ALD4/YOR374W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YOR374W_S288C   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_AWRI1631   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_AWRI796   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_BC187   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_BY4741   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_BY4742   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_CEN.PK   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_D273-10B   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_DBVPG6044   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_EC1118   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_EC9-8   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_FL100   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_FY1679   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_FostersB   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_FostersO   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_JAY291   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_JK9-3d   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_K11   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_Kyokai7   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_L1528   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_LalvinQA23   1   MFSRSTLCLKTSASSIGXLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_PW5   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_RM11-1a   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_RedStar   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_SEY6210   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_SK1   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_T7   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_T73   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPITVPIKLPNGLEYEQPTGLFIN   50
YOR374W_UC5   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_VL3   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_Vin13   1   MFSRSTLCLKTSASSIGGLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_W303   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_X2180-1A   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_Y55   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_YJM339   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_YJM789   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_YPH499   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_YPS128   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_YPS163   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_YS9   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
YOR374W_ZTW1   1   MFSRSTLCLKTSASSIGRLQLRYFSHLPMTVPIKLPNGLEYEQPTGLFIN   50
         

YOR374W_S288C   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_AWRI1631   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_AWRI796   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_BC187   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_BY4741   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_BY4742   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_CEN.PK   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_D273-10B   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_DBVPG6044   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_EC1118   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_EC9-8   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_FL100   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_FY1679   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_FostersB   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_FostersO   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_JAY291   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_JK9-3d   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_K11   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_Kyokai7   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_L1528   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_LalvinQA23   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_PW5   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_RM11-1a   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_RedStar   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_SEY6210   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_SK1   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_T7   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_T73   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_UC5   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_VL3   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_Vin13   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_W303   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_X2180-1A   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_Y55   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_YJM339   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_YJM789   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_YPH499   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_YPS128   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_YPS163   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_YS9   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
YOR374W_ZTW1   51   NKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSW   100
         

YOR374W_S288C   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_AWRI1631   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_AWRI796   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_BC187   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_BY4741   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_BY4742   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_CEN.PK   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_D273-10B   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_DBVPG6044   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_EC1118   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_EC9-8   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_FL100   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_FY1679   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_FostersB   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_FostersO   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_JAY291   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_JK9-3d   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_K11   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_Kyokai7   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_L1528   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_LalvinQA23   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_PW5   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_RM11-1a   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_RedStar   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_SEY6210   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_SK1   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_T7   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_T73   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_UC5   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_VL3   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_Vin13   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_W303   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_X2180-1A   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_Y55   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_YJM339   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_YJM789   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_YPH499   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_YPS128   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_YPS163   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_YS9   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
YOR374W_ZTW1   101   NGIDPIDRGKALYRLAELIEQDKDVIASIETLDNGKAISSSRGDVDLVIN   150
         

YOR374W_S288C   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_AWRI1631   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_AWRI796   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_BC187   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_BY4741   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_BY4742   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_CEN.PK   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_D273-10B   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_DBVPG6044   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_EC1118   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_EC9-8   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_FL100   151   YLKSSAGFADKIDGKMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_FY1679   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_FostersB   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_FostersO   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_JAY291   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_JK9-3d   151   YLKSSAGFADKIDGKMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_K11   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_Kyokai7   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_L1528   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_LalvinQA23   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_PW5   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_RM11-1a   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_RedStar   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_SEY6210   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_SK1   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_T7   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_T73   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_UC5   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_VL3   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_Vin13   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_W303   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_X2180-1A   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_Y55   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_YJM339   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_YJM789   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_YPH499   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_YPS128   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_YPS163   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_YS9   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
YOR374W_ZTW1   151   YLKSSAGFADKIDGRMIDTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAW   200
         

