YOR335W-A S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YOR335W-A_S288C   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_AWRI1631   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_AWRI796   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_CBS7960   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_CLIB215   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_CLIB324   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_EC1118   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_EC9-8   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_FostersB   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_FostersO   1   MEHSHWFRKMSSLHQEFVCFLFLALDLTSSFTAFSILLNFCFSSFFVITE   50
YOR335W-A_JAY291   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_Kyokai7   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_LalvinQA23   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_PW5   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_T7   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_T73   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_UC5   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_VL3   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_Vin13   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_Y10   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_YJM269   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_YJM789   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
YOR335W-A_ZTW1   1   MEHSHWFRKMSSLHQEFVCFLFWPLT------------------------   26
         

YOR335W-A_S288C   
   ---   
YOR335W-A_AWRI1631   
   ---   
YOR335W-A_AWRI796   
   ---   
YOR335W-A_CBS7960   
   ---   
YOR335W-A_CLIB215   
   ---   
YOR335W-A_CLIB324   
   ---   
YOR335W-A_EC1118   
   ---   
YOR335W-A_EC9-8   
   ---   
YOR335W-A_FostersB   
   ---   
YOR335W-A_FostersO   51   IES   53
YOR335W-A_JAY291   
   ---   
YOR335W-A_Kyokai7   
   ---   
YOR335W-A_LalvinQA23   
   ---   
YOR335W-A_PW5   
   ---   
YOR335W-A_T7   
   ---   
YOR335W-A_T73   
   ---   
YOR335W-A_UC5   
   ---   
YOR335W-A_VL3   
   ---   
YOR335W-A_Vin13   
   ---   
YOR335W-A_Y10   
   ---   
YOR335W-A_YJM269   
   ---   
YOR335W-A_YJM789   
   ---   
YOR335W-A_ZTW1   
   ---   
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YOR335W-A_S288C from SGD:

YOR335W-A_S288C [source=SGD]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_AWRI1631 from AWRI:

YOR335W-A_AWRI1631 [source=AWRI]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_AWRI796 from AWRI:

YOR335W-A_AWRI796 [source=AWRI]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_CBS7960 from WashU:

YOR335W-A_CBS7960 [source=WashU]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_CLIB215 from WashU:

YOR335W-A_CLIB215 [source=WashU]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_CLIB324 from WashU:

YOR335W-A_CLIB324 [source=WashU]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_EC1118 from Genoscope:

YOR335W-A_EC1118 [source=Genoscope]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_EC9-8 from ASinica:

YOR335W-A_EC9-8 [source=ASinica]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_FostersB from AWRI:

YOR335W-A_FostersB [source=AWRI]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_FostersO from AWRI:

YOR335W-A_FostersO [source=AWRI]  Length: 54  Fri Sep 22 12:31:42 2017  Type: P  Check: 110  ..

       1  MEHSHWFRKM SSLHQEFVCF LFLALDLTSS FTAFSILLNF CFSSFFVITE

      51  IES*

Protein Sequence for YOR335W-A_JAY291 from Duke:

YOR335W-A_JAY291 [source=Duke]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_Kyokai7 from NRIB:

YOR335W-A_Kyokai7 [source=NRIB]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_LalvinQA23 from AWRI:

YOR335W-A_LalvinQA23 [source=AWRI]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_PW5 from WashU:

YOR335W-A_PW5 [source=WashU]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_T7 from WashU:

YOR335W-A_T7 [source=WashU]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_T73 from WashU:

YOR335W-A_T73 [source=WashU]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_UC5 from WashU:

YOR335W-A_UC5 [source=WashU]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_VL3 from AWRI:

YOR335W-A_VL3 [source=AWRI]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_Vin13 from AWRI:

YOR335W-A_Vin13 [source=AWRI]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_Y10 from WashU:

YOR335W-A_Y10 [source=WashU]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_YJM269 from WashU:

YOR335W-A_YJM269 [source=WashU]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_YJM789 from Stanford:

YOR335W-A_YJM789 [source=Stanford]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*

Protein Sequence for YOR335W-A_ZTW1 from Zhejiang:

YOR335W-A_ZTW1 [source=Zhejiang]  Length: 27  Fri Sep 22 12:31:42 2017  Type: P  Check: 8146  ..

       1  MEHSHWFRKM SSLHQEFVCF LFWPLT*