MNN9/YPL050C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YPL050C_S288C   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_AWRI1631   1   -------------------------------------------MASPFPN   7
YPL050C_AWRI796   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFPREINLCWDLMASPFPN   50
YPL050C_BC187   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_BY4741   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_BY4742   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_CEN.PK   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_D273-10B   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_DBVPG6044   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_EC1118   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_EC9-8   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_FL100   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_FY1679   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_FostersB   
   --------------------------------------------------   
YPL050C_FostersO   1   -------------------------------------------MASPFPN   7
YPL050C_JAY291   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_JK9-3d   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_K11   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_Kyokai7   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_L1528   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_LalvinQA23   
   --------------------------------------------------   
YPL050C_PW5   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_RedStar   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_SEY6210   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_SK1   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_T7   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_T73   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_UC5   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_UWOPS05_217_3   
   --------------------------------------------------   
YPL050C_VL3   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_Vin13   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_W303   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_X2180-1A   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_Y55   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_YJM339   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_YJM789   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_YPH499   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_YPS128   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_YS9   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
YPL050C_ZTW1   1   MSLSLVSYRLRKNPWVNIFLPVLAIFLIYIIFFQRDQSLLG-LNGQSISQ   49
         

YPL050C_S288C   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_AWRI1631   8   TNGHTKRKTHFIFPSPRNTKCQSTLIRKKDGWLFNDHVEDIIPEGHIAHY   57
YPL050C_AWRI796   51   TNGHTKRKTHFIFPSPRNTKCQSTLIRKKDGWLFNDHVEDIIPEGHIAHY   100
YPL050C_BC187   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_BY4741   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_BY4742   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_CEN.PK   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_D273-10B   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_DBVPG6044   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_EC1118   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_EC9-8   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_FL100   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_FY1679   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_FostersB   
   --------------------------------------------------   
YPL050C_FostersO   8   TNGHTKRKTHFIFPSXRNTKCQSTLIRKKXGWLFNDHVEDIIPEGHIAHY   57
YPL050C_JAY291   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_JK9-3d   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_K11   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_Kyokai7   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_L1528   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_LalvinQA23   1   -MGTRKGKHILFSLHQEITKCQSTLIRKKXGWLFNDHVEDIIPEGHIAHY   49
YPL050C_PW5   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_RedStar   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_SEY6210   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_SK1   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_T7   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_T73   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_UC5   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_UWOPS05_217_3   1   --------------------MPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   30
YPL050C_VL3   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_Vin13   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_W303   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_X2180-1A   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_Y55   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_YJM339   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_YJM789   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_YPH499   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_YPS128   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_YS9   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
YPL050C_ZTW1   50   HKWAHEKENTFYFPFTKKYKMPKYSYKKKSGWLFNDHVEDIIPEGHIAHY   99
         

YPL050C_S288C   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_AWRI1631   58   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   107
YPL050C_AWRI796   101   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   150
YPL050C_BC187   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_BY4741   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_BY4742   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_CEN.PK   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_D273-10B   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_DBVPG6044   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_EC1118   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_EC9-8   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_FL100   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_FY1679   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_FostersB   
   --------------------------------------------------   
YPL050C_FostersO   58   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   107
YPL050C_JAY291   100   DLNKLHSTSEAAINKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_JK9-3d   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_K11   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_Kyokai7   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_L1528   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_LalvinQA23   50   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   99
YPL050C_PW5   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_RedStar   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_SEY6210   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_SK1   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_T7   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_T73   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLKLNYPRELIELGFI   149
YPL050C_UC5   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_UWOPS05_217_3   31   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   80
YPL050C_VL3   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_Vin13   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_W303   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_X2180-1A   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_Y55   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_YJM339   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_YJM789   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_YPH499   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_YPS128   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_YS9   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
YPL050C_ZTW1   100   DLNKLHSTSEAAVNKEHILILTPMQTFHQQYWDNLLQLNYPRELIELGFI   149
         

YPL050C_S288C   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_AWRI1631   108   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   157
YPL050C_AWRI796   151   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   200
YPL050C_BC187   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_BY4741   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_BY4742   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_CEN.PK   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_D273-10B   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_DBVPG6044   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_EC1118   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_EC9-8   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_FL100   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_FY1679   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_FostersB   1   ---------------MLLKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   35
YPL050C_FostersO   108   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   157
YPL050C_JAY291   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_JK9-3d   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_K11   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_Kyokai7   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_L1528   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_LalvinQA23   100   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   149
YPL050C_PW5   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_RedStar   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_SEY6210   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_SK1   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_T7   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_T73   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_UC5   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_UWOPS05_217_3   81   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   130
YPL050C_VL3   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_Vin13   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_W303   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_X2180-1A   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_Y55   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_YJM339   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_YJM789   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_YPH499   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_YPS128   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_YS9   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
YPL050C_ZTW1   150   TPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKE   199
         