YOR374W_S288C   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_AWRI1631   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_AWRI796   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_BC187   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_BY4741   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_BY4742   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_CEN.PK   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_D273-10B   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_DBVPG6044   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_EC1118   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_EC9-8   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_FL100   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_FY1679   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_FostersB   201   KIAPALVTGNTVVLKTAESTPLSALYASKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_FostersO   201   KIAPALVTXNTVVLKTAESTPFVRFVCV----------------------   228
YOR374W_JAY291   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_JK9-3d   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_K11   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_Kyokai7   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_L1528   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_LalvinQA23   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_PW5   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_RM11-1a   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_RedStar   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_SEY6210   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_SK1   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_T7   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_T73   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_UC5   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_VL3   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_Vin13   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_W303   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_X2180-1A   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_Y55   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_YJM339   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_YJM789   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_YPH499   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_YPS128   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_YPS163   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_YS9   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
YOR374W_ZTW1   201   KIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGKI   250
         

YOR374W_S288C   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_AWRI1631   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_AWRI796   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_BC187   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_BY4741   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_BY4742   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_CEN.PK   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_D273-10B   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_DBVPG6044   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_EC1118   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_EC9-8   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_FL100   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_FY1679   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_FostersB   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_FostersO   
   --------------------------------------------------   
YOR374W_JAY291   251   VGEAITNHPKNQKGCLHRVHGYG---------------------------   273
YOR374W_JK9-3d   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_K11   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_Kyokai7   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_L1528   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_LalvinQA23   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_PW5   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_RM11-1a   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_RedStar   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_SEY6210   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_SK1   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_T7   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_T73   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_UC5   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_VL3   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_Vin13   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_W303   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_X2180-1A   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_Y55   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_YJM339   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_YJM789   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_YPH499   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_YPS128   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_YPS163   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_YS9   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
YOR374W_ZTW1   251   VGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVF   300
         

YOR374W_S288C   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_AWRI1631   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_AWRI796   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_BC187   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_BY4741   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_BY4742   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_CEN.PK   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_D273-10B   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_DBVPG6044   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_EC1118   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_EC9-8   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKVASES   350
YOR374W_FL100   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_FY1679   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_FostersB   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_FostersO   
   --------------------------------------------------   
YOR374W_JAY291   
   --------------------------------------------------   
YOR374W_JK9-3d   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_K11   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_Kyokai7   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_L1528   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_LalvinQA23   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_PW5   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_RM11-1a   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_RedStar   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_SEY6210   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_SK1   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_T7   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_T73   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_UC5   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_VL3   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_Vin13   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_W303   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_X2180-1A   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_Y55   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_YJM339   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_YJM789   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_YPH499   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_YPS128   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_YPS163   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_YS9   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
YOR374W_ZTW1   301   ADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASES   350
         

YOR374W_S288C   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_AWRI1631   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_AWRI796   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_BC187   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_BY4741   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_BY4742   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_CEN.PK   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_D273-10B   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_DBVPG6044   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_EC1118   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_EC9-8   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_FL100   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_FY1679   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_FostersB   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_FostersO   
   --------------------------------------------------   
YOR374W_JAY291   
   --------------------------------------------------   
YOR374W_JK9-3d   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_K11   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_Kyokai7   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_L1528   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_LalvinQA23   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_PW5   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_RM11-1a   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_RedStar   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_SEY6210   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_SK1   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_T7   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_T73   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_UC5   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_VL3   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_Vin13   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_W303   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_X2180-1A   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_Y55   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_YJM339   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_YJM789   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_YPH499   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_YPS128   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_YPS163   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_YS9   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
YOR374W_ZTW1   351   IKVGDPFDESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKG   400
         

