SRL1/YOR247W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YOR247W_S288C   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_AWRI1631   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_AWRI796   1   MTPLLCLHHLLQQVSVTKIQTTKMQRSSPLNRLQLPMVASQSQSLSLSPM   50
YOR247W_BC187   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_BY4741   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_BY4742   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_CBS7960   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_CEN.PK   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_CLIB382   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_D273-10B   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_DBVPG6044   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_EC1118   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_EC9-8   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_FL100   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_FY1679   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_FostersB   1   MTPLLCLHHLLQQVSVTKIQTTKMQRSSPLNRLQLPMVASQSQSLSLSPM   50
YOR247W_FostersO   1   MTPLLCLHHLLQQVSVTKIQTTKMQRSSPLNRLQLPMVASQSQSLSLSPM   50
YOR247W_JAY291   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_JK9-3d   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_K11   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_Kyokai7   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_L1528   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_LalvinQA23   1   MTPLLCLHHLLQQVSVTKIQTTKMQRSSPLNRLQLPMVASQSQSLSLSPM   50
YOR247W_PW5   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_RM11-1a   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_RedStar   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_SEY6210   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_SK1   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_T7   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_T73   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_UC5   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_UWOPS05_217_3   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_VL3   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_Vin13   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_W303   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_X2180-1A   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_Y55   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_YJM269   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_YJM339   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_YJM789   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_YPH499   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_YPS128   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_YPS163   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
YOR247W_ZTW1   1   MLQSVVFFALLTFASSVSAIYSNNTVSTTTTLAPSYSLVPQETTISYADD   50
         

YOR247W_S288C   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_AWRI1631   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_AWRI796   51   SPLPSTLQSPQIRLLNTLLSPVHLLLP-----------------------   77
YOR247W_BC187   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_BY4741   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_BY4742   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_CBS7960   51   TTTFFCHLNGLLHELVHLNFSHH---------------------------   73
YOR247W_CEN.PK   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_CLIB382   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_D273-10B   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_DBVPG6044   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_EC1118   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_EC9-8   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_FL100   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_FY1679   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_FostersB   51   SPLPSTLQSPQIRLLNTLLSPVHLLLP-----------------------   77
YOR247W_FostersO   51   SPLPSTLQSPQIRLLNTLLSPVHLLLP-----------------------   77
YOR247W_JAY291   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_JK9-3d   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_K11   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_Kyokai7   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_L1528   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_LalvinQA23   51   SPLPSTLQSPQIRLLNTLLSPVHLLLP-----------------------   77
YOR247W_PW5   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_RM11-1a   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_RedStar   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_SEY6210   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_SK1   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_T7   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_T73   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_UC5   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_UWOPS05_217_3   51   TTTFFVTSTVYSTSWFTSTSATITDAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_VL3   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_Vin13   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_W303   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_X2180-1A   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_Y55   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_YJM269   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_YJM339   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_YJM789   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_YPH499   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_YPS128   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_YPS163   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
YOR247W_ZTW1   51   TTTFFVTSTVYSTSWFTSTSATITNAASSSLSTSSASGSVTPESTHEITS   100
         

YOR247W_S288C   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_AWRI1631   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_AWRI796   78   -----------------------------------------LPLQVTYNG   86
YOR247W_BC187   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_BY4741   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_BY4742   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_CBS7960   
   --------------------------------------------------   
YOR247W_CEN.PK   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_CLIB382   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_D273-10B   101   TSTITSTLLLTLHDSTTLSPSSAAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_DBVPG6044   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_EC1118   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_EC9-8   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_FL100   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_FY1679   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_FostersB   78   -----------------------------------------LPLQVTYNG   86
YOR247W_FostersO   78   -----------------------------------------LPLQVTYNG   86
YOR247W_JAY291   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_JK9-3d   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_K11   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_Kyokai7   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_L1528   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_LalvinQA23   78   -----------------------------------------LPLQVTYNG   86
YOR247W_PW5   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_RM11-1a   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_RedStar   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_SEY6210   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_SK1   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_T7   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_T73   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_UC5   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_UWOPS05_217_3   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_VL3   101   TSTITSTLLLTLHDSTTLSPSSXAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_Vin13   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_W303   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_X2180-1A   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_Y55   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_YJM269   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_YJM339   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_YJM789   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_YPH499   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_YPS128   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_YPS163   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
YOR247W_ZTW1   101   TSTITSTLLLTLHDSTTLSPSSTAASVSDEDSNNKDAKVKSFEQASTSNG   150
         

