALLPLALLLVSANQVTAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_VL3   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_Vin13   1   -------------------------------------MKEVTFEQHLAHL   13
YPL154C_W303   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_X2180-1A   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_Y55   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_YJM269   1   MFSLKALLPLALLLVSANQVTAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_YJM339   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_YJM789   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_YPH499   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_YPS128   1   MFSLKALLPLALLLVSANQVTAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_YPS163   1   MFSLKALLPLALLLVSANQVTAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_YS9   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
YPL154C_ZTW1   1   MFSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEMKEVTFEQHLAHL   50
         

YPL154C_S288C   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_AWRI796   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_BC187   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_BY4741   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_BY4742   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_CBS7960   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_CEN.PK   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_CLIB215   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_CLIB324   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_D273-10B   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_EC1118   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_EC9-8   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_FL100   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_FY1679   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_FostersB   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_FostersO   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTKLLERTILH-------   93
YPL154C_JAY291   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_JK9-3d   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_K11   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_Kyokai7   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_L1528   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_LalvinQA23   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_PW5   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_RM11-1a   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_RedStar   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_SEY6210   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_SK1   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_T7   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_UC5   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_UWOPS05_217_3   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_VL3   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_Vin13   14   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   63
YPL154C_W303   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_X2180-1A   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_Y55   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_YJM269   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_YJM339   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_YJM789   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_YPH499   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_YPS128   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_YPS163   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_YS9   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
YPL154C_ZTW1   51   GQKYLTQFEKANPEVVFSREHPFFTEGGHDVPLTNYLNAQYYTDITLGTP   100
         

YPL154C_S288C   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_AWRI796   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_BC187   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_BY4741   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_BY4742   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_CBS7960   101   PQNFKVILDTGSSNLWVPR-------------------------------   119
YPL154C_CEN.PK   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_CLIB215   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_CLIB324   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_D273-10B   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_EC1118   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_EC9-8   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_FL100   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_FY1679   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_FostersB   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_FostersO   
   --------------------------------------------------   
YPL154C_JAY291   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_JK9-3d   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_K11   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_Kyokai7   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_L1528   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_LalvinQA23   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_PW5   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_RM11-1a   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_RedStar   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_SEY6210   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_SK1   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_T7   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_UC5   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_UWOPS05_217_3   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_VL3   101   PQNFKVILDTGSSNLWVPSNECGSLACXLHSKYDHEASSSYKANGTEFAI   150
YPL154C_Vin13   64   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   113
YPL154C_W303   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_X2180-1A   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_Y55   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_YJM269   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_YJM339   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_YJM789   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_YPH499   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_YPS128   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_YPS163   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_YS9   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
YPL154C_ZTW1   101   PQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI   150
         

YPL154C_S288C   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_AWRI796   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_BC187   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_BY4741   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_BY4742   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_CBS7960   
   --------------------------------------------------   
YPL154C_CEN.PK   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_CLIB215   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_CLIB324   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_D273-10B   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_EC1118   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_EC9-8   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_FL100   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_FY1679   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_FostersB   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_FostersO   
   --------------------------------------------------   
YPL154C_JAY291   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_JK9-3d   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_K11   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_Kyokai7   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_L1528   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_LalvinQA23   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_PW5   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_RM11-1a   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_RedStar   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAGATSEPGLTFAFGKFDGILGL   200
YPL154C_SEY6210   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_SK1   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_T7   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_UC5   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_UWOPS05_217_3   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_VL3   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_Vin13   114   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   163
YPL154C_W303   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_X2180-1A   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_Y55   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_YJM269   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_YJM339   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_YJM789   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_YPH499   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_YPS128   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_YPS163   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_YS9   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
YPL154C_ZTW1   151   QYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL   200
         