YOR374W_S288C   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_AWRI1631   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEIINMANDSEYGLA   450
YOR374W_AWRI796   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_BC187   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_BY4741   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_BY4742   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_CEN.PK   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_D273-10B   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_DBVPG6044   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_EC1118   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_EC9-8   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_FL100   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_FY1679   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_FostersB   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_FostersO   
   --------------------------------------------------   
YOR374W_JAY291   
   --------------------------------------------------   
YOR374W_JK9-3d   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_K11   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_Kyokai7   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_L1528   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_LalvinQA23   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_PW5   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_RM11-1a   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_RedStar   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_SEY6210   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_SK1   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_T7   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_T73   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_UC5   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_VL3   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEXINMANDSEYGLA   450
YOR374W_Vin13   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_W303   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_X2180-1A   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_Y55   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_YJM339   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_YJM789   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_YPH499   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_YPS128   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_YPS163   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_YS9   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
YOR374W_ZTW1   401   YFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLA   450
         

YOR374W_S288C   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_AWRI1631   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_AWRI796   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_BC187   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_BY4741   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_BY4742   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_CEN.PK   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_D273-10B   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_DBVPG6044   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_EC1118   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_EC9-8   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_FL100   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_FY1679   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_FostersB   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_FostersO   
   --------------------------------------------------   
YOR374W_JAY291   
   --------------------------------------------------   
YOR374W_JK9-3d   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_K11   451   AGIHTSNINTALKVADRVTAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_Kyokai7   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_L1528   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_LalvinQA23   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_PW5   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_RM11-1a   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_RedStar   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_SEY6210   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_SK1   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_T7   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_T73   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_UC5   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_VL3   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_Vin13   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_W303   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_X2180-1A   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_Y55   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_YJM339   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_YJM789   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_YPH499   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_YPS128   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_YPS163   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_YS9   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
YOR374W_ZTW1   451   AGIHTSNINTALKVADRVNAGTVWINTYNDFHHAVPFGGFNASGLGREMS   500
         

YOR374W_S288C   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_AWRI1631   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_AWRI796   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_BC187   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_BY4741   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_BY4742   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_CEN.PK   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_D273-10B   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_DBVPG6044   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_EC1118   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_EC9-8   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_FL100   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_FY1679   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_FostersB   501   VDALQNYLQVKXVRAKLDE   519
YOR374W_FostersO   
   -------------------   
YOR374W_JAY291   
   -------------------   
YOR374W_JK9-3d   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_K11   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_Kyokai7   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_L1528   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_LalvinQA23   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_PW5   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_RM11-1a   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_RedStar   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_SEY6210   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_SK1   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_T7   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_T73   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_UC5   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_VL3   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_Vin13   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_W303   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_X2180-1A   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_Y55   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_YJM339   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_YJM789   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_YPH499   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_YPS128   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_YPS163   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_YS9   501   VDALQNYLQVKAVRAKLDE   519
YOR374W_ZTW1   501   VDALQNYLQVKAVRAKLDE   519
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YOR374W_S288C from SGD:

YOR374W_S288C [source=SGD]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_AWRI1631 from AWRI:

YOR374W_AWRI1631 [source=AWRI]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2437  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEIIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_AWRI796 from AWRI:

YOR374W_AWRI796 [source=AWRI]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_BC187 from Stanford:

YOR374W_BC187 [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_BY4741 from Stanford:

YOR374W_BY4741 [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_BY4742 from Stanford:

YOR374W_BY4742 [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_CEN.PK from Stanford:

YOR374W_CEN.PK [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_D273-10B from Stanford:

YOR374W_D273-10B [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_DBVPG6044 from Stanford:

YOR374W_DBVPG6044 [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_EC1118 from Genoscope:

YOR374W_EC1118 [source=Genoscope]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_EC9-8 from ASinica:

YOR374W_EC9-8 [source=ASinica]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 3028  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKVASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_FL100 from Stanford:

YOR374W_FL100 [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2587  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGKMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_FY1679 from Stanford:

YOR374W_FY1679 [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_FostersB from AWRI:

YOR374W_FostersB [source=AWRI]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 3056  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYASKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KXVRAKLDE*

Protein Sequence for YOR374W_FostersO from AWRI:

