HHO1/YPL127C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YPL127C_S288C   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_AWRI1631   
   --------------------------------------------------   
YPL127C_AWRI796   1   MLGSEGSNYNTTKATWHPRNPLPRPQVRARSLQPAKARRNQLPRPLSRKP   50
YPL127C_BC187   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_BY4741   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_BY4742   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_CBS7960   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_CEN.PK   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_CLIB324   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_D273-10B   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_DBVPG6044   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_EC1118   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_EC9-8   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_FL100   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_FY1679   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_FostersB   1   MLGSEGSNYNTTKXTWHPRNPLPRPQVRARSLQPAKARRNQLPRPLSRKP   50
YPL127C_FostersO   1   ---------------MAPKKSTTKTTSKGKKPAXSKGKEKSTSKAAIKKT   35
YPL127C_JAY291   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_JK9-3d   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_K11   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_Kyokai7   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_L1528   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_LalvinQA23   1   MLGSEGSNYNTTKATWHPRNPLPRPQVRARSLQPAKARRNQLPRPLSRKP   50
YPL127C_M22   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_PW5   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_RM11-1a   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_RedStar   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_SEY6210   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_SK1   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_T7   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_T73   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_UC5   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_UWOPS05_217_3   1   ---------------MAPKKSITKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_VL3   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_Vin13   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_W303   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_X2180-1A   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_Y10   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_Y55   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_YJM269   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_YJM339   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_YJM789   1   ---------------MAPKKSITKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_YPH499   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_YPS128   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_YPS163   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_YS9   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
YPL127C_ZTW1   1   ---------------MAPKKSTTKTTSKGKKPATSKGKEKSTSKAAIKKT   35
         

YPL127C_S288C   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_AWRI1631   
   --------------------------------------------------   
YPL127C_AWRI796   51   RQKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   100
YPL127C_BC187   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_BY4741   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_BY4742   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_CBS7960   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_CEN.PK   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_CLIB324   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_D273-10B   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_DBVPG6044   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_EC1118   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_EC9-8   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_FL100   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_FY1679   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_FostersB   51   RQKKEEASSKSYRELIIEGLTALKERKGSSRPXLKKFIKENYPIVGSASN   100
YPL127C_FostersO   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_JAY291   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_JK9-3d   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_K11   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_Kyokai7   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_L1528   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_LalvinQA23   51   RQKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   100
YPL127C_M22   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_PW5   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_RM11-1a   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_RedStar   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_SEY6210   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_SK1   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_T7   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_T73   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_UC5   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_UWOPS05_217_3   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_VL3   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_Vin13   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_W303   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_X2180-1A   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_Y10   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_Y55   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_YJM269   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_YJM339   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_YJM789   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_YPH499   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_YPS128   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_YPS163   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_YS9   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
YPL127C_ZTW1   36   TAKKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASN   85
         

YPL127C_S288C   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_AWRI1631   
   --------------------------------------------------   
YPL127C_AWRI796   101   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   150
YPL127C_BC187   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_BY4741   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_BY4742   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_CBS7960   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_CEN.PK   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_CLIB324   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_D273-10B   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_DBVPG6044   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_EC1118   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_EC9-8   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_FL100   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_FY1679   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_FostersB   101   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKXKQ   150
YPL127C_FostersO   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEXSPKXKQ   135
YPL127C_JAY291   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_JK9-3d   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_K11   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_Kyokai7   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_L1528   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_LalvinQA23   101   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   150
YPL127C_M22   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_PW5   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_RM11-1a   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_RedStar   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_SEY6210   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_SK1   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_T7   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_T73   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_UC5   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_UWOPS05_217_3   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKK   135
YPL127C_VL3   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_Vin13   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_W303   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_X2180-1A   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_Y10   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_Y55   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_YJM269   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_YJM339   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_YJM789   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKK   135
YPL127C_YPH499   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_YPS128   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_YPS163   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_YS9   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
YPL127C_ZTW1   86   FDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKKKSPEVKKEKEVSPKPKQ   135
         