YPL154C_S288C   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_AWRI796   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_BC187   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_BY4741   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_BY4742   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_CBS7960   
   --------------------------------------------------   
YPL154C_CEN.PK   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_CLIB215   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_CLIB324   201   GYDTIQASLFDHDFIKLQS-------------------------------   219
YPL154C_D273-10B   201   GYDTISVDKGVPPFYNAIQQDLLDEKKFAFHLGDTSKDTENGGEATFGGI   250
YPL154C_EC1118   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_EC9-8   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_FL100   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_FY1679   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_FostersB   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_FostersO   
   --------------------------------------------------   
YPL154C_JAY291   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_JK9-3d   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_K11   201   GYDTISVDKVVPPFYNAIQQDLLDEKKFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_Kyokai7   201   GYDTISVDKVVPPFYNAIQQDLLDEKKFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_L1528   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_LalvinQA23   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_PW5   201   GYDTISVDKVVPPFYNAIQQDLLDEKKFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_RM11-1a   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_RedStar   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_SEY6210   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_SK1   201   GYDTISVDKVVPPFYNAIQQDLLDEKKFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_T7   201   GYDTISVDKVVPPFYNAIQQDLLDEKKFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_UC5   201   GYDTISVDKVVPPFYNAIQQDLLDEKKFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_UWOPS05_217_3   201   GYDTISVDKVVPPFYNAIQQDLLDEKKFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_VL3   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_Vin13   164   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   213
YPL154C_W303   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_X2180-1A   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_Y55   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_YJM269   201   GYDTISVDKVVPPFYNAIQQDLLDEKKFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_YJM339   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_YJM789   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_YPH499   201   GYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_YPS128   201   GYDTISVDKVVPPFYNAIQQDLLDEKKFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_YPS163   201   GYDTISVDKVVPPFYNAIQQDLLDEKKFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_YS9   201   GYDTISVDKVVPPFYNAIQQDLLDEKKFAFYLGDTSKDTENGGEATFGGI   250
YPL154C_ZTW1   201   GYDTISVDKVVPPFYNAIQQDLLDEKKFAFYLGDTSKDTENGGEATFGGI   250
         

YPL154C_S288C   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_AWRI796   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_BC187   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_BY4741   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_BY4742   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_CBS7960   
   --------------------------------------------------   
YPL154C_CEN.PK   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_CLIB215   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_CLIB324   
   --------------------------------------------------   
YPL154C_D273-10B   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_EC1118   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_EC9-8   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_FL100   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_FY1679   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_FostersB   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_FostersO   
   --------------------------------------------------   
YPL154C_JAY291   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_JK9-3d   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_K11   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_Kyokai7   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_L1528   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_LalvinQA23   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_PW5   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_RM11-1a   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_RedStar   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_SEY6210   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_SK1   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_T7   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_UC5   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_UWOPS05_217_3   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_VL3   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_Vin13   214   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   263
YPL154C_W303   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_X2180-1A   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_Y55   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_YJM269   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_YJM339   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_YJM789   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_YPH499   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_YPS128   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_YPS163   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_YS9   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
YPL154C_ZTW1   251   DESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHGAAIDTGTSLI   300
         

YPL154C_S288C   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_AWRI796   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_BC187   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_BY4741   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_BY4742   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_CBS7960   
   --------------------------------------------------   
YPL154C_CEN.PK   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_CLIB215   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_CLIB324   
   --------------------------------------------------   
YPL154C_D273-10B   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_EC1118   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_EC9-8   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_FL100   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_FY1679   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_FostersB   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_FostersO   
   --------------------------------------------------   
YPL154C_JAY291   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNLNGYNFTIGP   350
YPL154C_JK9-3d   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_K11   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_Kyokai7   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_L1528   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_LalvinQA23   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_PW5   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_RM11-1a   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_RedStar   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_SEY6210   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_SK1   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_T7   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_UC5   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_UWOPS05_217_3   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGFNFTIGP   350
YPL154C_VL3   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_Vin13   264   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   313
YPL154C_W303   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_X2180-1A   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_Y55   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_YJM269   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_YJM339   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_YJM789   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_YPH499   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_YPS128   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_YPS163   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_YS9   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
YPL154C_ZTW1   301   TLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGP   350
         

YPL154C_S288C   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_AWRI796   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_BC187   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_BY4741   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_BY4742   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_CBS7960   
   --------------------------------------------------   
YPL154C_CEN.PK   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_CLIB215   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_CLIB324   
   --------------------------------------------------   
YPL154C_D273-10B   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_EC1118   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_EC9-8   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_FL100   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_FY1679   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_FostersB   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_FostersO   
   --------------------------------------------------   
YPL154C_JAY291   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_JK9-3d   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_K11   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_Kyokai7   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_L1528   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_LalvinQA23   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_PW5   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_RM11-1a   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_RedStar   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_SEY6210   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_SK1   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_T7   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_UC5   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_UWOPS05_217_3   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_VL3   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_Vin13   314   YDYTLEXSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   363
YPL154C_W303   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_X2180-1A   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_Y55   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_YJM269   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_YJM339   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_YJM789   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_YPH499   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_YPS128   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_YPS163   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_YS9   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
YPL154C_ZTW1   351   YDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVG   400
         