YPL050C_S288C   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_AWRI1631   158   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   207
YPL050C_AWRI796   201   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   250
YPL050C_BC187   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_BY4741   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_BY4742   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_CEN.PK   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_D273-10B   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_DBVPG6044   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_EC1118   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_EC9-8   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_FL100   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_FY1679   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_FostersB   36   RHALDVQKERRATMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   85
YPL050C_FostersO   158   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   207
YPL050C_JAY291   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_JK9-3d   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_K11   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_Kyokai7   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_L1528   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_LalvinQA23   150   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   199
YPL050C_PW5   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_RedStar   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_SEY6210   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_SK1   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_T7   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_T73   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_UC5   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_UWOPS05_217_3   131   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPFLIQD   180
YPL050C_VL3   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_Vin13   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_W303   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_X2180-1A   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_Y55   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_YJM339   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_YJM789   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_YPH499   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_YPS128   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_YS9   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
YPL050C_ZTW1   200   RHALDVQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQD   249
         

YPL050C_S288C   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_AWRI1631   208   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   257
YPL050C_AWRI796   251   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   300
YPL050C_BC187   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_BY4741   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_BY4742   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_CEN.PK   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_D273-10B   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_DBVPG6044   250   MTKHNKAVLAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_EC1118   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_EC9-8   250   MTKHNKAVLAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_FL100   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_FY1679   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_FostersB   86   MTKHNKAVLAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   135
YPL050C_FostersO   208   MTKHNKAXLAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   257
YPL050C_JAY291   250   MTKHNKAVLAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_JK9-3d   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_K11   250   MTKHNKAVLAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_Kyokai7   250   MTKHNKAVLAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_L1528   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_LalvinQA23   200   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   249
YPL050C_PW5   250   MTKHNKAVLAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_RedStar   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_SEY6210   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_SK1   250   MTKHNKAVLAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_T7   250   MTKHNKAVLAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_T73   250   MTKHNKAVLAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_UC5   250   MTKHNKAVLAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_UWOPS05_217_3   181   MTKHNKAVLAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   230
YPL050C_VL3   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_Vin13   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_W303   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_X2180-1A   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_Y55   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_YJM339   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_YJM789   250   MTKHNKAVLAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_YPH499   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_YPS128   250   MTKHNKAVLAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_YS9   250   MTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
YPL050C_ZTW1   250   MTKHNKAVLAANIYQRFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGD   299
         

YPL050C_S288C   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_AWRI1631   258   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   307
YPL050C_AWRI796   301   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   350
YPL050C_BC187   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_BY4741   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_BY4742   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_CEN.PK   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_D273-10B   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_DBVPG6044   300   DEIIVEGYAEIATYRPLMAHFYDASGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_EC1118   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_EC9-8   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_FL100   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_FY1679   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_FostersB   136   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   185
YPL050C_FostersO   258   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   307
YPL050C_JAY291   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_JK9-3d   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_K11   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_Kyokai7   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_L1528   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_LalvinQA23   250   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   299
YPL050C_PW5   300   DEIIVEGYAEIATYRPLMAHFYDASGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_RedStar   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_SEY6210   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_SK1   300   DEIIVEGYAEIATYRPLMAHFYDASGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_T7   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_T73   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_UC5   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_UWOPS05_217_3   231   DEIIVEGYAEIATYRPLMAHFYDASGVPGEEMALDGVGGGCTLVKAEVHR   280
YPL050C_VL3   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_Vin13   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_W303   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_X2180-1A   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_Y55   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_YJM339   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_YJM789   300   DEIIVEGYAEIATYRPLMAHFYDASGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_YPH499   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_YPS128   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_YS9   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
YPL050C_ZTW1   300   DEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKAEVHR   349
         

YPL050C_S288C   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_AWRI1631   308   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   353
YPL050C_AWRI796   351   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   396
YPL050C_BC187   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_BY4741   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_BY4742   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_CEN.PK   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_D273-10B   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_DBVPG6044   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_EC1118   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_EC9-8   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_FL100   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_FY1679   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_FostersB   186   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   231
YPL050C_FostersO   308   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   353
YPL050C_JAY291   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_JK9-3d   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_K11   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_Kyokai7   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_L1528   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_LalvinQA23   300   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   345
YPL050C_PW5   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_RedStar   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_SEY6210   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_SK1   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_T7   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_T73   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_UC5   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_UWOPS05_217_3   281   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   326
YPL050C_VL3   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_Vin13   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_W303   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_X2180-1A   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_Y55   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_YJM339   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_YJM789   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_YPH499   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_YPS128   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_YS9   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
YPL050C_ZTW1   350   DGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEEENH   395
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YPL050C_S288C from SGD:

YPL050C_S288C [source=SGD]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_AWRI1631 from AWRI:

YPL050C_AWRI1631 [source=AWRI]  Length: 354  Sun Aug 19 12:37:17 2018  Type: P  Check: 5308  ..