YOR374W_FostersO [source=AWRI]  Length: 229  Sun Sep 24 11:33:34 2017  Type: P  Check: 5215  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTXN TVVLKTAEST PFVRFVCV*

Protein Sequence for YOR374W_JAY291 from Duke:

YOR374W_JAY291 [source=Duke]  Length: 274  Sun Sep 24 11:33:34 2017  Type: P  Check: 5623  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK NQKGCLHRVH GYG*

Protein Sequence for YOR374W_JK9-3d from Stanford:

YOR374W_JK9-3d [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2587  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGKMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_K11 from Stanford:

YOR374W_K11 [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 3022  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVTA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_Kyokai7 from NRIB:

YOR374W_Kyokai7 [source=NRIB]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_L1528 from Stanford:

YOR374W_L1528 [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_LalvinQA23 from AWRI:

YOR374W_LalvinQA23 [source=AWRI]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 3052  ..

       1  MFSRSTLCLK TSASSIGXLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_PW5 from WashU:

YOR374W_PW5 [source=WashU]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_RM11-1a from Stanford:

YOR374W_RM11-1a [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_RedStar from Stanford:

YOR374W_RedStar [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_SEY6210 from Stanford:

YOR374W_SEY6210 [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_SK1 from Stanford:

YOR374W_SK1 [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_T7 from WashU:

YOR374W_T7 [source=WashU]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_T73 from WashU:

YOR374W_T73 [source=WashU]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2828  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPIT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_UC5 from WashU:

YOR374W_UC5 [source=WashU]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_VL3 from AWRI:

YOR374W_VL3 [source=AWRI]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 3022  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEXIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_Vin13 from AWRI:

YOR374W_Vin13 [source=AWRI]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2746  ..

       1  MFSRSTLCLK TSASSIGGLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_W303 from Stanford:

YOR374W_W303 [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_X2180-1A from Stanford:

YOR374W_X2180-1A [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_Y55 from Stanford:

YOR374W_Y55 [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_YJM339 from Stanford:

YOR374W_YJM339 [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_YJM789 from Stanford:

YOR374W_YJM789 [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_YPH499 from Stanford:

YOR374W_YPH499 [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_YPS128 from Stanford:

YOR374W_YPS128 [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_YPS163 from Stanford:

YOR374W_YPS163 [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_YS9 from Stanford:

YOR374W_YS9 [source=Stanford]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*

Protein Sequence for YOR374W_ZTW1 from Zhejiang:

YOR374W_ZTW1 [source=Zhejiang]  Length: 520  Sun Sep 24 11:33:34 2017  Type: P  Check: 2944  ..

       1  MFSRSTLCLK TSASSIGRLQ LRYFSHLPMT VPIKLPNGLE YEQPTGLFIN

      51  NKFVPSKQNK TFEVINPSTE EEICHIYEGR EDDVEEAVQA ADRAFSNGSW

     101  NGIDPIDRGK ALYRLAELIE QDKDVIASIE TLDNGKAISS SRGDVDLVIN

     151  YLKSSAGFAD KIDGRMIDTG RTHFSYTKRQ PLGVCGQIIP WNFPLLMWAW

     201  KIAPALVTGN TVVLKTAEST PLSALYVSKY IPQAGIPPGV INIVSGFGKI

     251  VGEAITNHPK IKKVAFTGST ATGRHIYQSA AAGLKKVTLE LGGKSPNIVF

     301  ADAELKKAVQ NIILGIYYNS GEVCCAGSRV YVEESIYDKF IEEFKAASES

     351  IKVGDPFDES TFQGAQTSQM QLNKILKYVD IGKNEGATLI TGGERLGSKG

     401  YFIKPTVFGD VKEDMRIVKE EIFGPVVTVT KFKSADEVIN MANDSEYGLA

     451  AGIHTSNINT ALKVADRVNA GTVWINTYND FHHAVPFGGF NASGLGREMS

     501  VDALQNYLQV KAVRAKLDE*