YPL154C_S288C   401   LAKAI   405
YPL154C_AWRI796   401   LAKAI   405
YPL154C_BC187   401   LAKAI   405
YPL154C_BY4741   401   LAKAI   405
YPL154C_BY4742   401   LAKAI   405
YPL154C_CBS7960   
   -----   
YPL154C_CEN.PK   401   LAKAI   405
YPL154C_CLIB215   401   LAKAI   405
YPL154C_CLIB324   
   -----   
YPL154C_D273-10B   401   LAKAI   405
YPL154C_EC1118   401   LAKAI   405
YPL154C_EC9-8   401   LAKAI   405
YPL154C_FL100   401   LAKAI   405
YPL154C_FY1679   401   LAKAI   405
YPL154C_FostersB   401   LAKAI   405
YPL154C_FostersO   
   -----   
YPL154C_JAY291   401   LAKAI   405
YPL154C_JK9-3d   401   LAKAI   405
YPL154C_K11   401   LAKAI   405
YPL154C_Kyokai7   401   LAKAI   405
YPL154C_L1528   401   LAKAI   405
YPL154C_LalvinQA23   401   LAKAI   405
YPL154C_PW5   401   LAKAI   405
YPL154C_RM11-1a   401   LAKAI   405
YPL154C_RedStar   401   LAKAI   405
YPL154C_SEY6210   401   LAKAI   405
YPL154C_SK1   401   LAKAI   405
YPL154C_T7   401   LVKAI   405
YPL154C_UC5   401   LAKAI   405
YPL154C_UWOPS05_217_3   401   LAKAI   405
YPL154C_VL3   401   LAKAI   405
YPL154C_Vin13   364   LAKAI   368
YPL154C_W303   401   LAKAI   405
YPL154C_X2180-1A   401   LAKAI   405
YPL154C_Y55   401   LAKAI   405
YPL154C_YJM269   401   LAKAI   405
YPL154C_YJM339   401   LAKAI   405
YPL154C_YJM789   401   LAKAI   405
YPL154C_YPH499   401   LAKAI   405
YPL154C_YPS128   401   LAKAI   405
YPL154C_YPS163   401   LAKAI   405
YPL154C_YS9   401   LAKAI   405
YPL154C_ZTW1   401   LAKAI   405
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YPL154C_S288C from SGD:

YPL154C_S288C [source=SGD]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_AWRI796 from AWRI:

YPL154C_AWRI796 [source=AWRI]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_BC187 from Stanford:

YPL154C_BC187 [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_BY4741 from Stanford:

YPL154C_BY4741 [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_BY4742 from Stanford:

YPL154C_BY4742 [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_CBS7960 from WashU:

YPL154C_CBS7960 [source=WashU]  Length: 120  Sat Sep 23 16:52:28 2017  Type: P  Check: 5325  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPR*

Protein Sequence for YPL154C_CEN.PK from Stanford:

YPL154C_CEN.PK [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_CLIB215 from WashU:

YPL154C_CLIB215 [source=WashU]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_CLIB324 from WashU:

YPL154C_CLIB324 [source=WashU]  Length: 220  Sat Sep 23 16:52:28 2017  Type: P  Check: 8794  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTIQASLF DHDFIKLQS*

Protein Sequence for YPL154C_D273-10B from Stanford:

YPL154C_D273-10B [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 9911  ..

       1  MFSLKALLPL ALLLVSANQV TAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKG VPPFYNAIQQ DLLDEKKFAF HLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_EC1118 from Genoscope:

YPL154C_EC1118 [source=Genoscope]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_EC9-8 from ASinica:

YPL154C_EC9-8 [source=ASinica]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_FL100 from Stanford:

YPL154C_FL100 [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_FY1679 from Stanford:

YPL154C_FY1679 [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_FostersB from AWRI:

YPL154C_FostersB [source=AWRI]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_FostersO from AWRI:

YPL154C_FostersO [source=AWRI]  Length: 94  Sat Sep 23 16:52:28 2017  Type: P  Check: 7512  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTKLLERT ILH*


Protein Sequence for YPL154C_JAY291 from Duke:

YPL154C_JAY291 [source=Duke]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 876  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN LNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_JK9-3d from Stanford:

YPL154C_JK9-3d [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_K11 from Stanford:

YPL154C_K11 [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 148  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKKFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_Kyokai7 from NRIB:

YPL154C_Kyokai7 [source=NRIB]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 148  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKKFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_L1528 from Stanford:

YPL154C_L1528 [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_LalvinQA23 from AWRI:

YPL154C_LalvinQA23 [source=AWRI]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_PW5 from WashU:

YPL154C_PW5 [source=WashU]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 547  ..