       1  MASPFPNTNG HTKRKTHFIF PSPRNTKCQS TLIRKKDGWL FNDHVEDIIP

      51  EGHIAHYDLN KLHSTSEAAV NKEHILILTP MQTFHQQYWD NLLQLNYPRE

     101  LIELGFITPR TATGDLALKK LENAIKKVQT DKKTQRFSKI TILRQNSQSF

     151  DKLMEKERHA LDVQKERRAA MALARNELLF STIGPHTSWV LWLDADIIET

     201  PPSLIQDMTK HNKAILAANI YQRFYDEEKK QPSIRPYDFN NWQESDTGLE

     251  IASQMGDDEI IVEGYAEIAT YRPLMAHFYD ANGVPGEEMA LDGVGGGCTL

     301  VKAEVHRDGA MFPNFPFYHL IETEGFAKMA KRLNYDVFGL PNYLVYHIEE

     351  ENH*

Protein Sequence for YPL050C_AWRI796 from AWRI:

YPL050C_AWRI796 [source=AWRI]  Length: 397  Sun Aug 19 12:37:17 2018  Type: P  Check: 3786  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFPREINLC WDLMASPFPN

      51  TNGHTKRKTH FIFPSPRNTK CQSTLIRKKD GWLFNDHVED IIPEGHIAHY

     101  DLNKLHSTSE AAVNKEHILI LTPMQTFHQQ YWDNLLQLNY PRELIELGFI

     151  TPRTATGDLA LKKLENAIKK VQTDKKTQRF SKITILRQNS QSFDKLMEKE

     201  RHALDVQKER RAAMALARNE LLFSTIGPHT SWVLWLDADI IETPPSLIQD

     251  MTKHNKAILA ANIYQRFYDE EKKQPSIRPY DFNNWQESDT GLEIASQMGD

     301  DEIIVEGYAE IATYRPLMAH FYDANGVPGE EMALDGVGGG CTLVKAEVHR

     351  DGAMFPNFPF YHLIETEGFA KMAKRLNYDV FGLPNYLVYH IEEENH*


Protein Sequence for YPL050C_BC187 from Stanford:

YPL050C_BC187 [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_BY4741 from Stanford:

YPL050C_BY4741 [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_BY4742 from Stanford:

YPL050C_BY4742 [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_CEN.PK from Stanford:

YPL050C_CEN.PK [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_D273-10B from Stanford:

YPL050C_D273-10B [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_DBVPG6044 from Stanford:

YPL050C_DBVPG6044 [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 517  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAVLAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDASGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_EC1118 from Genoscope:

YPL050C_EC1118 [source=Genoscope]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_EC9-8 from ASinica:

YPL050C_EC9-8 [source=ASinica]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 322  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAVLAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_FL100 from Stanford:

YPL050C_FL100 [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_FY1679 from Stanford:

YPL050C_FY1679 [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_FostersB from AWRI:

YPL050C_FostersB [source=AWRI]  Length: 232  Sun Aug 19 12:37:17 2018  Type: P  Check: 9609  ..

       1  MLLKKVQTDK KTQRFSKITI LRQNSQSFDK LMEKERHALD VQKERRATMA

      51  LARNELLFST IGPHTSWVLW LDADIIETPP SLIQDMTKHN KAVLAANIYQ

     101  RFYDEEKKQP SIRPYDFNNW QESDTGLEIA SQMGDDEIIV EGYAEIATYR

     151  PLMAHFYDAN GVPGEEMALD GVGGGCTLVK AEVHRDGAMF PNFPFYHLIE

     201  TEGFAKMAKR LNYDVFGLPN YLVYHIEEEN H*

Protein Sequence for YPL050C_FostersO from AWRI:

YPL050C_FostersO [source=AWRI]  Length: 354  Sun Aug 19 12:37:17 2018  Type: P  Check: 6892  ..

       1  MASPFPNTNG HTKRKTHFIF PSXRNTKCQS TLIRKKXGWL FNDHVEDIIP

      51  EGHIAHYDLN KLHSTSEAAV NKEHILILTP MQTFHQQYWD NLLQLNYPRE

     101  LIELGFITPR TATGDLALKK LENAIKKVQT DKKTQRFSKI TILRQNSQSF

     151  DKLMEKERHA LDVQKERRAA MALARNELLF STIGPHTSWV LWLDADIIET

     201  PPSLIQDMTK HNKAXLAANI YQRFYDEEKK QPSIRPYDFN NWQESDTGLE

     251  IASQMGDDEI IVEGYAEIAT YRPLMAHFYD ANGVPGEEMA LDGVGGGCTL

     301  VKAEVHRDGA MFPNFPFYHL IETEGFAKMA KRLNYDVFGL PNYLVYHIEE

     351  ENH*

Protein Sequence for YPL050C_JAY291 from Duke:

YPL050C_JAY291 [source=Duke]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9607  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AINKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAVLAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_JK9-3d from Stanford:

YPL050C_JK9-3d [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_K11 from Stanford:

YPL050C_K11 [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 322  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAVLAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_Kyokai7 from NRIB:

YPL050C_Kyokai7 [source=NRIB]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 322  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAVLAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_L1528 from Stanford:

YPL050C_L1528 [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_LalvinQA23 from AWRI:

YPL050C_LalvinQA23 [source=AWRI]  Length: 346  Sun Aug 19 12:37:17 2018  Type: P  Check: 8482  ..

       1  MGTRKGKHIL FSLHQEITKC QSTLIRKKXG WLFNDHVEDI IPEGHIAHYD

      51  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     101  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     151  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     201  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     251  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     301  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_PW5 from WashU:

YPL050C_PW5 [source=WashU]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 517  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAVLAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDASGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_RedStar from Stanford:

YPL050C_RedStar [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_SEY6210 from Stanford:

YPL050C_SEY6210 [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_SK1 from Stanford:

YPL050C_SK1 [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 517  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAVLAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDASGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_T7 from WashU:

YPL050C_T7 [source=WashU]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 322  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAVLAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_T73 from WashU:

YPL050C_T73 [source=WashU]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 190  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLKLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAVLAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_UC5 from WashU:

YPL050C_UC5 [source=WashU]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 322  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAVLAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_UWOPS05_217_3 from Stanford:

YPL050C_UWOPS05_217_3 [source=Stanford]  Length: 327  Sun Aug 19 12:37:17 2018  Type: P  Check: 1777  ..

       1  MPKYSYKKKS GWLFNDHVED IIPEGHIAHY DLNKLHSTSE AAVNKEHILI

      51  LTPMQTFHQQ YWDNLLQLNY PRELIELGFI TPRTATGDLA LKKLENAIKK

     101  VQTDKKTQRF SKITILRQNS QSFDKLMEKE RHALDVQKER RAAMALARNE

     151  LLFSTIGPHT SWVLWLDADI IETPPFLIQD MTKHNKAVLA ANIYQRFYDE

     201  EKKQPSIRPY DFNNWQESDT GLEIASQMGD DEIIVEGYAE IATYRPLMAH

     251  FYDASGVPGE EMALDGVGGG CTLVKAEVHR DGAMFPNFPF YHLIETEGFA

     301  KMAKRLNYDV FGLPNYLVYH IEEENH*

Protein Sequence for YPL050C_VL3 from AWRI:

YPL050C_VL3 [source=AWRI]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_Vin13 from AWRI:

YPL050C_Vin13 [source=AWRI]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_W303 from Stanford:

YPL050C_W303 [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_X2180-1A from Stanford:

YPL050C_X2180-1A [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_Y55 from Stanford:

YPL050C_Y55 [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_YJM339 from Stanford:

YPL050C_YJM339 [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_YJM789 from Stanford:

YPL050C_YJM789 [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 517  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAVLAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDASGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_YPH499 from Stanford:

YPL050C_YPH499 [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_YPS128 from Stanford:

YPL050C_YPS128 [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 322  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAVLAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_YS9 from Stanford:

YPL050C_YS9 [source=Stanford]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 9945  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAILAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*


Protein Sequence for YPL050C_ZTW1 from Zhejiang:

YPL050C_ZTW1 [source=Zhejiang]  Length: 396  Sun Aug 19 12:37:17 2018  Type: P  Check: 322  ..

       1  MSLSLVSYRL RKNPWVNIFL PVLAIFLIYI IFFQRDQSLL GLNGQSISQH

      51  KWAHEKENTF YFPFTKKYKM PKYSYKKKSG WLFNDHVEDI IPEGHIAHYD

     101  LNKLHSTSEA AVNKEHILIL TPMQTFHQQY WDNLLQLNYP RELIELGFIT

     151  PRTATGDLAL KKLENAIKKV QTDKKTQRFS KITILRQNSQ SFDKLMEKER

     201  HALDVQKERR AAMALARNEL LFSTIGPHTS WVLWLDADII ETPPSLIQDM

     251  TKHNKAVLAA NIYQRFYDEE KKQPSIRPYD FNNWQESDTG LEIASQMGDD

     301  EIIVEGYAEI ATYRPLMAHF YDANGVPGEE MALDGVGGGC TLVKAEVHRD

     351  GAMFPNFPFY HLIETEGFAK MAKRLNYDVF GLPNYLVYHI EEENH*