YPL127C_S288C   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_AWRI1631   1   -----------------------------------------------MIL   3
YPL127C_AWRI796   151   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   200
YPL127C_BC187   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_BY4741   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_BY4742   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_CBS7960   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_CEN.PK   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_CLIB324   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_D273-10B   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_DBVPG6044   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_EC1118   136   AATSVSATASKAKAASTKLAPKKVVKK-NRLLLPPRRHLRLLH-------   177
YPL127C_EC9-8   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_FL100   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_FY1679   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_FostersB   151   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   200
YPL127C_FostersO   136   AATSVSATASKAKAASTKLAPKKVVKKKIAYCYRQEGIFAFFIDLQGNDP   185
YPL127C_JAY291   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_JK9-3d   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_K11   136   AATSVSATASKAKAASTKLAPKKVVKKKLPTVTAKKASSPSSLTYKEMIL   185
YPL127C_Kyokai7   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_L1528   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_LalvinQA23   151   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   200
YPL127C_M22   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_PW5   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_RM11-1a   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_RedStar   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_SEY6210   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_SK1   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_T7   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_T73   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_UC5   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_UWOPS05_217_3   136   AATSVSVTASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_VL3   136   AATSVSATASKAKAASTKLAPKKVVXKKIAYCYRQEGIFAFFIDLQGNDP   185
YPL127C_Vin13   136   AATSVSATASKAKAASTKLAPKKVSRKKNRLLLPPRRXLRLLH-------   178
YPL127C_W303   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_X2180-1A   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_Y10   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_Y55   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_YJM269   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_YJM339   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_YJM789   136   ATTSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_YPH499   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_YPS128   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_YPS163   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_YS9   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
YPL127C_ZTW1   136   AATSVSATASKAKAASTKLAPKKVVKKKSPTVTAKKASSPSSLTYKEMIL   185
         

YPL127C_S288C   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_AWRI1631   4   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   53
YPL127C_AWRI796   201   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   250
YPL127C_BC187   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_BY4741   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_BY4742   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_CBS7960   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_CEN.PK   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_CLIB324   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_D273-10B   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_DBVPG6044   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_EC1118   
   --------------------------------------------------   
YPL127C_EC9-8   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_FL100   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_FY1679   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_FostersB   201   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   250
YPL127C_FostersO   
   --------------------------------------------------   
YPL127C_JAY291   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_JK9-3d   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_K11   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_Kyokai7   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_L1528   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_LalvinQA23   201   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   250
YPL127C_M22   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_PW5   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_RM11-1a   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_RedStar   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_SEY6210   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_SK1   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_T7   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_T73   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_UC5   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_UWOPS05_217_3   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_VL3   
   --------------------------------------------------   
YPL127C_Vin13   
   --------------------------------------------------   
YPL127C_W303   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_X2180-1A   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_Y10   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_Y55   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_YJM269   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_YJM339   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_YJM789   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_YPH499   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_YPS128   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_YPS163   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_YS9   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
YPL127C_ZTW1   186   KSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENG   235
         

YPL127C_S288C   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_AWRI1631   54   ELVQPKGPSGIIKLNKKKVKLST   76
YPL127C_AWRI796   251   ELVQPKGPSGIIKLNKKKVKLST   273
YPL127C_BC187   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_BY4741   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_BY4742   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_CBS7960   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_CEN.PK   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_CLIB324   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_D273-10B   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_DBVPG6044   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_EC1118   
   -----------------------   
YPL127C_EC9-8   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_FL100   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_FY1679   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_FostersB   251   ELVQPKGPSGIIKLNKKKVKLST   273
YPL127C_FostersO   
   -----------------------   
YPL127C_JAY291   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_JK9-3d   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_K11   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_Kyokai7   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_L1528   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_LalvinQA23   251   ELVQPKGPSGIIKLNKKKVKLST   273
YPL127C_M22   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_PW5   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_RM11-1a   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_RedStar   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_SEY6210   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_SK1   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_T7   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_T73   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_UC5   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_UWOPS05_217_3   236   ELVQPKGPSGIIKLNKKKVKLFT   258
YPL127C_VL3   
   -----------------------   
YPL127C_Vin13   
   -----------------------   
YPL127C_W303   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_X2180-1A   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_Y10   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_Y55   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_YJM269   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_YJM339   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_YJM789   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_YPH499   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_YPS128   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_YPS163   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_YS9   236   ELVQPKGPSGIIKLNKKKVKLST   258
YPL127C_ZTW1   236   ELVQPKGPSGIIKLNKKKVKLST   258
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YPL127C_S288C from SGD:

YPL127C_S288C [source=SGD]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_AWRI1631 from AWRI:

YPL127C_AWRI1631 [source=AWRI]  Length: 77  Sun Feb 25 15:28:05 2018  Type: P  Check: 2506  ..