       1  MFSLKALLPL ALLLVSANQV TAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKKFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_RM11-1a from Stanford:

YPL154C_RM11-1a [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_RedStar from Stanford:

YPL154C_RedStar [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 558  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAG ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_SEY6210 from Stanford:

YPL154C_SEY6210 [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_SK1 from Stanford:

YPL154C_SK1 [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 547  ..

       1  MFSLKALLPL ALLLVSANQV TAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKKFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_T7 from WashU:

YPL154C_T7 [source=WashU]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 610  ..

       1  MFSLKALLPL ALLLVSANQV TAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKKFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LVKAI*

Protein Sequence for YPL154C_UC5 from WashU:

YPL154C_UC5 [source=WashU]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 148  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKKFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_UWOPS05_217_3 from Stanford:

YPL154C_UWOPS05_217_3 [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 509  ..

       1  MFSLKALLPL ALLLVSANQV TAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKKFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGFNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_VL3 from AWRI:

YPL154C_VL3 [source=AWRI]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 792  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACXLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_Vin13 from AWRI:

YPL154C_Vin13 [source=AWRI]  Length: 369  Sat Sep 23 16:52:28 2017  Type: P  Check: 6221  ..

       1  MKEVTFEQHL AHLGQKYLTQ FEKANPEVVF SREHPFFTEG GHDVPLTNYL

      51  NAQYYTDITL GTPPQNFKVI LDTGSSNLWV PSNECGSLAC FLHSKYDHEA

     101  SSSYKANGTE FAIQYGTGSL EGYISQDTLS IGDLTIPKQD FAEATSEPGL

     151  TFAFGKFDGI LGLGYDTISV DKVVPPFYNA IQQDLLDEKR FAFYLGDTSK

     201  DTENGGEATF GGIDESKFKG DITWLPVRRK AYWEVKFEGI GLGDEYAELE

     251  SHGAAIDTGT SLITLPSGLA EMINAEIGAK KGWTGQYTLD CNTRDNLPDL

     301  IFNFNGYNFT IGPYDYTLEX SGSCISAITP MDFPEPVGPL AIVGDAFLRK

     351  YYSIYDLGNN AVGLAKAI*

Protein Sequence for YPL154C_W303 from Stanford:

YPL154C_W303 [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_X2180-1A from Stanford:

YPL154C_X2180-1A [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_Y55 from Stanford:

YPL154C_Y55 [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_YJM269 from WashU:

YPL154C_YJM269 [source=WashU]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 547  ..

       1  MFSLKALLPL ALLLVSANQV TAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKKFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_YJM339 from Stanford:

YPL154C_YJM339 [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_YJM789 from Stanford:

YPL154C_YJM789 [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_YPH499 from Stanford:

YPL154C_YPH499 [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 540  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKRFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_YPS128 from Stanford:

YPL154C_YPS128 [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 547  ..

       1  MFSLKALLPL ALLLVSANQV TAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKKFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_YPS163 from Stanford:

YPL154C_YPS163 [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 547  ..

       1  MFSLKALLPL ALLLVSANQV TAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKKFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_YS9 from Stanford:

YPL154C_YS9 [source=Stanford]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 148  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKKFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*

Protein Sequence for YPL154C_ZTW1 from Zhejiang:

YPL154C_ZTW1 [source=Zhejiang]  Length: 406  Sat Sep 23 16:52:28 2017  Type: P  Check: 148  ..

       1  MFSLKALLPL ALLLVSANQV AAKVHKAKIY KHELSDEMKE VTFEQHLAHL

      51  GQKYLTQFEK ANPEVVFSRE HPFFTEGGHD VPLTNYLNAQ YYTDITLGTP

     101  PQNFKVILDT GSSNLWVPSN ECGSLACFLH SKYDHEASSS YKANGTEFAI

     151  QYGTGSLEGY ISQDTLSIGD LTIPKQDFAE ATSEPGLTFA FGKFDGILGL

     201  GYDTISVDKV VPPFYNAIQQ DLLDEKKFAF YLGDTSKDTE NGGEATFGGI

     251  DESKFKGDIT WLPVRRKAYW EVKFEGIGLG DEYAELESHG AAIDTGTSLI

     301  TLPSGLAEMI NAEIGAKKGW TGQYTLDCNT RDNLPDLIFN FNGYNFTIGP

     351  YDYTLEVSGS CISAITPMDF PEPVGPLAIV GDAFLRKYYS IYDLGNNAVG

     401  LAKAI*