YOR247W_S288C   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_AWRI1631   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_AWRI796   87   TTPLRLLIRPVGEL------------------------------------   100
YOR247W_BC187   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYLTVTGAPSVTTTSPGNVQWYN   200
YOR247W_BY4741   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_BY4742   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_CBS7960   
   --------------------------------------------------   
YOR247W_CEN.PK   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_CLIB382   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_D273-10B   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_DBVPG6044   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_EC1118   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_EC9-8   151   CVPITKFVTVTNQPVTQYVTVTPNMTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_FL100   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_FY1679   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_FostersB   87   TTPLRLLIXPVGEL------------------------------------   100
YOR247W_FostersO   87   TTPLRLLIRPVGEL------------------------------------   100
YOR247W_JAY291   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_JK9-3d   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_K11   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVNTTSPGNVQWYN   200
YOR247W_Kyokai7   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVNTTSPGNVQWYN   200
YOR247W_L1528   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_LalvinQA23   87   TTPLRLLIRPVGEL------------------------------------   100
YOR247W_PW5   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_RM11-1a   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYLTVTGAPSVTTTSPGNVQWYN   200
YOR247W_RedStar   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_SEY6210   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_SK1   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_T7   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_T73   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_UC5   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVNTTSPGNVQWYN   200
YOR247W_UWOPS05_217_3   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_VL3   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_Vin13   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_W303   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_X2180-1A   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_Y55   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_YJM269   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_YJM339   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_YJM789   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_YPH499   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_YPS128   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_YPS163   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
YOR247W_ZTW1   151   CVPITKFVTVTNEPVTQYVTVTPNTTTQYVTVTGAPSVTTTSPGNVQWYN   200
         

YOR247W_S288C   201   TTSITNSTSW   210
YOR247W_AWRI1631   201   TTSITNSTSW   210
YOR247W_AWRI796   
   ----------   
YOR247W_BC187   201   TTSITNSTSW   210
YOR247W_BY4741   201   TTSITNSTSW   210
YOR247W_BY4742   201   TTSITNSTSW   210
YOR247W_CBS7960   
   ----------   
YOR247W_CEN.PK   201   TTSITNSTSW   210
YOR247W_CLIB382   201   TTSITNSTSW   210
YOR247W_D273-10B   201   TTSITNSTSW   210
YOR247W_DBVPG6044   201   TTSITNSTSW   210
YOR247W_EC1118   201   TTSITNSTSW   210
YOR247W_EC9-8   201   TTSITNSTSW   210
YOR247W_FL100   201   TTSITNSTSW   210
YOR247W_FY1679   201   TTSITNSTSW   210
YOR247W_FostersB   
   ----------   
YOR247W_FostersO   
   ----------   
YOR247W_JAY291   201   TTSITNSTSW   210
YOR247W_JK9-3d   201   TTSITNSTSW   210
YOR247W_K11   201   TTSITNSTSW   210
YOR247W_Kyokai7   201   TTSITNSTSW   210
YOR247W_L1528   201   TTSITNSTSW   210
YOR247W_LalvinQA23   
   ----------   
YOR247W_PW5   201   TTSITNSTSW   210
YOR247W_RM11-1a   201   TTSITNSTSW   210
YOR247W_RedStar   201   TTSITNSTSW   210
YOR247W_SEY6210   201   TTSITNSTSW   210
YOR247W_SK1   201   TTSITNSTSW   210
YOR247W_T7   201   TTSITNSTSW   210
YOR247W_T73   201   TTSITNSTSW   210
YOR247W_UC5   201   TTSITNSTSW   210
YOR247W_UWOPS05_217_3   201   TTSITNSTSW   210
YOR247W_VL3   201   TTSITNSTSW   210
YOR247W_Vin13   201   TTSITNSTSW   210
YOR247W_W303   201   TTSITNSTSW   210
YOR247W_X2180-1A   201   TTSITNSTSW   210
YOR247W_Y55   201   TTSITNSTSW   210
YOR247W_YJM269   201   TTSITNSTSW   210
YOR247W_YJM339   201   TTSITNSTSW   210
YOR247W_YJM789   201   TTSITNSTSW   210
YOR247W_YPH499   201   TTSITNSTSW   210
YOR247W_YPS128   201   TTSITNSTSW   210
YOR247W_YPS163   201   TTSITNSTSW   210
YOR247W_ZTW1   201   TTSITNSTSW   210
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YOR247W_S288C from SGD:

YOR247W_S288C [source=SGD]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_AWRI1631 from AWRI:

YOR247W_AWRI1631 [source=AWRI]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_AWRI796 from AWRI:

YOR247W_AWRI796 [source=AWRI]  Length: 101  Wed Feb 21 15:01:36 2018  Type: P  Check: 7878  ..

       1  MTPLLCLHHL LQQVSVTKIQ TTKMQRSSPL NRLQLPMVAS QSQSLSLSPM

      51  SPLPSTLQSP QIRLLNTLLS PVHLLLPLPL QVTYNGTTPL RLLIRPVGEL

     101  *

Protein Sequence for YOR247W_BC187 from Stanford:

YOR247W_BC187 [source=Stanford]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7356  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYL TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_BY4741 from Stanford:

YOR247W_BY4741 [source=Stanford]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_BY4742 from Stanford:

YOR247W_BY4742 [source=Stanford]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_CBS7960 from WashU:

YOR247W_CBS7960 [source=WashU]  Length: 74  Wed Feb 21 15:01:36 2018  Type: P  Check: 9993  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFCHLNG LLHELVHLNF SHH*