       1  MILKSMPQLN DGKGSSRIVL KKYVKDTFSS KLKTSSNFDY LFNSAIKKCV

      51  ENGELVQPKG PSGIIKLNKK KVKLST*

Protein Sequence for YPL127C_AWRI796 from AWRI:

YPL127C_AWRI796 [source=AWRI]  Length: 274  Sun Feb 25 15:28:05 2018  Type: P  Check: 7931  ..

       1  MLGSEGSNYN TTKATWHPRN PLPRPQVRAR SLQPAKARRN QLPRPLSRKP

      51  RQKKEEASSK SYRELIIEGL TALKERKGSS RPALKKFIKE NYPIVGSASN

     101  FDLYFNNAIK KGVEAGDFEQ PKGPAGAVKL AKKKSPEVKK EKEVSPKPKQ

     151  AATSVSATAS KAKAASTKLA PKKVVKKKSP TVTAKKASSP SSLTYKEMIL

     201  KSMPQLNDGK GSSRIVLKKY VKDTFSSKLK TSSNFDYLFN SAIKKCVENG

     251  ELVQPKGPSG IIKLNKKKVK LST*

Protein Sequence for YPL127C_BC187 from Stanford:

YPL127C_BC187 [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_BY4741 from Stanford:

YPL127C_BY4741 [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_BY4742 from Stanford:

YPL127C_BY4742 [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_CBS7960 from WashU:

YPL127C_CBS7960 [source=WashU]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_CEN.PK from Stanford:

YPL127C_CEN.PK [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_CLIB324 from WashU:

YPL127C_CLIB324 [source=WashU]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_D273-10B from Stanford:

YPL127C_D273-10B [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_DBVPG6044 from Stanford:

YPL127C_DBVPG6044 [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_EC1118 from Genoscope:

YPL127C_EC1118 [source=Genoscope]  Length: 178  Sun Feb 25 15:28:05 2018  Type: P  Check: 6977  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKNRLLLPPR RHLRLLH*

Protein Sequence for YPL127C_EC9-8 from ASinica:

YPL127C_EC9-8 [source=ASinica]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_FL100 from Stanford:

YPL127C_FL100 [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_FY1679 from Stanford:

YPL127C_FY1679 [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_FostersB from AWRI:

YPL127C_FostersB [source=AWRI]  Length: 274  Sun Feb 25 15:28:05 2018  Type: P  Check: 9123  ..

       1  MLGSEGSNYN TTKXTWHPRN PLPRPQVRAR SLQPAKARRN QLPRPLSRKP

      51  RQKKEEASSK SYRELIIEGL TALKERKGSS RPXLKKFIKE NYPIVGSASN

     101  FDLYFNNAIK KGVEAGDFEQ PKGPAGAVKL AKKKSPEVKK EKEVSPKXKQ

     151  AATSVSATAS KAKAASTKLA PKKVVKKKSP TVTAKKASSP SSLTYKEMIL

     201  KSMPQLNDGK GSSRIVLKKY VKDTFSSKLK TSSNFDYLFN SAIKKCVENG

     251  ELVQPKGPSG IIKLNKKKVK LST*

Protein Sequence for YPL127C_FostersO from AWRI:

YPL127C_FostersO [source=AWRI]  Length: 186  Sun Feb 25 15:28:05 2018  Type: P  Check: 2552  ..

       1  MAPKKSTTKT TSKGKKPAXS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEXS PKXKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKIAYCYRQ EGIFAFFIDL QGNDP*

Protein Sequence for YPL127C_JAY291 from Duke:

YPL127C_JAY291 [source=Duke]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_JK9-3d from Stanford:

YPL127C_JK9-3d [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_K11 from Stanford:

YPL127C_K11 [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9519  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKLPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_Kyokai7 from NRIB:

YPL127C_Kyokai7 [source=NRIB]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_L1528 from Stanford:

YPL127C_L1528 [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_LalvinQA23 from AWRI:

YPL127C_LalvinQA23 [source=AWRI]  Length: 274  Sun Feb 25 15:28:05 2018  Type: P  Check: 7931  ..

       1  MLGSEGSNYN TTKATWHPRN PLPRPQVRAR SLQPAKARRN QLPRPLSRKP

      51  RQKKEEASSK SYRELIIEGL TALKERKGSS RPALKKFIKE NYPIVGSASN

     101  FDLYFNNAIK KGVEAGDFEQ PKGPAGAVKL AKKKSPEVKK EKEVSPKPKQ

     151  AATSVSATAS KAKAASTKLA PKKVVKKKSP TVTAKKASSP SSLTYKEMIL

     201  KSMPQLNDGK GSSRIVLKKY VKDTFSSKLK TSSNFDYLFN SAIKKCVENG

     251  ELVQPKGPSG IIKLNKKKVK LST*

Protein Sequence for YPL127C_M22 from WashU:

YPL127C_M22 [source=WashU]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_PW5 from WashU:

YPL127C_PW5 [source=WashU]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_RM11-1a from Stanford:

YPL127C_RM11-1a [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_RedStar from Stanford:

YPL127C_RedStar [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_SEY6210 from Stanford:

YPL127C_SEY6210 [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_SK1 from Stanford:

YPL127C_SK1 [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_T7 from WashU:

YPL127C_T7 [source=WashU]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_T73 from WashU:

YPL127C_T73 [source=WashU]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_UC5 from WashU:

YPL127C_UC5 [source=WashU]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_UWOPS05_217_3 from Stanford:

YPL127C_UWOPS05_217_3 [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9877  ..

       1  MAPKKSITKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKKAATSV SVTASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLFT*

Protein Sequence for YPL127C_VL3 from AWRI:

YPL127C_VL3 [source=AWRI]  Length: 186  Sun Feb 25 15:28:05 2018  Type: P  Check: 2905  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV XKKIAYCYRQ EGIFAFFIDL QGNDP*

Protein Sequence for YPL127C_Vin13 from AWRI:

YPL127C_Vin13 [source=AWRI]  Length: 179  Sun Feb 25 15:28:05 2018  Type: P  Check: 7409  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVS RKKNRLLLPP RRXLRLLH*

Protein Sequence for YPL127C_W303 from Stanford:

YPL127C_W303 [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_X2180-1A from Stanford:

YPL127C_X2180-1A [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_Y10 from WashU:

YPL127C_Y10 [source=WashU]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_Y55 from Stanford:

YPL127C_Y55 [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_YJM269 from WashU:

YPL127C_YJM269 [source=WashU]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_YJM339 from Stanford:

YPL127C_YJM339 [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_YJM789 from Stanford:

YPL127C_YJM789 [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 103  ..

       1  MAPKKSITKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKKATTSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_YPH499 from Stanford:

YPL127C_YPH499 [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_YPS128 from Stanford:

YPL127C_YPS128 [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_YPS163 from Stanford:

YPL127C_YPS163 [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_YS9 from Stanford:

YPL127C_YS9 [source=Stanford]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*

Protein Sequence for YPL127C_ZTW1 from Zhejiang:

YPL127C_ZTW1 [source=Zhejiang]  Length: 259  Sun Feb 25 15:28:05 2018  Type: P  Check: 9869  ..

       1  MAPKKSTTKT TSKGKKPATS KGKEKSTSKA AIKKTTAKKE EASSKSYREL

      51  IIEGLTALKE RKGSSRPALK KFIKENYPIV GSASNFDLYF NNAIKKGVEA

     101  GDFEQPKGPA GAVKLAKKKS PEVKKEKEVS PKPKQAATSV SATASKAKAA

     151  STKLAPKKVV KKKSPTVTAK KASSPSSLTY KEMILKSMPQ LNDGKGSSRI

     201  VLKKYVKDTF SSKLKTSSNF DYLFNSAIKK CVENGELVQP KGPSGIIKLN

     251  KKKVKLST*