Protein Sequence for YOR247W_CEN.PK from Stanford:

YOR247W_CEN.PK [source=Stanford]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_CLIB382 from WashU:

YOR247W_CLIB382 [source=WashU]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_D273-10B from Stanford:

YOR247W_D273-10B [source=Stanford]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7275  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSAAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_DBVPG6044 from Stanford:

YOR247W_DBVPG6044 [source=Stanford]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_EC1118 from Genoscope:

YOR247W_EC1118 [source=Genoscope]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_EC9-8 from ASinica:

YOR247W_EC9-8 [source=ASinica]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 8006  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNQPVTQYVT VTPNMTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_FL100 from Stanford:

YOR247W_FL100 [source=Stanford]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_FY1679 from Stanford:

YOR247W_FY1679 [source=Stanford]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_FostersB from AWRI:

YOR247W_FostersB [source=AWRI]  Length: 101  Wed Feb 21 15:01:36 2018  Type: P  Check: 8106  ..

       1  MTPLLCLHHL LQQVSVTKIQ TTKMQRSSPL NRLQLPMVAS QSQSLSLSPM

      51  SPLPSTLQSP QIRLLNTLLS PVHLLLPLPL QVTYNGTTPL RLLIXPVGEL

     101  *

Protein Sequence for YOR247W_FostersO from AWRI:

YOR247W_FostersO [source=AWRI]  Length: 101  Wed Feb 21 15:01:36 2018  Type: P  Check: 7878  ..

       1  MTPLLCLHHL LQQVSVTKIQ TTKMQRSSPL NRLQLPMVAS QSQSLSLSPM

      51  SPLPSTLQSP QIRLLNTLLS PVHLLLPLPL QVTYNGTTPL RLLIRPVGEL

     101  *

Protein Sequence for YOR247W_JAY291 from Duke:

YOR247W_JAY291 [source=Duke]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_JK9-3d from Stanford:

YOR247W_JK9-3d [source=Stanford]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_K11 from Stanford:

YOR247W_K11 [source=Stanford]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7338  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVNT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_Kyokai7 from NRIB:

YOR247W_Kyokai7 [source=NRIB]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7338  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVNT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_L1528 from Stanford:

YOR247W_L1528 [source=Stanford]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_LalvinQA23 from AWRI:

YOR247W_LalvinQA23 [source=AWRI]  Length: 101  Wed Feb 21 15:01:36 2018  Type: P  Check: 7878  ..

       1  MTPLLCLHHL LQQVSVTKIQ TTKMQRSSPL NRLQLPMVAS QSQSLSLSPM

      51  SPLPSTLQSP QIRLLNTLLS PVHLLLPLPL QVTYNGTTPL RLLIRPVGEL

     101  *

Protein Sequence for YOR247W_PW5 from WashU:

YOR247W_PW5 [source=WashU]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_RM11-1a from Stanford:

YOR247W_RM11-1a [source=Stanford]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7356  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYL TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_RedStar from Stanford:

YOR247W_RedStar [source=Stanford]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_SEY6210 from Stanford:

YOR247W_SEY6210 [source=Stanford]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_SK1 from Stanford:

YOR247W_SK1 [source=Stanford]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_T7 from WashU:

YOR247W_T7 [source=WashU]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_T73 from WashU:

YOR247W_T73 [source=WashU]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_UC5 from WashU:

YOR247W_UC5 [source=WashU]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7338  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVNT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_UWOPS05_217_3 from Stanford:

YOR247W_UWOPS05_217_3 [source=Stanford]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7266  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITDAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_VL3 from AWRI:

YOR247W_VL3 [source=AWRI]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7482  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSXAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_Vin13 from AWRI:

YOR247W_Vin13 [source=AWRI]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_W303 from Stanford:

YOR247W_W303 [source=Stanford]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_X2180-1A from Stanford:

YOR247W_X2180-1A [source=Stanford]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_Y55 from Stanford:

YOR247W_Y55 [source=Stanford]  Length: 211  Wed Feb 21 15:01:36 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_YJM269 from WashU:

YOR247W_YJM269 [source=WashU]  Length: 211  Wed Feb 21 15:01:37 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_YJM339 from Stanford:

YOR247W_YJM339 [source=Stanford]  Length: 211  Wed Feb 21 15:01:37 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_YJM789 from Stanford:

YOR247W_YJM789 [source=Stanford]  Length: 211  Wed Feb 21 15:01:37 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_YPH499 from Stanford:

YOR247W_YPH499 [source=Stanford]  Length: 211  Wed Feb 21 15:01:37 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_YPS128 from Stanford:

YOR247W_YPS128 [source=Stanford]  Length: 211  Wed Feb 21 15:01:37 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_YPS163 from Stanford:

YOR247W_YPS163 [source=Stanford]  Length: 211  Wed Feb 21 15:01:37 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for YOR247W_ZTW1 from Zhejiang:

YOR247W_ZTW1 [source=Zhejiang]  Length: 211  Wed Feb 21 15:01:37 2018  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *